Search Results

Search found 8942 results on 358 pages for 'print r'.

Page 351/358 | < Previous Page | 347 348 349 350 351 352 353 354 355 356 357 358  | Next Page >

  • JSF : able to do mass update but unable to update a single row in a datatable

    - by nash
    I have a simple data object: Car. I am showing the properties of Car objects in a JSF datatable. If i display the properties using inputText tags, i am able to get the modified values in the managed bean. However i just want a single row editable. So have placed a edit button in a separate column and inputText and outputText for every property of Car. the edit button just toggles the rendering of inputText and outputText. Plus i placed a update button in a separate column which is used to save the updated values. However on clicking the update button, i still get the old values instead of the modified values. Here is the complete code: public class Car { int id; String brand; String color; public Car(int id, String brand, String color) { this.id = id; this.brand = brand; this.color = color; } //getters and setters of id, brand, color } Here is the managed bean: import java.util.ArrayList; import java.util.List; import javax.faces.bean.ManagedBean; import javax.faces.bean.RequestScoped; import javax.faces.component.UIData; @ManagedBean(name = "CarTree") @RequestScoped public class CarTree { int editableRowId; List<Car> carList; private UIData myTable; public CarTree() { carList = new ArrayList<Car>(); carList.add(new Car(1, "jaguar", "grey")); carList.add(new Car(2, "ferari", "red")); carList.add(new Car(3, "camri", "steel")); } public String update() { System.out.println("updating..."); //below statments print old values, was expecting modified values System.out.println("new car brand is:" + ((Car) myTable.getRowData()).brand); System.out.println("new car color is:" + ((Car) myTable.getRowData()).color); //how to get modified row values in this method?? return null; } public int getEditableRowId() { return editableRowId; } public void setEditableRowId(int editableRowId) { this.editableRowId = editableRowId; } public UIData getMyTable() { return myTable; } public void setMyTable(UIData myTable) { this.myTable = myTable; } public List<Car> getCars() { return carList; } public void setCars(List<Car> carList) { this.carList = carList; } } here is the JSF 2 page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <h:head> <title>Facelet Title</title> </h:head> <h:body> <h:form id="carForm" prependId="false"> <h:dataTable id="dt" binding="#{CarTree.myTable}" value="#{CarTree.cars}" var="car" > <h:column> <h:outputText value="#{car.id}" /> </h:column> <h:column> <h:outputText value="#{car.brand}" rendered="#{CarTree.editableRowId != car.id}"/> <h:inputText value="#{car.brand}" rendered="#{CarTree.editableRowId == car.id}"/> </h:column> <h:column> <h:outputText value="#{car.color}" rendered="#{CarTree.editableRowId != car.id}"/> <h:inputText value="#{car.color}" rendered="#{CarTree.editableRowId == car.id}"/> </h:column> <h:column> <h:commandButton value="edit"> <f:setPropertyActionListener target="#{CarTree.editableRowId}" value="#{car.id}" /> </h:commandButton> </h:column> <h:column> <h:commandButton value="update" action="#{CarTree.update}"/> </h:column> </h:dataTable> </h:form> </h:body> </html> However if i just keep the inputText tags and remove the rendered attributes, i get the modified values in the update method. How can i get the modified values for the single row edit?

    Read the article

  • Segmentation fault when running a python script/GTKBuilder app?

    - by pythonscript
    I'm trying to learn GUI programming using python2 and GTKBuilder, but I get a segmentation fault when I run the code. This is my file, created in Glade as a GTKBuilder file: <?xml version="1.0" encoding="UTF-8"?> <interface> <!-- interface-requires gtk+ 3.0 --> <object class="GtkWindow" id="mainWindow"> <property name="can_focus">False</property> <child> <object class="GtkBox" id="box1"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="orientation">vertical</property> <child> <object class="GtkBox" id="box2"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="halign">start</property> <property name="margin_left">146</property> <property name="margin_right">276</property> <child> <object class="GtkLabel" id="label1"> <property name="visible">True</property> <property name="can_focus">False</property> <property name="label" translatable="yes">label</property> </object> <packing> <property name="expand">True</property> <property name="fill">False</property> <property name="position">0</property> </packing> </child> <child> <object class="GtkEntry" id="entryName"> <property name="visible">True</property> <property name="can_focus">True</property> <property name="margin_bottom">4</property> <property name="hexpand">True</property> <property name="vexpand">True</property> <property name="invisible_char">?</property> <property name="placeholder_text">Please enter your name here...</property> </object> <packing> <property name="expand">True</property> <property name="fill">True</property> <property name="position">1</property> </packing> </child> </object> <packing> <property name="expand">False</property> <property name="fill">True</property> <property name="position">0</property> </packing> </child> <child> <object class="GtkButton" id="buttonWriteNameToFile"> <property name="label" translatable="yes">button</property> <property name="use_action_appearance">False</property> <property name="visible">True</property> <property name="can_focus">True</property> <property name="receives_default">True</property> <property name="use_action_appearance">False</property> <signal name="clicked" handler="buttonWriteNameToFile_clicked" swapped="no"/> </object> <packing> <property name="expand">False</property> <property name="fill">True</property> <property name="position">1</property> </packing> </child> <child> <placeholder/> </child> <child> <placeholder/> </child> </object> </child> </object> </interface> My python code, based on this question, is this: #!/usr/bin/env python import gtk class NameApp: def __init__(self): filename = "project.glade" builder = gtk.Builder() builder.add_from_file(filename) builder.connect_signals(self) builder.get_object("mainWindow").show_all() def buttonWriteNameToFile_clicked(self, widget): print("File write code...") if __name__ == "__main__": app = NameApp() gtk.main() Running the file with python2 yields this error: name.py:9: Warning: cannot create instance of abstract (non-instantiatable) type `GtkBox' builder.add_from_file(filename) ./geany_run_script.sh: line 5: 14897 Segmentation fault python2 "name.py" I thought I followed that example as closely as possible, and I don't see any differences outside of the GTKBuilder file. However, the example in the linked question runs successfully on my machine. I don't know if it's relevant, but I'm running Arch Linux x86_64.

