Search Results

Search found 8362 results on 335 pages for 'rainbow tables'.

Page 35/335 | < Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >

  • MySQL: how to convert many MyISAM tables to InnoDB in a production database?

    - by Continuation
    We have a production database that is made up entirely of MyISAM tables. We are considering converting them to InnoDB to gain better concurrency & reliability. Can I just alter the myISAM tables to InnoDB without shutting down MySQL? What are the recommend procedures here? How long will such a conversion take? All the tables have a total size of about 700MB There are quite a large number of tables. Is there any way to apply ALTER TABLE to all the MyISAM tables at once instead of doing it one by one? Any pitfalls I need to be aware of? Thank you

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Issues with "There is already an object named 'xxx' in the database'

    - by Hoser
    I'm fairly new to SQL so this may be an easy mistake, but I haven't been able to find a solid solution anywhere else. Problem is whenever I try to use my temp table, it tells me it cannot be used because there is already an object with that name. I frequently try switching up the names, and sometimes it'll let me work with the table for a little while, but it never lasts for long. Am I dropping the table incorrectly? Also, I've had people suggest to just use a permanent table, but this database does not allow me to do that. create table #RandomTableName(NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue decimal) select vPerformanceRule.ObjectName, vPerformanceRule.CounterName, Perf.vPerfRaw.SampleValue into #RandomTableName from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfRaw where (ObjectName like 'Processor' AND CounterName like '% Processor Time') OR(ObjectName like 'System' AND CounterName like 'Processor Queue Length') OR(ObjectName like 'Memory' AND CounterName like 'Pages/Sec') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk Queue Length') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk sec/Read') OR(ObjectName like 'Physical Disk' and CounterName like '% Disk Time') OR(ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 70 AND SampleValue < 100) order by ObjectName, SampleValue drop table #RandomTableName

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

  • [Flex 4 and .Net] Retrieving tables from SQL database

    - by mG
    Hi everyone, As the title says, I want to retrieve tables of data from a SQL database, using Flex 4 and .Net WebService. I'm new to both Flex and DotNet. Please tell me a proper way to do it. This is what I've done so far: Retrieving an array of string: (this works) .Net: [WebMethod] public String[] getTestArray() { String[] arStr = { "AAA", "BBB", "CCC", "DDD" }; return arStr; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getTestArray(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application> Retrieving a DataTable: (this does not work) DotNet: [WebMethod] public DataTable getUsers() { DataTable dt = new DataTable("Users"); SqlConnection conn = new SqlConnection("server = 192.168.1.50; database = MyDatabase; user id = sa; password = 1234; integrated security = false"); SqlDataAdapter da = new SqlDataAdapter("select vFName, vLName, vEmail from Users", conn); da.Fill(dt); return dt; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getUsers(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application>

    Read the article

  • Comparing 2 tables column values and copying the next column content to the second table

    - by Sullan
    Hi All.. I am comparing between two tables first column each. If there is find a match i am copying the text from the adjacent cell of the first table to the second table. I am able to compare strings and get the value, but finding it difficult to print it in the second table. I am getting the value in the var "replaceText", but how to print it in the second table ?? Please help... Sample code is as follows.. <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready(function(){ jQuery('.itemname').each(function(){ var itemName = jQuery(this).text(); jQuery('.comparerow').each(function() { var compareRow = jQuery(this).text(); if (itemName == compareRow) { var replaceText = jQuery(this).next('td').text(); alert(replaceText); } }); }); }); </script> HTML is as follows <table width="100%"><thead> <tr> <th align="left" >Name</th><th>Description</th></tr></thead> <tbody> <tr> <td class="comparerow">IX0001</td> <td class="desc">Desc 1 </td> </tr> <tr> <td class="comparerow">IX0002</td> <td class="desc" >Desc 2 </td> </tr> <tr> <td class="comparerow">IX0003</td> <td class="desc">Desc 3 </td> </tr> <tr> <td class="comparerow">IX0004</td> <td class="desc">Desc 4 </td> </tr> </tbody> </table> <br /> <table width="100%"> <tr> <th>Name</th><th>Description</th> </tr> <tr > <td class="itemname">IX0001</td><td></td> </tr> <tr> <td class="itemname">IX0002</td><td></td> </tr> <tr> <td class="itemname">IX0003</td><td></td> </tr> </table>