    Read the article

  • Get CoreLocation Update before TableView population?

    - by Clemens
    hi, i have the corelocation stuff in an uitableview controller. i actually want to get a distance from two locations and print that distance in a tableview cell. the problem is, that the tableview is filled before all the corelocation stuff happens. how can i make corelocation makes all updates before the table is filled? heres my class: // // EntriesListViewController.m // OEAW_App // // Created by Clemens on 6/6/10. // Copyright 2010 MyCompanyName. All rights reserved. // import "EntriesListViewController.h" import "EntryDetailController.h" @implementation EntriesListViewController @synthesize locationManager; @synthesize delegate; NSMutableDictionary *entries; NSMutableDictionary *dictionary; CLLocation *coords; /- (id) init { self = [super init]; if (self != nil) { self.locationManager = [[[CLLocationManager alloc] init] autorelease]; self.locationManager.delegate = self; } return self; }/ (CLLocationManager *)locationManager { if (locationManager != nil) { return locationManager; } locationManager = [[CLLocationManager alloc] init]; locationManager.desiredAccuracy = kCLLocationAccuracyNearestTenMeters; locationManager.delegate = self; return locationManager; } (void)locationManager:(CLLocationManager *)manager didUpdateToLocation:(CLLocation *)newLocation fromLocation:(CLLocation *)oldLocation { //coords.longitude = newLocation.coordinate.longitude; //coords.latitude = newLocation.coordinate.latitude; coords = newLocation; NSLog(@"Location: %@", [newLocation description]); } (void)locationManager:(CLLocationManager *)manager didFailWithError:(NSError *)error { NSLog(@"Error: %@", [error description]); } (void)viewDidLoad { //[[MyCLController alloc] init]; //[locationManager startUpdatingLocation]; [[self locationManager] startUpdatingLocation]; //---initialize the array--- //entries = [[NSMutableArray alloc] init]; //---add items--- //NSString *Path = [[NSBundle mainBundle] bundlePath]; //NSString *DataPath = [Path stringByAppendingPathComponent:@"Memorials.plist"]; dictionary = [[NSDictionary alloc] initWithContentsOfURL:[NSURL URLWithString: @"http://akm.madison.at/memorials.xml"]]; /*NSDictionary *dssItem = [dictionary objectForKey:@"1"]; NSString *text = [dssItem objectForKey:@"text"]; */ //entries = [[NSMutableDictionary alloc] init]; NSLog(@"%@", dictionary); //Path get the path to MyTestList.plist NSString *path=[[NSBundle mainBundle] pathForResource:@"Memorials" ofType:@"plist"]; //Next create the dictionary from the contents of the file. NSDictionary *dict=[NSDictionary dictionaryWithContentsOfFile:path]; //now we can use the items in the file. // self.name.text = [dict valueForKey:@"Name"] ; NSLog(@"%@",[dict valueForKey:@"Name"]); //---set the title--- self.navigationItem.title = @"Türkendenkmäler"; [super viewDidLoad]; } (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 1; } (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return [dictionary count]; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleValue1 reuseIdentifier:CellIdentifier] autorelease]; } // Configure the cell... NSArray *keys = [dictionary allKeys]; id key = [keys objectAtIndex:indexPath.row]; NSDictionary *tmp = [dictionary objectForKey:key]; NSString *name = [tmp objectForKey:@"name"]; cell.textLabel.text = name; cell.font = [UIFont fontWithName:@"Helvetica" size:12.0]; CLLocation *location = [[CLLocation alloc] initWithLatitude:[[tmp valueForKey:@"coords_x"] floatValue] longitude:[[tmp valueForKey:@"coords_y"] floatValue]]; /*CLLocation *newLoc = [[CLLocation alloc] initWithLatitude:coords.latitude longitude:coords.longitude];*/ //locationController = [[MyCLController alloc] init]; int distance = [coords distanceFromLocation:location]; NSLog(@"%@",distance); cell.detailTextLabel.text = [NSString stringWithFormat:@"%@m",distance]; //NSLog(@"%@", [getLocation newLoc]); return cell; } (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { EntryDetailController *detailViewController = [[EntryDetailController alloc] initWithNibName:@"EntryDetailController" bundle:nil]; //detailViewController.entrySelected = [dictionary objectAtIndex:indexPath.row]; NSArray *keys = [dictionary allKeys]; id key = [keys objectAtIndex:indexPath.row]; NSDictionary *tmp = [dictionary objectForKey:key]; NSString *name = [tmp objectForKey:@"name"]; detailViewController.entrySelected_name = name; NSString *location = [tmp objectForKey:@"location"]; detailViewController.entrySelected_location = location; NSString *type = [tmp objectForKey:@"type"]; detailViewController.entrySelected_type = type; NSString *slug = [tmp objectForKey:@"slug"]; detailViewController.entrySelected_slug = slug; [self.navigationController pushViewController:detailViewController animated:YES]; [detailViewController release]; } (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; } (void)dealloc { [entries release]; [super dealloc]; } @end

    Read the article

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • Maddening Linked List problem