    Read the article

  • Parsing tables, cells with Html agility in C#

    - by Kaeso
    I need to parse Html code. More specifically, parse each cell of every rows in all tables. Each row represent a single object and each cell represent different properties. I want to parse these to be able to write an XML file with every data inside (without the useless HTML code). This is the way I thought it out initially but I ran out of ideas: HTML: <tr> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="left"> <a href="/ice/player.htm?id=8471675">Sidney Crosby</a> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> PIT </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> C </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 39 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 32 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 33 </td> <td class="statBox sorted" style="border-width:0px 1px 1px 0px; background-color: #E0E0E0" align="right"> <font color="#000000"> 65 </font> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 29 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 10 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 3 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 0 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 154 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20.8 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 21:54 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 22.6 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> 55.7 </td> </tr> C#: using HtmlAgilityPack; using System.Data; namespace Stats { class StatsParser { private string htmlCode; private static string fileName = "[" + DateTime.Now.ToShortDateString() + " NHL Stats].xml"; public StatsParser(string htmlCode) { this.htmlCode = htmlCode; this.ParseHtml(); } public DataTable ParseHtml() { var result = new DataTable(); HtmlDocument doc = new HtmlDocument(); doc.LoadHtml(htmlCode); HtmlNode row = doc.DocumentNode.SelectNodes("//tr"); foreach (var statBox in row.SelectNodes("//td[@class='statBox']")) { System.Windows.MessageBox.Show(statBox.InnerText); } } } }