    - by Mike
    This has been plaguing me for weeks. It's something really simple, I know it. Every time I print a singly linked list, it prints an address at the end of the list. #include <iostream> using namespace std; struct node { int info; node *link; }; node *before(node *head); node *after(node *head); void middle(node *head, node *ptr); void reversep(node *head, node *ptr); node *head, *ptr, *newnode; int main() { head = NULL; ptr = NULL; newnode = new node; head = newnode; for(int c1=1;c1<11;c1++) { newnode->info = c1; ptr = newnode; newnode = new node; ptr->link = newnode; ptr = ptr->link; } ptr->link=NULL; head = before(head); head = after(head); middle(head, ptr); //reversep(head, ptr); ptr = head; cout<<ptr->info<<endl; while(ptr->link!=NULL) { ptr=ptr->link; cout<<ptr->info<<endl; } system("Pause"); return 0; } node *before(node *head) { node *befnode; befnode = new node; cout<<"What should go before the list?"<<endl; cin>>befnode->info; befnode->link = head; head = befnode; return head; } node *after(node *head) { node *afnode, *ptr2; afnode = new node; ptr2 = head; cout<<"What should go after the list?"<<endl; cin>>afnode->info; ptr2 = afnode; afnode->link=NULL; ptr2 = head; return ptr2; } void middle(node *head, node *ptr) { int c1 = 0, c2 = 0; node *temp, *midnode; ptr = head; while(ptr->link->link!=NULL) { ptr=ptr->link; c1++; } c1/=2; c1-=1; ptr = head; while(c2<c1) { ptr=ptr->link; c2++; } midnode = new node; cout<<"What should go in the middle of the list?"<<endl; cin>>midnode->info; cout<<endl; temp=ptr->link; ptr->link=midnode; midnode->link=temp; } void reversep(node *head, node *ptr) { node *last, *ptr2; ptr=head; ptr2=head; while(ptr->link!=NULL) ptr = ptr->link; last = ptr; cout<<last->info; while(ptr!=head) { while(ptr2->link!=ptr) ptr2=ptr2->link; ptr = ptr2; cout<<ptr->info; } } I'll admit that this is class work, but even the professor can't figure it out, and says that its probably something insignificant that we're overlooking, but I can't put my mind to rest until I find out what it is.

    Read the article

  • Of these 3 methods for reading linked lists from shared memory, why is the 3rd fastest?

    - by Joseph Garvin
    I have a 'server' program that updates many linked lists in shared memory in response to external events. I want client programs to notice an update on any of the lists as quickly as possible (lowest latency). The server marks a linked list's node's state_ as FILLED once its data is filled in and its next pointer has been set to a valid location. Until then, its state_ is NOT_FILLED_YET. I am using memory barriers to make sure that clients don't see the state_ as FILLED before the data within is actually ready (and it seems to work, I never see corrupt data). Also, state_ is volatile to be sure the compiler doesn't lift the client's checking of it out of loops. Keeping the server code exactly the same, I've come up with 3 different methods for the client to scan the linked lists for changes. The question is: Why is the 3rd method fastest? Method 1: Round robin over all the linked lists (called 'channels') continuously, looking to see if any nodes have changed to 'FILLED': void method_one() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { Data* current_item = channel_cursors[i]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[i] = static_cast<Data*>(current_item->next_.get(segment)); } } } Method 1 gave very low latency when then number of channels was small. But when the number of channels grew (250K+) it became very slow because of looping over all the channels. So I tried... Method 2: Give each linked list an ID. Keep a separate 'update list' to the side. Every time one of the linked lists is updated, push its ID on to the update list. Now we just need to monitor the single update list, and check the IDs we get from it. void method_two() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { if(update_cursor->state_ == NOT_FILLED_YET) { continue; } ::uint32_t update_id = update_cursor->list_id_; Data* current_item = channel_cursors[update_id]; if(current_item->state_ == NOT_FILLED_YET) { std::cerr << "This should never print." << std::endl; // it doesn't continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[update_id] = static_cast<Data*>(current_item->next_.get(segment)); update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } } Method 2 gave TERRIBLE latency. Whereas Method 1 might give under 10us latency, Method 2 would inexplicably often given 8ms latency! Using gettimeofday it appears that the change in update_cursor-state_ was very slow to propogate from the server's view to the client's (I'm on a multicore box, so I assume the delay is due to cache). So I tried a hybrid approach... Method 3: Keep the update list. But loop over all the channels continuously, and within each iteration check if the update list has updated. If it has, go with the number pushed onto it. If it hasn't, check the channel we've currently iterated to. void method_three() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { std::size_t idx = i; ACQUIRE_MEMORY_BARRIER; if(update_cursor->state_ != NOT_FILLED_YET) { //std::cerr << "Found via update" << std::endl; i--; idx = update_cursor->list_id_; update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } Data* current_item = channel_cursors[idx]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } found_an_update = true; log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[idx] = static_cast<Data*>(current_item->next_.get(segment)); } } } The latency of this method was as good as Method 1, but scaled to large numbers of channels. The problem is, I have no clue why. Just to throw a wrench in things: if I uncomment the 'found via update' part, it prints between EVERY LATENCY LOG MESSAGE. Which means things are only ever found on the update list! So I don't understand how this method can be faster than method 2. The full, compilable code (requires GCC and boost-1.41) that generates random strings as test data is at: http://pastebin.com/e3HuL0nr

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • How to get predecessor and successors from an adjacency matrix