    Read the article

  • Database with 5 Tables with Insert and Select

    - by kirbby
    hi guys, my problem is that i have 5 tables and need inserts and selects. what i did is for every table a class and there i wrote the SQL Statements like this public class Contact private static String IDCont = "id_contact"; private static String NameCont = "name_contact"; private static String StreetCont = "street_contact"; private static String Street2Cont = "street2_contact"; private static String Street3Cont = "street3_contact"; private static String ZipCont = "zip_contact"; private static String CityCont = "city_contact"; private static String CountryCont = "country_contact"; private static String Iso2Cont = "iso2_contact"; private static String PhoneCont = "phone_contact"; private static String Phone2Cont = "phone2_contact"; private static String FaxCont = "fax_contact"; private static String MailCont = "mail_contact"; private static String Mail2Cont = "mail2_contact"; private static String InternetCont = "internet_contact"; private static String DrivemapCont = "drivemap_contact"; private static String PictureCont = "picture_contact"; private static String LatitudeCont = "latitude_contact"; private static String LongitudeCont = "longitude_contact"; public static final String TABLE_NAME = "contact"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + IDCont + "INTEGER not NULL," + NameCont + " TEXT not NULL," + StreetCont + " TEXT," + Street2Cont + " TEXT," + Street3Cont + " TEXT," + ZipCont + " TEXT," + CityCont + " TEXT," + CountryCont + " TEXT," + Iso2Cont + " TEXT," + PhoneCont + " TEXT," + Phone2Cont + " TEXT," + FaxCont + " TEXT," + MailCont + " TEXT," + Mail2Cont + " TEXT," + InternetCont + " TEXT," + //website of the contact DrivemapCont + " TEXT," + //a link to a drivemap to the contact PictureCont + " TEXT," + //a photo of the contact building (contact is not a person) LatitudeCont + " TEXT," + LongitudeCont + " TEXT," + "primary key(id_contact)" + "foreign key(iso2)"; and my insert looks like this public boolean SQL_INSERT_CONTACT(int IDContIns, String NameContIns, String StreetContIns, String Street2ContIns, String Street3ContIns, String ZipContIns, String CityContIns, String CountryContIns, String Iso2ContIns, String PhoneContIns, String Phone2ContIns, String FaxContIns, String MailContIns, String Mail2ContIns, String InternetContIns, String DrivemapContIns, String PictureContIns, String LatitudeContIns, String LongitudeContIns) { try{ db.execSQL("INSERT INTO " + "contact" + "(" + IDCont + ", " + NameCont + ", " + StreetCont + ", " + Street2Cont + ", " + Street3Cont + ", " + ZipCont + ", " + CityCont + ", " + CountryCont + ", " + Iso2Cont + ", " + PhoneCont + ", " + Phone2Cont + ", " + FaxCont + ", " + MailCont + ", " + Mail2Cont + ", " + InternetCont + ", " + DrivemapCont + ", " + PictureCont + ", " + LatitudeCont + ", " + LongitudeCont + ") " + "VALUES (" + IDContIns + ", " + NameContIns +", " + StreetContIns + ", " + Street2ContIns + ", " + Street3ContIns + ", " + ZipContIns + ", " + CityContIns + ", " + CountryContIns + ", " + Iso2ContIns + ", " + PhoneContIns + ", " + Phone2ContIns + ", " + FaxContIns + ", " + MailContIns + ", " + Mail2ContIns + ", " + InternetContIns + ", " + DrivemapContIns + ", " + PictureContIns + ", " + LatitudeContIns + ", " + LongitudeContIns +")"); return true; } catch (SQLException e) { return false; } } i have a DBAdapter class there i created the database public class DBAdapter { public static final String DB_NAME = "mol.db"; private static final int DB_VERSION = 1; private static final String TAG = "DBAdapter"; //to log private final Context context; private SQLiteDatabase db; public DBAdapter(Context context) { this.context = context; OpenHelper openHelper = new OpenHelper(this.context); this.db = openHelper.getWritableDatabase(); } public static class OpenHelper extends SQLiteOpenHelper { public OpenHelper(Context context) { super(context, DB_NAME, null, DB_VERSION); } @Override public void onCreate(SQLiteDatabase db) { // TODO Auto-generated method stub db.execSQL(Contact.SQL_CREATE); db.execSQL(Country.SQL_CREATE); db.execSQL(Picture.SQL_CREATE); db.execSQL(Product.SQL_CREATE); db.execSQL(Project.SQL_CREATE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { // TODO Auto-generated method stub Log.w(TAG, "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL(Contact.SQL_DROP); db.execSQL(Country.SQL_DROP); db.execSQL(Picture.SQL_DROP); db.execSQL(Product.SQL_DROP); db.execSQL(Project.SQL_DROP); onCreate(db); } i found so many different things and tried them but i didn't get anything to work... i need to know how can i access the database in my activity and how i can get the insert to work and is there sth wrong in my code? thanks for your help thats how i tried to get it into my activity public class MainTabActivity extends TabActivity { private Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.maintabactivity); TabHost mTabHost = getTabHost(); Intent intent1 = new Intent().setClass(this,MapOfLight.class); //Intent intent2 = new Intent().setClass(this,Test.class); //Testactivity //Intent intent2 = new Intent().setClass(this,DetailView.class); //DetailView Intent intent2 = new Intent().setClass(this,ObjectList.class); //ObjectList //Intent intent2 = new Intent().setClass(this,Gallery.class); //Gallery Intent intent3 = new Intent().setClass(this,ContactDetail.class); mTabHost.addTab(mTabHost.newTabSpec("tab_mol").setIndicator(this.getText(R.string.mol), getResources().getDrawable(R.drawable.ic_tab_mol)).setContent(intent1)); mTabHost.addTab(mTabHost.newTabSpec("tab_highlights").setIndicator(this.getText(R.string.highlights),getResources().getDrawable(R.drawable.ic_tab_highlights)).setContent(intent2)); mTabHost.addTab(mTabHost.newTabSpec("tab_contacts").setIndicator(this.getText(R.string.contact),getResources().getDrawable(R.drawable.ic_tab_contact)).setContent(intent3)); mTabHost.setCurrentTab(1); SQLiteDatabase db; DBAdapter dh = null; OpenHelper openHelper = new OpenHelper(this.context); dh = new DBAdapter(this); db = openHelper.getWritableDatabase(); dh.SQL_INSERT_COUNTRY("AT", "Austria", "AUT"); } } i tried it with my country table because it has only 3 columns public class Country { private static String Iso2Count = "iso2_country"; private static String NameCount = "name_country"; private static String FlagCount = "flag_image_url_country"; public static final String TABLE_NAME = "country"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + Iso2Count + " TEXT not NULL," + NameCount + " TEXT not NULL," + FlagCount + " TEXT not NULL," + "primary key(iso2_country)"; public boolean SQL_INSERT_COUNTRY(String Iso2CountIns, String NameCountIns, String FlagCountIns) { try{ db.execSQL("INSERT INTO " + "country" + "(" + Iso2Count + ", " + NameCount + ", " + FlagCount + ") " + "VALUES ( " + Iso2CountIns + ", " + NameCountIns +", " + FlagCountIns + " )"); return true; } catch (SQLException e) { return false; } } another question is it better to put the insert and select from each table into a separate class, so i have 1 class for each table or put them all into the DBAdapter class?

    Read the article

  • tables wrapping to next line when width 100%

    - by jmo
    I'm encountering some weirdness with tables in css. The layout is fairly simple, a fixed-width nav bar on the left and the content on the right. When the content includes a table with a width of 100% the table ends up getting pushed down until it has room to take up the full width of the screen (instead of just the area to the right of the nav bar). If I remove the width=100% from the table's css, then it looks fine, but obviously the table doesn't grow to fill the space of the div. The problem is that i want the table to grow and shrink with the window but still stay in the bounds of its div. Thanks. Here's a simple example: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title>Test</title> <style type="text/css"> #content { padding-right:20px; background:white; overflow:hidden; margin:20px; } #content .column { position:relative; padding-bottom: 20010px; margin-bottom: -20000px; } #center { width:100%; padding-top:15px; } body { min-width:700px; } #left { width: 330px; padding: 0 10px; padding-top:10px; float:left; } .tableData { width:100%; } </style> </head> <body> <div id="content"> <div class="column" id="left"> <div> Some text goes in here<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> </div> </div> <div class="column" id="center"> Some text at the top; <hr/> <table class="tableData"> <thead> <tr><th>A</th><th>B</th><th>C</th></tr> </thead> <tbody> <tr> <td>A1 A1 A1 A1</td> <td>B1 B1 B1 B1</td> <td>C1 C1 C1 C1 C</td> </tr> <tr> <td>A2 A2 A2 A2 </td> <td>B2 B2 B2 B2 </td> <td>C2 C2 C2 C2</td> </tr> <tr> <td>A3 A3 A3 A3 A3 </td> <td>B3 B3 B3 B3 B3 </td> <td>C3 C3 C3 C3 C3</td> </tr> <tr> <td>A4 A4 A4 A4 A4</td> <td>B4 B4 B4 B4 B4</td> <td>C4 C4 C4 C4 C4</td> </tr> </tbody> </table> </div> </div> </body> </html>

    Read the article

  • How do you version/track changes to SQL tables?

    - by gabe.
    When working in a team of developers, where everyone is making changes to local tables, and development tables, how do you keep all the changes in sync? A central log file where everyone keeps their sql changes? A wiki page to track alter table statements, individual .sql files that the devs can run to bring their local db's to the latest version? I've used some of these solutions, and I'm tyring to get a good solid solution together that works, so I'd appreciate your ideas.

    Read the article

  • Things you can draw with HTML tables

    - by Coronatus
    So I was watching a talk by Google's Marissa Mayer about speeding up Google's pages. They found that a shopping cart icon increased load time by 2%, and users then searched 2% less. They managed to replace the icon with an HTML table. Here is my attempt at drawing a shopping cart: (live example page) <html> <head> <style> table {border-collapse: collapse;} th, td {width: 8px; height: 8px;} th {background-color: blue;} td {background-color: white;} </style> </head> <body> <table> <!-- this row is just to see alignment --> <tr> <td></td><td></td><td></td><td></td><td></td> <td></td><td></td><td></td><td></td><td></td> <td></td><td></td><td></td><td></td><td></td> <td></td><td></td><td></td><td></td><td></td> </tr> <!-- handle --> <tr> <td colspan="14"></td> <th colspan="3"></th> <td colspan="3"></td> </tr> <tr> <td colspan="13"></td> <th colspan="2"></th> <td colspan="1"></td> <th colspan="2"></th> <td colspan="2"></td> </tr> <tr> <td colspan="13"></td> <th colspan="2"></th> <td colspan="1"></td> <th colspan="2"></th> <td colspan="2"></td> </tr> <tr> <td colspan="14"></td> <th colspan="3"></th> <td colspan="3"></td> </tr> <!-- main body --> <tr> <td colspan="5"></td> <th colspan="13"></th> <td colspan="2"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="2"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="3"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="2"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="3"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="2"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="3"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="2"></td> </tr> <tr> <td colspan="5"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <td colspan="1"></td> <th colspan="1"></th> <th colspan="1"></th> <td colspan="3"></td> </tr> <tr> <td colspan="5"></td> <th colspan="13"></th> <td colspan="2"></td> </tr> <!-- wheels --> <tr> <td colspan="7"></td> <th colspan="2"></th> <td colspan="4"></td> <th colspan="2"></th> <td colspan="5"></td> </tr> <tr> <td colspan="6"></td> <th colspan="4"></th> <td colspan="2"></td> <th colspan="4"></th> <td colspan="4"></td> </tr> <tr> <td colspan="7"></td> <th colspan="2"></th> <td colspan="4"></td> <th colspan="2"></th> <td colspan="5"></td> </tr> </table> </body> </html> What can you draw in tables?! Impress us.