    - by NickTFried
    Hi I am am trying to complete an assignment, where it is ok to consult the online community. I have to create a graph class that ultimately can do Breadth First Search and Depth First Search. I have been able to implement those algorithms successfully however another requirement is to be able to get the successors and predecessors and detect if two vertices are either predecessors or successors for each other. I'm having trouble thinking of a way to do this. I will post my code below, if anyone has any suggestions it would be greatly appreciated. import java.util.ArrayList; import java.util.Iterator; import java.util.LinkedList; import java.util.Queue; import java.util.Stack; public class Graph<T> { public Vertex<T> root; public ArrayList<Vertex<T>> vertices=new ArrayList<Vertex<T>>(); public int[][] adjMatrix; int size; private ArrayList<Vertex<T>> dfsArrList; private ArrayList<Vertex<T>> bfsArrList; public void setRootVertex(Vertex<T> n) { this.root=n; } public Vertex<T> getRootVertex() { return this.root; } public void addVertex(Vertex<T> n) { vertices.add(n); } public void removeVertex(int loc){ vertices.remove(loc); } public void addEdge(Vertex<T> start,Vertex<T> end) { if(adjMatrix==null) { size=vertices.size(); adjMatrix=new int[size][size]; } int startIndex=vertices.indexOf(start); int endIndex=vertices.indexOf(end); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public void removeEdge(Vertex<T> v1, Vertex<T> v2){ int startIndex=vertices.indexOf(v1); int endIndex=vertices.indexOf(v2); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public int countVertices(){ int ver = vertices.size(); return ver; } /* public boolean isPredecessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ /* public boolean isSuccessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ public void getSuccessors(Vertex<T> v1){ } public void getPredessors(Vertex<T> v1){ } private Vertex<T> getUnvisitedChildNode(Vertex<T> n) { int index=vertices.indexOf(n); int j=0; while(j<size) { if(adjMatrix[index][j]==1 && vertices.get(j).visited==false) { return vertices.get(j); } j++; } return null; } public Iterator<Vertex<T>> bfs() { Queue<Vertex<T>> q=new LinkedList<Vertex<T>>(); q.add(this.root); printVertex(this.root); root.visited=true; while(!q.isEmpty()) { Vertex<T> n=q.remove(); Vertex<T> child=null; while((child=getUnvisitedChildNode(n))!=null) { child.visited=true; bfsArrList.add(child); q.add(child); } } clearVertices(); return bfsArrList.iterator(); } public Iterator<Vertex<T>> dfs() { Stack<Vertex<T>> s=new Stack<Vertex<T>>(); s.push(this.root); root.visited=true; printVertex(root); while(!s.isEmpty()) { Vertex<T> n=s.peek(); Vertex<T> child=getUnvisitedChildNode(n); if(child!=null) { child.visited=true; dfsArrList.add(child); s.push(child); } else { s.pop(); } } clearVertices(); return dfsArrList.iterator(); } private void clearVertices() { int i=0; while(i<size) { Vertex<T> n=vertices.get(i); n.visited=false; i++; } } private void printVertex(Vertex<T> n) { System.out.print(n.label+" "); } }

    Read the article

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Qt drag & drop button; drop not detecting

    - by Thomas Verbeke
    I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Saving in mongoDb with Mongoose, unexpected elements saved

    - by guiomie
    When I write in my mongoDB with mongoose the operation is treated with success, my document is saved, but there is also all kind of weird other sutff written down. It seems to be mongoose code. What could cause this? I add stuff in a specific array with: resultReference.ref[arrayLocation].allEvents.push(theEvent); {id: 11, allEvents: [] } is the structure of a ref element, and I push theEvent in the allEvents array. I then resultReference.save() I use express, mongoose and mongoHQ for database. I tried on a local mongo server, and this annoyance is still there. I've print in my console the document to write before save() and non of this weird code is there. { id 11 allEvents [ 0 { _events { maxListeners 0 } _doc { _id {"$oid": "4eb87834f54944e263000003"} title "Test" allDay false start 2011-11-10 13:00:00 UTC end 2011-11-10 15:00:00 UTC url "/test/4eb87834f54944e263000002" color "#99CCFF" ref "4eb87834f54944e263000002" } _activePaths { paths { title "modify" allDay "modify" start "modify" end "modify" url "modify" color "modify" ref "modify" } states { init { } modify { title true allDay true start true end true url true color true ref true } require { } } stateNames [ 0 "require" 1 "modify" 2 "init" ] } _saveError null _validationError null isNew true _pres { save [ 0 function (next) { // we keep the error semaphore to make sure we don't // call `save` unnecessarily (we only need 1 error) var subdocs = 0 , error = false , self = this; var arrays = this._activePaths .map('init', 'modify', function (i) { return self.getValue(i); }) .filter(function (val) { return (val && val instanceof DocumentArray && val.length); }); if (!arrays.length) return next(); arrays.forEach(function (array) { subdocs += array.length; array.forEach(function (value) { if (!error) value.save(function (err) { if (!error) { if (err) { error = true; next(err); } else --subdocs || next(); } }); }); }); } 1 "function checkForExistingErrors(next) { if (self._saveError){ next(self._saveError); self._saveError = null; } else { next(); } }" 2 "function validation(next) { return self.validate.call(self, next); }" ] } _posts { save [ ] } save function () { var self = this , hookArgs // arguments eventually passed to the hook - are mutable , lastArg = arguments[arguments.length-1] , pres = this._pres[name] , posts = this._posts[name] , _total = pres.length , _current = -1 , _asyncsLeft = proto[name].numAsyncPres , _next = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var _args = Array.prototype.slice.call(arguments) , currPre , preArgs; if (_args.length && !(arguments[0] === null && typeof lastArg === 'function')) hookArgs = _args; if (++_current < _total) { currPre = pres[_current] if (currPre.isAsync && currPre.length < 2) throw new Error("Your pre must have next and done arguments -- e.g., function (next, done, ...)"); if (currPre.length < 1) throw new Error("Your pre must have a next argument -- e.g., function (next, ...)"); preArgs = (currPre.isAsync ? [once(_next), once(_asyncsDone)] : [once(_next)]).concat(hookArgs); return currPre.apply(self, preArgs); } else if (!proto[name].numAsyncPres) { return _done.apply(self, hookArgs); } } , _done = function () { var args_ = Array.prototype.slice.call(arguments) , ret, total_, current_, next_, done_, postArgs; if (_current === _total) { ret = fn.apply(self, args_); total_ = posts.length; current_ = -1; next_ = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var args_ = Array.prototype.slice.call(arguments, 1) , currPost , postArgs; if (args_.length) hookArgs = args_; if (++current_ < total_) { currPost = posts[current_] if (currPost.length < 1) throw new Error("Your post must have a next argument -- e.g., function (next, ...)"); postArgs = [once(next_)].concat(hookArgs); return currPost.apply(self, postArgs); } }; if (total_) return next_(); return ret; } }; if (_asyncsLeft) { function _asyncsDone (err) { if (err && err instanceof Error) { return handleError(err); } --_asyncsLeft || _done.apply(self, hookArgs); } } function handleError (err) { if ('function' == typeof lastArg) return lastArg(err); if (errorCb) return errorCb.call(self, err); throw err; } return _next.apply(this, arguments); } errors null } ] } ]

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • a program similar to ls with some modifications

    - by Bond
    Hi, here is a simple puzzle I wanted to discuss. A C program to take directory name as command line argument and print last 3 directories and 3 files in all subdirectories without using api 'system' inside it. suppose directory bond0 contains bond1, di2, bond3, bond4, bond5 and my_file1, my_file2, my_file3, my_file4, my_file5, my_file6 and bond1 contains bond6 my_file7 my_file8 my_file9 my_file10 program should output - bond3, bond4, bond5, my_file4, my_file5, my_file6, bond6, my_file8, my_file9, my_file10 My code for the above problem is here #include<dirent.h> #include<unistd.h> #include<string.h> #include<sys/stat.h> #include<stdlib.h> #include<stdio.h> char *directs[20], *files[20]; int i = 0; int j = 0; int count = 0; void printdir(char *); int count_dirs(char *); int count_files(char *); int main() { char startdir[20]; printf("Scanning user directories\n"); scanf("%s", startdir); printdir(startdir); } void printdir(char *dir) { printf("printdir called %d directory is %s\n", ++count, dir); DIR *dp = opendir(dir); int nDirs, nFiles, nD, nF; nDirs = 0; nFiles = 0; nD = 0; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; nDirs = count_dirs(dir); nFiles = count_files(dir); printf("The no of subdirectories in %s is %d \n", dir, nDirs); printf("The no of files in %s is %d \n", dir, nFiles); while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { nD++; if ((nDirs - nD) < 3) { printf("The directory is %s\n",entry->d_name); } } else { nF++; if ((nFiles - nF) < 3) { printf("The files are %s\n", entry->d_name); } //if } //else free(filepath); } //if(filepath) } //while while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } printf("In second while loop *entry=%s\n",entry->d_name); char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { printdir(entry->d_name); } } //else free(filepath); } //2nd while closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } } //printdir int count_dirs(char *dir) { DIR *dp = opendir(dir); int nD; nD = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { nD++; } else { continue; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } return nD; } int count_files(char *dir) { DIR *dp = opendir(dir); int nF; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { continue; } else { nF++; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open file %s\n", dir); } return nF; } The above code I wrote is a bit not functioning correctly can some one help me to understand the error which is coming.So that I improve it further.There seems to be some small glitch which is not clear to me right now.

    Read the article

  • .NET interview, code structure and the design

    - by j_lewis
    I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

    Read the article

  • Undefined reference to ...

    - by Patrick LaChance
    I keep getting this error message every time I try to compile, and I cannot find out what the problem is. any help would be greatly appreciated: C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::List()' C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::add(int)' collect2: ld returned 1 exit status code: //List.h #ifndef LIST_H #define LIST_H #include <exception> //brief Definition of linked list class class List { public: /** \brief Exception for operating on empty list */ class Empty : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Exception for invalid operations other than operating on an empty list */ class InvalidOperation : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Node within List */ class Node { public: /** data element stored in this node */ int element; /** next node in list */ Node* next; /** previous node in list */ Node* previous; Node (int element); ~Node(); void print() const; void printDebug() const; }; List(); ~List(); void add(int element); void remove(int element); int first()const; int last()const; int removeFirst(); int removeLast(); bool isEmpty()const; int size()const; void printForward() const; void printReverse() const; void printDebug() const; /** enables extra output for debugging purposes */ static bool traceOn; private: /** head of list */ Node* head; /** tail of list */ Node* tail; /** count of number of nodes */ int count; }; #endif //List.cpp I only included the parts of List.cpp that might be the issue #include "List.h" #include <iostream> #include <iomanip> using namespace std; List::List() { //List::size = NULL; head = NULL; tail = NULL; } List::~List() { Node* current; while(head != NULL) { current = head-> next; delete current->previous; if (current->next!=NULL) { head = current; } else { delete current; } } } void List::add(int element) { Node* newNode; Node* current; newNode->element = element; if(newNode->element > head->element) { current = head->next; } else { head->previous = newNode; newNode->next = head; newNode->previous = NULL; return; } while(newNode->element > current->element) { current = current->next; } if(newNode->element <= current->element) { newNode->previous = current->previous; newNode->next = current; } } //main.cpp #include "List.h" #include <iostream> #include <string> using namespace std; //void add(int element); int main (char** argv, int argc) { List* MyList = new List(); bool quit = false; string value; int element; while(quit==false) { cin>>value; if(value == "add") { cin>>element; MyList->add(element); } if(value=="quit") { quit = true; } } return 0; } I'm doing everything I think I'm suppose to be doing. main.cpp isn't complete yet, just trying to get the add function to work first. Any help will be greatly appreciated.