    Read the article

  • recipe for adding Drupal node records.

    - by bert
    I am looking for a recipe for adding Drupal node records. I have identified three tables. node_revisions nid=249 - vid + 1? vid=248 - auto-increment node: nid=250 - vid + 1? vid=249 - auto-increment content_type_my_content vid=248 - from node_revisions table? nid=249 - from node table? Am I on right track? Is there some helper functions for this?

    Read the article

  • Rich Text Editor with Tab and Table Support

    - by Chris W.
    We are developing a project for a client that requires a rich text editor that supports both tables and "real" tabs for indentation. Of the editors we've looked at, both TinyMCE and FreeRichTextEditor are very close fits, but indenting with tab seems to only work in WebKit-based browsers. Is there a (preferably free) cross-browser compatible rich text editor that supports both of these features, or a way of 'fixing' tab support in Trident and Mozilla-based browsers?

    Read the article

  • Sorting table data across two table sets with jquery tablesorter

    - by Peter
    I am using jquery table sorter and have two tables. Instead of sorting the data just in the first table, could there be a way to combine the data in the second table and sort both? As an example, sorting column 1 on table 1 OR 2, will result in: //ORIGINAL //RESULT TABLE 1 TABLE 1 col1 | col2 col1 | col2 1 | 1 1 | 1 3 | 3 2 | 2 5 | 5 3 | 3 TABLE 2 TABLE 2 col1 | col 2 col1 | col 2 2 | 2 4 | 4 4 | 4 5 | 5 6 | 6 6 | 6

    Read the article

  • Using CASE Statements in LEFT OUTER JOIN in SQL

    - by s khan
    I've got a scenario where I want to switch on two different tables in an outer join. It goes something like this:- select mytable.id, yourtable.id from mytable left outer join (case when mytable.id = 2 then table2 yourtable on table1.id = table2.id else table3 yourtable on table1.id = table3.id end) ...but it doesn't work. Any suggestions?

    Read the article

  • MYSQL updating data from other table

    - by atif089
    Hi, I have two tables like of this structure content (content_id, content_type, user_id, time, comment_count) comments (comment_id, content_id, userid, comment, comment_time) What I wold like to do is update the comments_count field with sum of comments i.e COUNT(content_id) from the comments table. I am not able to figure out the right syntax Thanks

    Read the article

  • default loading problem

    - by pradeep
    hi, i am working on a site. where in i use tables. when i load the page for 1st time the table seems to be cluttered, but when i refresh the page again, its align itself properly.dono how do i solve this issue.i am proving the sample link URL please provide some help.

    Read the article

  • Why should I use display:table instead of table

    - by nimo9367
    What's the benefits of structuring my site with divs and apply the display:table property ( display:tr, display:tr). Doesn't this mean that the divs will behave exactly like tr and td elements? I know I probably shouldn’t use tables or table behavior for layout at all but I'm just curious if there's a difference and a benefit?

    Read the article

  • Visual Studio DataSet Designer Refresh Tables

    - by LnDCobra
    In visual studio datasource designer(The screen where you have all the UML Diagrams including relations) is there any way to refresh a table and its relations/foreign key constraints without refreshing the whole table? The way I am doing it at the moment is removing the table and adding it again. This adds all the relations and refreshes all fields. Also if I change a fields data type, is there a way to automatically refresh all the fields in the datasource? Again without deleting the table and adding it again. Reason for this is because some of my TableAdapters have quite a number of complex queries attached to them and when I remove the table the adapter gets removed as well including all its queries. I am using Visual Studio 2008 and connecting to a MySQL database.