    Read the article

  • Work time in fullcalendar [Solution]

    - by Zozo
    Full calendar have no included options to work-time feature (selecting first and last rows in agenda view for any day - where in example company is not working). I managed something like that: viewDisplay: function(view){ $.ajax({ url: 'index.php?r=calendar/Default/worktime', dataType: 'json', success: function(data){ if(view.name=='agendaWeek') selectWorkTime(data, 30, 0, 24, false); else if(view.name=='agendaDay') selectDayWorkTime(data, 30, 0, 24, view, false); } }); } Where index.php?r=calendar/Default/worktime is php file returning json. It looks like that: $arr = array( 'mon' => array('8:00', '17:00'), 'tue' => array('9:00', '15:00'), 'wed' => array('9:30', '19:00'), 'thu' => array('6:00', '14:00'), 'fri' => array('0:00', '24:00'), 'sat' => array('9:00', '14:00'), 'sun' => array() ); foreach ($arr as &$day){ foreach($day as &$hour){ $tmp = explode(':', $hour); $hour = $tmp[0] * 3600 + $tmp[1] * 60; } } print json_encode($arr); and at the end, some functions using for counting and selecting work-time: function selectDayWorkTime(timeArray, slotMinutes, minTime, maxTime, viewObject, showAtHolidays){ var dayname; $('.fc-content').find('.fc-view-agendaWeek').find('.fc-agenda-body') .children('.fc-work-time').remove(); $('.fc-content').find('.fc-view-agendaDay') .find('.fc-work-time-day').removeClass('fc-work-time-day'); switch(viewObject.start.getDay()){ case 1: dayname='mon'; break; case 2: dayname='tue'; break; case 3: dayname='wed'; break; case 4: dayname='thu'; break; case 5: dayname='fri'; break; case 6: dayname='sat'; break; case 0: dayname='sun'; break; } for(var day in timeArray){ if(day == dayname){ if($('.fc-content').find('.fc-view-agendaDay').find('.fc-'+day).attr('class').search('fc-holiday') == -1 || showAtHolidays){ var startBefore = 0; var endBefore = timeArray[day][0] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var startAfter = timeArray[day][1] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var endAfter = (maxTime - minTime) * 60 / slotMinutes - 1; for(startBefore; startBefore < endBefore; startBefore++){ $('.fc-view-agendaDay').find('.fc-slot'+startBefore).find('div').addClass('fc-work-time-day'); } for(startAfter; startAfter <= endAfter; startAfter++){ $('.fc-view-agendaDay').find('.fc-slot'+startAfter).find('div').addClass('fc-work-time-day'); } } } } } function selectWorkTime(timeArray, slotMinutes, minTime, maxTime, showAtHolidays){ for(var day in timeArray){ var startBefore = 0; var endBefore = timeArray[day][0] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var startAfter = timeArray[day][1] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var endAfter = (maxTime - minTime) * 60 / slotMinutes - 1; if(startBefore > endBefore) endBefore = startBefore; if(startAfter > endAfter) startAfter = endAfter; try{ selectCell(startBefore, endBefore, 'fc-'+day, 'fc-work-time', false, showAtHolidays); selectCell(startAfter, endAfter, 'fc-'+day, 'fc-work-time', true, showAtHolidays); } catch(e){ continue; } } } function selectCell(startRowNo, endRowNo, collClass, cellClass, closeGap, showAtHolidays){ $('.fc-content').find('.fc-view-agendaWeek').find('.fc-agenda-body') .children('.'+cellClass+''+startRowNo+''+collClass).remove(); $('.fc-content').find('.fc-view-agendaDay') .find('.fc-work-time-day').removeClass('fc-work-time-day'); if($('.fc-content').find('.fc-view-agendaWeek').find('.'+collClass).attr('class').search('fc-holiday') == -1 || showAtHolidays){ var width = $('.fc-content').find('.fc-view-agendaWeek') .find('.'+collClass+':last').width(); var height = 0; if(closeGap && (startRowNo != endRowNo)){ height = $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).height(); } $('.fc-view-agendaWeek').find('.fc-agenda-body').prepend('<div class="'+cellClass+' ' + ''+cellClass+''+startRowNo+''+collClass+'"></div>'); $('.'+cellClass).width(width - 2); height += $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ endRowNo).position().top - $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).position().top; $('.'+cellClass+''+startRowNo+''+collClass).height(height); $('.'+cellClass+''+startRowNo+''+collClass) .css('margin-top', $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).position().top); $('.'+cellClass+''+startRowNo+''+collClass) .css('margin-left', $('.fc-content').find('.fc-view-agendaWeek') .find('.'+collClass+':last').offset().left - width / 2); } } Don't forget about CSS: .fc-work-time-day{ background-color: yellow; opacity: 0.3; filter: alpha(opacity=30); /* for IE */ } .fc-work-time{ position: absolute; background-color: yellow; z-index:10; margin: 0; padding: 0; text-align: left; z-index: 0; opacity: 0.3; filter: alpha(opacity=30); /* for IE */ } So, I've got some questions about - is the other way to make the same, but no using absolute div's in agendaWeek? And... How can I get in viewDisplay function actual slotMinutes, minTime and maxTime

    Read the article

  • How I can get output from 1st frame textfield input text to 2nd frame textArea

    - by soulgreen
    Here is my 1st frame - I want went I input text in textfield example name then click button report will display output to 2nd frame using textArea... please help me import java.awt.; import java.awt.event.; import javax.swing.; import javax.swing.border.; public class Order extends JFrame implements ActionListener { private JPanel pInfo,pN, pIC, pDate,Blank,pBlank, button, pTotal; private JLabel nameL,icL,DateL; private JTextField nameTF, icTF; private JFormattedTextField DateTF; private JButton calB,clearB,exitB,reportB; public Order() { Container contentPane = getContentPane(); contentPane.setLayout(new BorderLayout()); contentPane.setBackground(Color.gray); pInfo = new JPanel(); pN = new JPanel(); pIC = new JPanel(); pDate = new JPanel(); nameTF = new JTextField(30); icTF = new JTextField(30); DateTF = new JFormattedTextField(java.util.Calendar.getInstance().getTime()); DateTF.setEditable (false); DateTF.addActionListener(this); nameL = new JLabel(" NAME : ",SwingConstants.RIGHT); icL = new JLabel(" IC : ",SwingConstants.RIGHT); DateL = new JLabel(" DATE :",SwingConstants.RIGHT); pInfo.setLayout(new GridLayout(10,2,5,5)); pInfo.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"ORDER")); pN.add(nameL); pN.add(nameTF); pIC.add(icL); pIC.add(icTF); pDate.add(DateL); pDate.add(DateTF); pInfo.add(pN); pInfo.add(pIC); pInfo.add(pDate); pInfo.setBackground(Color.GRAY); pN.setBackground(Color.gray); pIC.setBackground(Color.gray); pDate.setBackground(Color.gray); nameL.setForeground(Color.black); icL.setForeground(Color.black); DateL.setForeground(Color.black); nameTF.setBackground(Color.pink); icTF.setBackground(Color.pink); DateTF.setBackground(Color.pink); contentPane.add(pInfo,BorderLayout.CENTER); Blank = new JPanel(); pBlank = new JPanel(); button = new JPanel(); calB = new JButton("CALCULATE"); calB.setToolTipText("Click to calculate"); clearB = new JButton("RESET"); clearB.setToolTipText("Click to clear"); reportB = new JButton ("REPORT"); reportB.setToolTipText ("Click to print"); exitB = new JButton("EXIT"); exitB.setToolTipText("Click to exit"); Blank.setLayout(new GridLayout(2,2)); Blank.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"")); button.setLayout(new GridLayout(1,4)); button.add(calB,BorderLayout.WEST); button.add(clearB,BorderLayout.CENTER); button.add(reportB,BorderLayout.CENTER); button.add(exitB,BorderLayout.EAST); Blank.add(pBlank); Blank.add(button); contentPane.add(Blank,BorderLayout.SOUTH); Blank.setBackground(Color.gray); pBlank.setBackground(Color.gray); calB.setForeground(Color.black); clearB.setForeground(Color.black); reportB.setForeground(Color.black); exitB.setForeground(Color.black); calB.setBackground(Color.pink); clearB.setBackground(Color.pink); reportB.setBackground(Color.pink); exitB.setBackground(Color.pink); calB.addActionListener(this); clearB.addActionListener(this); reportB.addActionListener(this); exitB.addActionListener(this); } public void actionPerformed(ActionEvent p) { if (p.getSource() == calB) { } else if (p.getSource() == clearB) { } else if (p.getSource () == reportB) { } else if (p.getSource() == exitB) { } } public static void main (String [] args) { Order frame = new Order(); frame.setTitle("Order"); frame.setSize(500,500); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setResizable(false); frame.setVisible(true); frame.setLocationRelativeTo(null);//center the frame } }

    Read the article

  • SWIG & C/C++ Python API connected - SEGFAULT

    - by user289637
    Hello, my task is to create dual program. At the beginning I start C program that calls throught C/C++ API of Python some Python method. The called method after that call a function that is created with SWIG. I show you my sample also with backtrace from gdb after I am given Segmentation fault. main.c: #include <Python.h> #include <stdio.h> #include "utils.h" int main(int argc, char** argv) { printf("Calling from C !\n"); increment(); int i; for(i = 0; i < 11; ++i) { Py_Initialize(); PyObject *pname = PyString_FromString("py_function"); PyObject *module = PyImport_Import(pname); PyObject *dict = PyModule_GetDict(module); PyObject *func = PyDict_GetItemString(dict, "ink"); PyObject_CallObject(func, NULL); Py_DECREF(module); Py_DECREF(pname); printf("\tbefore finalize\n"); Py_Finalize(); printf("\tafter finalize\n"); } return 0; } utils.c #include <stdio.h> #include "utils.h" void increment(void) { printf("Incremention counter to: %u\n", ++counter); } py_function.py #!/usr/bin/python2.6 '''py_function.py - Python source designed to demonstrate the use of python embedding''' import utils def ink(): print 'I am gonna increment !' utils.increment() and last think is my Makefile & SWIG configure file Makefile: CC=gcc CFLAGS=-c -g -Wall -std=c99 all: main main: main.o utils.o utils_wrap.o $(CC) main.o utils.o -lpython2.6 -o sample swig -Wall -python -o utils_wrap.c utils.i $(CC) utils.o utils_wrap.o -shared -o _utils.so main.o: main.c $(CC) $(CFLAGS) main.c -I/usr/include/python2.6 -o main.o utils.o: utils.c utils.h $(CC) $(CFLAGS) -fPIC utils.c -o $@ utils_wrap.o: utils_wrap.c $(CC) -c -fPIC utils_wrap.c -I/usr/include/python2.6 -o $@ clean: rm -rf *.o The program is called by ./main and there is output: (gdb) run Starting program: /home/marxin/Programming/python2/sample [Thread debugging using libthread_db enabled] Calling from C ! Incremention counter to: 1 I am gonna increment ! Incremention counter to: 2 before finalize after finalize I am gonna increment ! Incremention counter to: 3 before finalize after finalize I am gonna increment ! Incremention counter to: 4 before finalize after finalize Program received signal SIGSEGV, Segmentation fault. 0xb7ed3e4e in PyObject_Malloc () from /usr/lib/libpython2.6.so.1.0 Backtrace: (gdb) backtrace #0 0xb7ed3e4e in PyObject_Malloc () from /usr/lib/libpython2.6.so.1.0 #1 0xb7ca2b2c in ?? () #2 0xb7f8dd40 in ?? () from /usr/lib/libpython2.6.so.1.0 #3 0xb7eb014c in ?? () from /usr/lib/libpython2.6.so.1.0 #4 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #5 0xb7f99820 in ?? () from /usr/lib/libpython2.6.so.1.0 #6 0x00000001 in ?? () #7 0xb7f8dd40 in ?? () from /usr/lib/libpython2.6.so.1.0 #8 0xb7f4f014 in _PyObject_GC_Malloc () from /usr/lib/libpython2.6.so.1.0 #9 0xb7f99820 in ?? () from /usr/lib/libpython2.6.so.1.0 #10 0xb7f4f104 in _PyObject_GC_NewVar () from /usr/lib/libpython2.6.so.1.0 #11 0xb7ee8760 in _PyType_Lookup () from /usr/lib/libpython2.6.so.1.0 #12 0xb7f99820 in ?? () from /usr/lib/libpython2.6.so.1.0 #13 0x00000001 in ?? () #14 0xb7f8dd40 in ?? () from /usr/lib/libpython2.6.so.1.0 #15 0xb7ef13ed in ?? () from /usr/lib/libpython2.6.so.1.0 #16 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #17 0x00000001 in ?? () #18 0xbfff0c34 in ?? () #19 0xb7e993c3 in ?? () from /usr/lib/libpython2.6.so.1.0 #20 0x00000001 in ?? () #21 0xbfff0c70 in ?? () #22 0xb7f99da0 in ?? () from /usr/lib/libpython2.6.so.1.0 #23 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #24 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #25 0x080a6b0c in ?? () #26 0x080a6b0c in ?? () #27 0xb7e99420 in PyObject_CallFunctionObjArgs () from /usr/lib/libpython2.6.so.1.0 #28 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #29 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #30 0x800e55eb in ?? () #31 0x080a6b0c in ?? () #32 0xb7e9958c in PyObject_IsSubclass () from /usr/lib/libpython2.6.so.1.0 #33 0xb7f8dd40 in ?? () from /usr/lib/libpython2.6.so.1.0 #34 0x080a9020 in ?? () #35 0xb7fb78f0 in PyFPE_counter () from /usr/lib/libpython2.6.so.1.0 #36 0xb7f86ff4 in ?? () from /usr/lib/libpython2.6.so.1.0 #37 0x00000000 in ?? () Thanks for your help and advices, marxin

    Read the article

  • textbox disappears in paging - php

    - by fusion
    i'm calling the search.php page via ajax to search.html. the problem is, since i've implemented paging, the textbox with the search keyword from search.html 'disappears' when the user clicks the 'Next' button [because the page goes to search.php which has no textbox element] i'd like the textbox with the search keyword to be there, when the user goes through the records via paging. how'd i achieve this? search.html: <body> <form name="myform" class="wrapper"> <input type="text" name="q" onkeyup="showPage();" class="txt_search"/> <input type="button" name="button" onclick="showPage();" class="button"/> <p> <div id="txtHint"></div> <div id="page"></div> </form> </body> search.php [the relevant part]: $self = $_SERVER['PHP_SELF']; $limit = 5; //Number of results per page $numpages=ceil($totalrows/$limit); $query = $query." ORDER BY idQuotes LIMIT " . ($page-1)*$limit . ",$limit"; $result = mysql_query($query, $conn) or die('Error:' .mysql_error()); ?> <div class="caption">Search Results</div> <div class="center_div"> <table> <?php while ($row= mysql_fetch_array($result, MYSQL_ASSOC)) { $cQuote = highlightWords(htmlspecialchars($row['cQuotes']), $search_result); ?> <tr> <td style="text-align:right; font-size:15px;"><?php h($row['cArabic']); ?></td> <td style="font-size:16px;"><?php echo $cQuote; ?></td> <td style="font-size:12px;"><?php h($row['vAuthor']); ?></td> <td style="font-size:12px; font-style:italic; text-align:right;"><?php h($row['vReference']); ?></td> </tr> <?php } ?> </table> </div> <?php //Create and print the Navigation bar $nav=""; if($page > 1) { $nav .= "<a href=\"$self?page=" . ($page-1) . "&q=" .urlencode($search_result) . "\">< Prev</a>"; $first = "<a href=\"$self?page=1&q=" .urlencode($search_result) . "\"><< First</a>" ; } else { $nav .= "&nbsp;"; $first = "&nbsp;"; } for($i = 1 ; $i <= $numpages ; $i++) { if($i == $page) { $nav .= "<B>$i</B>"; }else{ $nav .= "<a href=\"$self?page=" . $i . "&q=" .urlencode($search_result) . "\">$i</a>"; } } if($page < $numpages) { $nav .= "<a href=\"$self?page=" . ($page+1) . "&q=" .urlencode($search_result) . "\">Next ></a>"; $last = "<a href=\"$self?page=$numpages&q=" .urlencode($search_result) . "\">Last >></a> "; } else { $nav .= "&nbsp;"; $last = "&nbsp;"; } echo "<br /><br />" . $first . $nav . $last; }

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

< Previous Page | 347 348 349 350 351 352 353 354 355 356 357 358  | Next Page >