    Read the article

  • NHibernate Query across multiple tables

    - by Dai Bok
    I am using NHibernate, and am trying to figure out how to write a query, that searchs all the names of my entities, and lists the results. As a simple example, I have the following objects; public class Cat { public string name {get; set;} } public class Dog { public string name {get; set;} } public class Owner { public string firstname {get; set;} public string lastname {get; set;} } Eventaully I want to create a query , say for example, which and returns all the pet owners with an name containing "ted", OR pets with a name containing "ted". Here is an example of the SQL I want to execute: SELECT TOP 10 d.*, c.*, o.* FROM owners AS o INNER JOIN dogs AS d ON o.id = d.ownerId INNER JOIN cats AS c ON o.id = c.ownerId WHERE o.lastname like '%ted%' OR o.firstname like '%ted%' OR c.name like '%ted%' OR d.name like '%ted%' When I do it using Criteria like this: var criteria = session.CreateCriteria<Owner>() .Add( Restrictions.Disjunction() .Add(Restrictions.Like("FirstName", keyword, MatchMode.Anywhere)) .Add(Restrictions.Like("LastName", keyword, MatchMode.Anywhere)) ) .CreateCriteria("Dog").Add(Restrictions.Like("Name", keyword, MatchMode.Anywhere)) .CreateCriteria("Cat").Add(Restrictions.Like("Name", keyword, MatchMode.Anywhere)); return criteria.List<Owner>(); The following query is generated: SELECT TOP 10 d.*, c.*, o.* FROM owners AS o INNER JOIN dogs AS d ON o.id = d.ownerId INNER JOIN cats AS c ON o.id = c.ownerId WHERE o.lastname like '%ted%' OR o.firstname like '%ted%' AND d.name like '%ted%' AND c.name like '%ted%' How can I adjust my query so that the .CreateCriteria("Dog") and .CreateCriteria("Cat") generate an OR instead of the AND? thanks for your help.

    Read the article

  • Reporting Services: Two Tables One Sum

    - by Neomoon
    My report is as follows: One table provides financial information with sums at the group footer (Grouping is called "StockTable_Shipped"). The group is controlled by a boolean value (1=shows shipped data, 0 = shows received data) The second table is a variance report for data that has been shipped (boolean value of 1) and has a sum at the bottom of the table. My ultimate goal is to take the sum from table1 where shipped=1 and subtract it from the variance sum from table2. This will be placed in a textbox at the bottom of the report. I understand if this sounds confusing but I would be more then happy to provide more information.

    Read the article

  • Join with three tables

    - by John
    Hello, For the join query below, I would like to pull some data from a third MySQL table called "comment." Each s.title has a corresponding s.submissionid. The field "submissionid" is also the in the table "comment." For each "submissionid" in the table "comment," I would like to count a field called "commentid." How can I do this? Thanks in advance, John $sqlStr = "SELECT s.loginid, s.title, s.url, s.displayurl, l.username FROM submission AS s, login AS l WHERE s.loginid = l.loginid ORDER BY s.datesubmitted DESC LIMIT 10";

    Read the article

  • Tables created programmatically don't appear in WebBrowser control

    - by John Hall
    I'm creating HTML dynamically in a WebBrowser control. Most elements seems to appear correctly, with the exception of a table. My code is: var doc = webBrowser1.Document; var body = webBrowser1.Document.Body; body.AppendChild(webBrowser1.Document.CreateElement("hr")); var div = doc.CreateElement("DIV"); var table = doc.CreateElement("TABLE"); var row1 = doc.CreateElement("TR"); var cell1 = doc.CreateElement("TD"); cell1.InnerText = "Cell 1"; row1.AppendChild(cell1); var cell2 = doc.CreateElement("TD"); cell2.InnerText = "Cell 2"; row1.AppendChild(cell2); table.AppendChild(row1); div.AppendChild(table); body.AppendChild(div); body.AppendChild(webBrowser1.Document.CreateElement("hr")); The HTML tags are visible in the OuterHTML property of the body, but all that appears in the browser are the two horizontal rules. If I replace div.AppendChild(table); with div.InnerHtml = table.OuterHtml then everything appears as expected.

    Read the article

< Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >