Search Results

Search found 9078 results on 364 pages for 'package'.

Page 352/364 | < Previous Page | 348 349 350 351 352 353 354 355 356 357 358 359  | Next Page >

  • understand SimpleTimeZone and DST Test

    - by Cygnusx1
    I Have an issue with the use of SimpleTimeZone class in Java. First, the JavaDoc is nice but not quite easy to understand in regards of the start and end Rules. But with the help of some example found on the web, i managed to get it right (i still don't understand why 8 represents the second week of a month in day_of_month!!! but whatever) Now i have written a simple Junit test to validate what i understand: package test; import static org.junit.Assert.assertEquals; import java.sql.Timestamp; import java.util.Calendar; import java.util.GregorianCalendar; import java.util.SimpleTimeZone; import org.apache.log4j.Logger; import org.junit.Test; public class SimpleTimeZoneTest { Logger log = Logger.getLogger(SimpleTimeZoneTest.class); @Test public void testTimeZoneWithDST() throws Exception { Calendar testDateEndOut = new GregorianCalendar(2012, Calendar.NOVEMBER, 4, 01, 59, 59); Calendar testDateEndIn = new GregorianCalendar(2012, Calendar.NOVEMBER, 4, 02, 00, 00); Calendar testDateStartOut = new GregorianCalendar(2012, Calendar.MARCH, 11, 01, 59, 59); Calendar testDateStartIn = new GregorianCalendar(2012, Calendar.MARCH, 11, 02, 00, 00); SimpleTimeZone est = new SimpleTimeZone(-5 * 60 * 60 * 1000, "EST"); est.setStartRule(Calendar.MARCH, 8, -Calendar.SUNDAY, 2 * 60 * 60 * 1000); est.setEndRule(Calendar.NOVEMBER, 1, Calendar.SUNDAY, 2 * 60 * 60 * 1000); Calendar theCal = new GregorianCalendar(est); theCal.setTimeInMillis(testDateEndOut.getTimeInMillis()); log.info(" Cal date = " + new Timestamp(theCal.getTimeInMillis()) + " : " + theCal.getTimeZone().getDisplayName()); log.info(" Cal use DST = " + theCal.getTimeZone().useDaylightTime()); log.info(" Cal In DST = " + theCal.getTimeZone().inDaylightTime(theCal.getTime())); log.info("offset = " + theCal.getTimeZone().getOffset(theCal.getTimeInMillis())); log.info("DTS offset= " + theCal.getTimeZone().getDSTSavings()); assertEquals("End date Should be In DST", true, theCal.getTimeZone().inDaylightTime(theCal.getTime())); theCal.setTimeInMillis(testDateEndIn.getTimeInMillis()); log.info(" Cal date = " + new Timestamp(theCal.getTimeInMillis()) + " : " + theCal.getTimeZone().getDisplayName()); log.info(" Cal use DST = " + theCal.getTimeZone().useDaylightTime()); log.info(" Cal In DST = " + theCal.getTimeZone().inDaylightTime(theCal.getTime())); log.info("offset = " + theCal.getTimeZone().getOffset(theCal.getTimeInMillis())); log.info("DTS offset= " + theCal.getTimeZone().getDSTSavings()); assertEquals("End date Should be Out DST", false, theCal.getTimeZone().inDaylightTime(theCal.getTime())); theCal.setTimeInMillis(testDateStartIn.getTimeInMillis()); log.info(" Cal date = " + new Timestamp(theCal.getTimeInMillis()) + " : " + theCal.getTimeZone().getDisplayName()); log.info(" Cal use DST = " + theCal.getTimeZone().useDaylightTime()); log.info(" Cal In DST = " + theCal.getTimeZone().inDaylightTime(theCal.getTime())); log.info("offset = " + theCal.getTimeZone().getOffset(theCal.getTimeInMillis())); log.info("DTS offset= " + theCal.getTimeZone().getDSTSavings()); assertEquals("Start date Should be in DST", true, theCal.getTimeZone().inDaylightTime(theCal.getTime())); theCal.setTimeInMillis(testDateStartOut.getTimeInMillis()); log.info(" Cal date = " + new Timestamp(theCal.getTimeInMillis()) + " : " + theCal.getTimeZone().getDisplayName()); log.info(" Cal use DST = " + theCal.getTimeZone().useDaylightTime()); log.info(" Cal In DST = " + theCal.getTimeZone().inDaylightTime(theCal.getTime())); log.info("offset = " + theCal.getTimeZone().getOffset(theCal.getTimeInMillis())); log.info("DTS offset= " + theCal.getTimeZone().getDSTSavings()); assertEquals("Start date Should be Out DST", false, theCal.getTimeZone().inDaylightTime(theCal.getTime())); } } Ok, i want to test the date limits to see if the inDaylightTime return the right thing! So, my rules are : DST start the second sunday of March at 2am DST end the first sunday of november at 2am In 2012 (now) this give us the march 11 at 2am and November 4 at 2am You can see my test dates are set properly!!! Well here is the output of my test run: 2012-11-01 18:22:44,344 INFO [test.SimpleTimeZoneTest] - < Cal date = 2012-11-04 01:59:59.0 : Eastern Standard Time> 2012-11-01 18:22:44,345 INFO [test.SimpleTimeZoneTest] - < Cal use DST = true> 2012-11-01 18:22:44,345 INFO [test.SimpleTimeZoneTest] - < Cal In DST = false> 2012-11-01 18:22:44,345 INFO [test.SimpleTimeZoneTest] - <offset = -18000000> 2012-11-01 18:22:44,345 INFO [test.SimpleTimeZoneTest] - <DTS offset= 3600000> My first assert just fails and tell me that 2012-11-04 01:59:59 is not inDST... !!!!??? If i put 2012-11-04 00:59:59, the test pass! This 1 hour gap just puzzle me... can anyone explain this behavior? Oh, btw, if anyone could elaborate on the : est.setStartRule(Calendar.MARCH, 8, -Calendar.SUNDAY, 2 * 60 * 60 * 1000); Why 8 means second week of march... and the -SUNDAY. I can't figure out this thing on a real calendar example!!! Thanks

    Read the article

  • Handling android player errors

    - by stack hoss
    I am anew android developer and i made ashoutcast radio player and work good but when i open app it work for afew time but suddenly stop and need to press stop and play again but i need Handling android player errors to automatic restart on errors package com.test.test; import java.io.IOException; import android.app.Notification; import android.app.NotificationManager; import android.app.PendingIntent; import android.app.Service; import android.content.Context; import android.content.Intent; import android.content.SharedPreferences; import android.media.AudioManager; import android.media.AudioManager.OnAudioFocusChangeListener; import android.media.MediaPlayer; import android.os.IBinder; import android.preference.PreferenceManager; import android.util.Log; public class StreamService extends Service { private static final String TAG = "StreamService"; MediaPlayer mp; boolean isPlaying; Intent MainActivity; SharedPreferences prefs; SharedPreferences.Editor editor; Notification n; NotificationManager notificationManager; // Change this int to some number specifically for this app int notifId = 85; private OnAudioFocusChangeListener focusChangeListener = new OnAudioFocusChangeListener() { public void onAudioFocusChange(int focusChange) { switch (focusChange) { case (AudioManager.AUDIOFOCUS_LOSS_TRANSIENT_CAN_DUCK) : // Lower the volume while ducking. mp.setVolume(0.2f, 0.2f); break; case (AudioManager.AUDIOFOCUS_LOSS_TRANSIENT) : mp.pause(); break; case (AudioManager.AUDIOFOCUS_LOSS) : mp.stop(); break; case (AudioManager.AUDIOFOCUS_GAIN) : // Return the volume to normal and resume if paused. mp.setVolume(1f, 1f); mp.start(); break; default: break; } } }; @Override public IBinder onBind(Intent arg0) { // TODO Auto-generated method stub return null; } @SuppressWarnings("deprecation") @Override public void onCreate() { super.onCreate(); Log.d(TAG, "onCreate"); // Init the SharedPreferences and Editor prefs = PreferenceManager.getDefaultSharedPreferences(getApplicationContext()); editor = prefs.edit(); // Set up the buffering notification notificationManager = (NotificationManager) getApplicationContext() .getSystemService(NOTIFICATION_SERVICE); Context context = getApplicationContext(); String notifTitle = context.getResources().getString(R.string.app_name); String notifMessage = context.getResources().getString(R.string.buffering); n = new Notification(); n.icon = R.drawable.ic_launcher; n.tickerText = "Buffering"; n.when = System.currentTimeMillis(); Intent nIntent = new Intent(context, MainActivity.class); nIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK | Intent.FLAG_ACTIVITY_SINGLE_TOP); PendingIntent pIntent = PendingIntent.getActivity(context, 0, nIntent, 0); n.setLatestEventInfo(context, notifTitle, notifMessage, pIntent); notificationManager.notify(notifId, n); // It's very important that you put the IP/URL of your ShoutCast stream here // Otherwise you'll get Webcom Radio String url = "http://47.182.19.93:9888/"; mp = new MediaPlayer(); mp.setAudioStreamType(AudioManager.STREAM_MUSIC); try { mp.reset(); mp.setDataSource(url); mp.prepare(); mp.start(); } catch (IllegalArgumentException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (SecurityException e) { // TODO Auto-generated catch block Log.e(TAG, "SecurityException"); } catch (IllegalStateException e) { // TODO Auto-generated catch block Log.e(TAG, "IllegalStateException"); } catch (IOException e) { // TODO Auto-generated catch block Log.e(TAG, "IOException"); } } @SuppressWarnings("deprecation") @Override public void onStart(Intent intent, int startId) { Log.d(TAG, "onStart"); mp.start(); // Set the isPlaying preference to true editor.putBoolean("isPlaying", true); editor.commit(); Context context = getApplicationContext(); String notifTitle = context.getResources().getString(R.string.app_name); String notifMessage = context.getResources().getString(R.string.now_playing); n.icon = R.drawable.ic_launcher; n.tickerText = notifMessage; n.flags = Notification.FLAG_NO_CLEAR; n.when = System.currentTimeMillis(); Intent nIntent = new Intent(context, MainActivity.class); PendingIntent pIntent = PendingIntent.getActivity(context, 0, nIntent, 0); n.setLatestEventInfo(context, notifTitle, notifMessage, pIntent); // Change 5315 to some nother number notificationManager.notify(notifId, n); AudioManager am = (AudioManager)getSystemService(Context.AUDIO_SERVICE); // Request audio focus for playback int result = am.requestAudioFocus(focusChangeListener, // Use the music stream. AudioManager.STREAM_MUSIC, // Request permanent focus. AudioManager.AUDIOFOCUS_GAIN); if (result == AudioManager.AUDIOFOCUS_REQUEST_GRANTED) { // other app had stopped playing song now , so u can do u stuff now . } } @Override public void onDestroy() { Log.d(TAG, "onDestroy"); mp.stop(); mp.release(); mp = null; editor.putBoolean("isPlaying", false); editor.commit(); notificationManager.cancel(notifId); AudioManager am = (AudioManager)getSystemService(Context.AUDIO_SERVICE); am.abandonAudioFocus(focusChangeListener); } }

    Read the article

  • Vertical Scroll not working, are the guides but the screen does not scroll.

    - by Leandro
    package com.lcardenas.infoberry; import net.rim.device.api.system.DeviceInfo; import net.rim.device.api.system.GPRSInfo; import net.rim.device.api.system.Memory; import net.rim.device.api.ui.MenuItem; import net.rim.device.api.ui.component.Dialog; import net.rim.device.api.ui.component.LabelField; import net.rim.device.api.ui.component.Menu; import net.rim.device.api.ui.component.SeparatorField; import net.rim.device.api.ui.container.MainScreen; import net.rim.device.api.ui.container.VerticalFieldManager; import net.rim.device.api.ui.decor.Background; import net.rim.device.api.ui.decor.BackgroundFactory; public class vtnprincipal extends MainScreen { //llamamos a la clase principal private InfoBerry padre; //variables para el menu private MenuItem mnubateria; private MenuItem mnuestado; private MenuItem mnuacerca; public vtnprincipal(InfoBerry padre) { super(); this.padre = padre; } public void incventana(){ VerticalFieldManager _ventana = new VerticalFieldManager(VerticalFieldManager.VERTICAL_SCROLL | VerticalFieldManager.VERTICAL_SCROLLBAR); double tmemoria =((DeviceInfo.getTotalFlashSize()/1024)/1024.00); double fmemoria = ((Memory.getFlashFree()/1024)/1024.00); Background cyan = BackgroundFactory.createSolidBackground(0x00E0FFFF); Background gris = BackgroundFactory.createSolidBackground(0x00DCDCDC ); //Borramos todos de la pantalla this.deleteAll(); //llamamos al menu incMenu(); //DIBUJAMOS LA VENTANA try{ LabelField title = new LabelField("Info Berry", LabelField.FIELD_HCENTER | LabelField.USE_ALL_HEIGHT ); setTitle(title); _ventana.add(new LabelField("Información del Dispositivo", LabelField.FIELD_HCENTER |LabelField.RIGHT | LabelField.USE_ALL_HEIGHT | LabelField.NON_FOCUSABLE )); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); txthorizontal modelo = new txthorizontal("Modelo:", DeviceInfo.getDeviceName()); modelo.setBackground(gris); _ventana.add(modelo); txthorizontal pin = new txthorizontal("PIN:" , Integer.toHexString(DeviceInfo.getDeviceId()).toUpperCase()); pin.setBackground(cyan); _ventana.add(pin); txthorizontal imeid = new txthorizontal("IMEID:" , GPRSInfo.imeiToString(GPRSInfo.getIMEI())); imeid.setBackground(gris); _ventana.add(imeid); txthorizontal version= new txthorizontal("SO Versión:" , DeviceInfo.getSoftwareVersion()); version.setBackground(cyan); _ventana.add(version); txthorizontal plataforma= new txthorizontal("SO Plataforma:" , DeviceInfo.getPlatformVersion()); plataforma.setBackground(gris); _ventana.add(plataforma); txthorizontal numero= new txthorizontal("Numero Telefonico: " , "Hay que firmar"); numero.setBackground(cyan); _ventana.add(numero); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); _ventana.add(new LabelField("Memoria", LabelField.FIELD_HCENTER | LabelField.USE_ALL_HEIGHT | LabelField.NON_FOCUSABLE)); _ventana.add(new SeparatorField()); txthorizontal totalm= new txthorizontal("Memoria app Total:" , mmemoria(tmemoria) + " Mb"); totalm.setBackground(gris); _ventana.add(totalm); txthorizontal disponiblem= new txthorizontal("Memoria app Disponible:" , mmemoria(fmemoria) + " Mb"); disponiblem.setBackground(cyan); _ventana.add(disponiblem); ///txthorizontal estadoram = new txthorizontal("Memoria RAM:" , mmemoria(prueba) + " Mb"); //estadoram.setBackground(gris); //add(estadoram); _ventana.add(new SeparatorField()); _ventana.add(new SeparatorField()); this.add(_ventana); }catch(Exception e){ Dialog.alert("Excepción en clase vtnprincipal: " + e.toString()); } } //DIBUJAMOS EL MENU private void incMenu() { MenuItem.separator(30); mnubateria = new MenuItem("Bateria",40, 10) { public void run() { bateria(); } }; mnuestado = new MenuItem("Estado de Red", 50, 10) { public void run() { estado(); } }; mnuacerca = new MenuItem("Acerca de..", 60, 10) { public void run() { acerca(); } }; MenuItem.separator(70); }; // public void makeMenu(Menu menu, int instance) { if (!menu.isDisplayed()) { menu.deleteAll(); menu.add(MenuItem.separator(30)); menu.add(mnubateria); menu.add(mnuestado); menu.add(mnuacerca); menu.add(MenuItem.separator(60)); } } public void bateria(){ padre.vtnbateria.incventana(); padre.pushScreen(padre.vtnbateria); } public void estado(){ padre.vtnestado.incventana(); padre.pushScreen(padre.vtnestado); } public void acerca(){ padre.vtnacerca.incventana(); padre.pushScreen(padre.vtnacerca); } public boolean onClose(){ Dialog.alert("Hasta Luego"); System.exit(0); return true; } public double mmemoria(double x) { if ( x > 0 ) return Math.floor(x * 100) / 100; else return Math.ceil(x * 100) / 100; } }

    Read the article

  • Problem with custom Dialog Android

    - by Nanis
    Hi, I have a custom Dialog on my app and I have a problem to do what I would like. I explain. My Dialog have had 4 Buttons. (Back, Valid, Modify and Restore) When user click on Modify or Valid I would like to call another activity. So I use Intent but it crash. The error Log : 05-19 13:29:21.495: ERROR/DEBUGTAG(974): java.lang.NullPointerException 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.content.ComponentName.(ComponentName.java:75) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.content.Intent.(Intent.java:2551) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.booztermobile.activity.HeaderMailDisplayActivity.onClick(HeaderMailDisplayActivity.java:571) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.View.performClick(View.java:2364) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.View.onTouchEvent(View.java:4179) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.widget.TextView.onTouchEvent(TextView.java:6540) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.View.dispatchTouchEvent(View.java:3709) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.internal.policy.impl.PhoneWindow$DecorView.superDispatchTouchEvent(PhoneWindow.java:1659) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.internal.policy.impl.PhoneWindow.superDispatchTouchEvent(PhoneWindow.java:1107) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.app.Dialog.dispatchTouchEvent(Dialog.java:643) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.internal.policy.impl.PhoneWindow$DecorView.dispatchTouchEvent(PhoneWindow.java:1643) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.view.ViewRoot.handleMessage(ViewRoot.java:1691) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.os.Handler.dispatchMessage(Handler.java:99) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.os.Looper.loop(Looper.java:123) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at android.app.ActivityThread.main(ActivityThread.java:4363) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at java.lang.reflect.Method.invokeNative(Native Method) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at java.lang.reflect.Method.invoke(Method.java:521) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 05-19 13:29:21.495: ERROR/DEBUGTAG(974): at dalvik.system.NativeStart.main(Native Method) My custom Dialog : package com.android.booztermobile.services; import com.android.booztermobile.R; import android.app.Dialog; import android.content.Context; import android.os.Bundle; import android.util.Log; import android.widget.Button; public class MailDialog extends Dialog { private Button btnValid; private Button btnBack; private Button btnRestore; private Button btnModify; private Context context; public MailDialog(Context cont) { super(cont); context = cont; } @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); Log.d("TestApp", "Dialog created"); setContentView(R.layout.dialog_classement); btnValid = (Button) findViewById(R.id.btnValidClassement); btnBack = (Button) findViewById(R.id.btnBackClassement); btnRestore = (Button) findViewById(R.id.btnRestoreClassement); btnModify = (Button) findViewById(R.id.btnModifyClassement); } } and the activity (cut because too long): //create dialog public void getMailInformations(View v, Context context){ currentMail = (MailHeader) v.getTag(); dial = new MailDialog(context); dial.setTitle("Classement"); dial.show(); btnValidClassement = (Button) dial.findViewById(R.id.btnValidClassement); btnValidClassement.setOnClickListener(this); } /** the Onclick : */ public void onClick(View view) { if(view == btnValidClassement){ try{ ClassementHandlerCall classement = new ClassementHandlerCall(); boolean mailClassify = classement.classifyMail(AuthentificationActivity.uidh, String.valueOf(currentMail.getSeqnum()), null, null); dial.dismiss(); if (mailClassify == true){ // create Intent Intent defineIntentDisplayPreviousMails = new Intent(HeaderMailDisplayActivity.this, ClassementActivity.class); } }catch(Exception e){ // TODO Auto-generated catch block Log.e("DEBUGTAG","Error occured", e); e.printStackTrace(); } } }

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Ruby erb template- try to change layout- get error

    - by nigel curruthers
    Hi there! I'm working my way through adapting a template I have been given that is basically a list of products for sale. I want to change it from a top-down list into a table layout. I want to end up with something as follows- <div id= 'ladiesproducts'> <% ladies_products = hosting_products.find_all do |product| product.name.match("ladies") end %> <table><tbody> <% [ladies_products].each do | slice | %> <tr> <% slice.each do | product | %> <td> <h4><%= product.name.html %></h4> <p><%= product.description %></p> <% other parts go here %> </td> <% end %> </tr> <% end %> </tbody></table> </div> This works fine for the layout that I am trying to achieve. The problem I have is when I paste back the <% other parts go here % part of the code. I get an internal error message on the page. I am completely new to Ruby so am just bumbling my way through this really. I have a hunch that I'm neglecting something that is probably very simple. The <% other parts go here %> code is as follows: <input type='hidden' name='base_renewal_period-<%= i %>' value="<%= product.base_renewal_period %>" /> <input type='hidden' name='quoted_unit_price-<%= i %>' value="<%= billing.price(product.unit_price) %>" /> <p><input type='radio' name='add-product' value='<%= product.specific_type.html %>:<%= i %>:base_renewal_period,quoted_unit_price,domain' /><%= billing.currency_symbol.html %><%= billing.price(product.unit_price, :use_tax_prefs) %> <% if product.base_renewal_period != 'never' %> every <%= product.unit_period.to_s_short.html %> <% end %> <% if product.setup_fee != 0 %> plus a one off fee of <%= billing.currency_symbol.html %><%= sprintf("%.2f", if billing.include_tax? then billing.price(product.setup_fee) else product.setup_fee end) %> <% end %> <% if product.has_free_products? %> <br /> includes free domains <% product.free_products_list.each do | free_product | %> <%= free_product["free_name"] %> <% end %> <% end %> * </p> <% i = i + 1 %> <% end %> <p><input type='submit' value='Add to Basket'/></p> </form> <% unless basket.nil? or basket.empty? or no_upsell? %> <p><a href='basket?add-no-product=package'>No thank you, please continue with my order ...</a></p> <% end %> <% if not billing.tax_applies? %> <% elsif billing.include_tax? %> <p>* Includes <%= billing.tax_name %></p> <% else %> <p>* Excluding <%= billing.tax_name %></p> <% end %> If anyone can point out what I'm doing wrong or what I'm missing or failing to change I would GREATLY appreciate it! Many thanks in advance. Nigel

    Read the article

  • Possible to manipulate UI elements via dispatchEvent()?

    - by rinogo
    Hi all! I'm trying to manually dispatch events on a textfield so I can manipulate it indirectly via code (e.g. place cursor at a given set of x/y coordinates). However, my events seem to have no effect. I've written a test to experiment with this phenomenon: package sandbox { import flash.display.Sprite; import flash.events.MouseEvent; import flash.text.TextField; import flash.text.TextFieldType; import flash.text.TextFieldAutoSize; import flash.utils.setTimeout; public class Test extends Sprite { private var tf:TextField; private var tf2:TextField; public function Test() { super(); tf = new TextField(); tf.text = 'Interact here'; tf.type = TextFieldType.INPUT; addChild(tf); tf2 = new TextField(); tf2.text = 'Same events replayed with five second delay here'; tf2.autoSize = TextFieldAutoSize.LEFT; tf2.type = TextFieldType.INPUT; tf2.y = 30; addChild(tf2); tf.addEventListener(MouseEvent.CLICK, mouseListener); tf.addEventListener(MouseEvent.DOUBLE_CLICK, mouseListener); tf.addEventListener(MouseEvent.MOUSE_DOWN, mouseListener); tf.addEventListener(MouseEvent.MOUSE_MOVE, mouseListener); tf.addEventListener(MouseEvent.MOUSE_OUT, mouseListener); tf.addEventListener(MouseEvent.MOUSE_OVER, mouseListener); tf.addEventListener(MouseEvent.MOUSE_UP, mouseListener); tf.addEventListener(MouseEvent.MOUSE_WHEEL, mouseListener); tf.addEventListener(MouseEvent.ROLL_OUT, mouseListener); tf.addEventListener(MouseEvent.ROLL_OVER, mouseListener); } private function mouseListener(event:MouseEvent):void { //trace(event); setTimeout(function():void {trace(event); tf2.dispatchEvent(event);}, 5000); } } } Essentially, all this test does is to use setTimeout to effectively 'record' events on TextField tf and replay them five seconds later on TextField tf2. When an event is dispatched on tf2, it is traced to the console output. The console output upon running this program and clicking on tf is: [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=0 localY=1 stageX=0 stageY=1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="rollOver" bubbles=false cancelable=false eventPhase=2 localX=0 localY=1 stageX=0 stageY=1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseOver" bubbles=true cancelable=false eventPhase=3 localX=0 localY=1 stageX=0 stageY=1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=2 localY=1 stageX=2 stageY=1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=2 localY=2 stageX=2 stageY=2 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=2 localY=3 stageX=2 stageY=3 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=3 localY=3 stageX=3 stageY=3 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=5 localY=3 stageX=5 stageY=3 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=6 localY=5 stageX=6 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=7 localY=5 stageX=7 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=9 localY=5 stageX=9 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=10 localY=5 stageX=10 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=11 localY=5 stageX=11 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=12 localY=5 stageX=12 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseDown" bubbles=true cancelable=false eventPhase=3 localX=12 localY=5 stageX=12 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseUp" bubbles=true cancelable=false eventPhase=3 localX=12 localY=5 stageX=12 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="click" bubbles=true cancelable=false eventPhase=3 localX=12 localY=5 stageX=12 stageY=5 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=10 localY=4 stageX=10 stageY=4 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=9 localY=2 stageX=9 stageY=2 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseMove" bubbles=true cancelable=false eventPhase=3 localX=9 localY=1 stageX=9 stageY=1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="mouseOut" bubbles=true cancelable=false eventPhase=3 localX=-1 localY=-1 stageX=-1 stageY=-1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] [MouseEvent type="rollOut" bubbles=false cancelable=false eventPhase=2 localX=-1 localY=-1 stageX=-1 stageY=-1 relatedObject=null ctrlKey=false altKey=false shiftKey=false delta=0] As we can see, the events are being captured and replayed successfully. However, no change occurs in tf2 - the mouse cursor does not appear in tf2 as we would expect. In fact, the cursor remains in tf even after the tf2 events are dispatched. Please help! Thanks, -Rich

    Read the article

  • code for TouchPad works, but not for DPAD ...please help me to fix this..

    - by Chandan
    package org.coe.twoD; import android.app.Activity; import android.content.Context; import android.graphics.Canvas; import android.graphics.Color; import android.graphics.Paint; //import android.graphics.Path; import android.graphics.Rect; //import android.graphics.RectF; import android.os.Bundle; //import android.util.Log; import android.util.Log; import android.view.KeyEvent; import android.view.MotionEvent; import android.view.View; import android.view.View.OnClickListener; public class TwoD extends Activity implements OnClickListener { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); View draw2d = findViewById(R.id.draw_button); draw2d.setOnClickListener(this); } public void onClick(View v) { if (R.id.draw_button == v.getId()) { setContentView(new draw2D(this)); } } public class draw2D extends View { private static final String TAG = "Sudoku"; private float width; // width of one tile private float height; // height of one tile private int selX; // X index of selection private int selY; // Y index of selection private final Rect selRect = new Rect(); public draw2D(Context context) { super(context); } @Override protected void onSizeChanged(int w, int h, int oldw, int oldh) { width = w / 9f; height = h / 9f; getRect(selX, selY, selRect); Log.d(TAG, "onSizeChanged: width " + width + ", height " + height); super.onSizeChanged(w, h, oldw, oldh); } @Override protected void onDraw(Canvas canvas) { // Draw the background... Paint background = new Paint(); background.setColor(getResources().getColor(R.color.background)); canvas.drawRect(0, 0, getWidth(), getHeight(), background); // Draw the board... // Define colors for the grid lines Paint dark = new Paint(); dark.setColor(getResources().getColor(R.color.dark)); Paint hilite = new Paint(); hilite.setColor(getResources().getColor(R.color.hilite)); Paint light = new Paint(); light.setColor(getResources().getColor(R.color.light)); // Draw the minor grid lines for (int i = 0; i < 9; i++) { canvas.drawLine(0, i * height, getWidth(), i * height, light); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), light); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } // Draw the major grid lines for (int i = 0; i < 9; i++) { if (i % 3 != 0) continue; canvas.drawLine(0, i * height, getWidth(), i * height, dark); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), dark); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } /* * dark.setColor(Color.MAGENTA); Path circle= new Path(); * circle.addCircle(150, 150, 100, Path.Direction.CW); * canvas.drawPath(circle, dark); * * * Path rect=new Path(); * * RectF rectf= new RectF(150,200,250,300); rect.addRect(rectf, * Path.Direction.CW); canvas.drawPath(rect, dark); * * * canvas.drawRect(0, 0,250, 250, dark); * * * canvas.drawText("Hello", 200,200, dark); */ Paint selected = new Paint(); selected.setColor(Color.GREEN); canvas.drawRect(selRect, selected); } /* * public boolean onTouchEvent(MotionEvent event){ * if(event.getAction()!=MotionEvent.ACTION_DOWN) return * super.onTouchEvent(event); * select((int)(event.getX()/width),(int)(event.getY()/height)); * * * return true; } */ private void select(int x, int y) { invalidate(selRect); selX = Math.min(Math.max(x, 0), 8); selY = Math.min(Math.max(y, 0), 8); getRect(selX, selY, selRect); invalidate(selRect); } @Override public boolean onKeyUp(int keyCode, KeyEvent event) { return super.onKeyUp(keyCode, event); } @Override public boolean onTouchEvent(MotionEvent event) { if (event.getAction() != MotionEvent.ACTION_DOWN) return super.onTouchEvent(event); select((int) (event.getX() / width), (int) (event.getY() / height)); // game.showKeypadOrError(selX, selY); Log.d(TAG, "onTouchEvent: x " + selX + ", y " + selY); return true; } @Override public boolean onKeyDown(int keyCode, KeyEvent event) { Log.d(TAG, "onKeyDown: keycode=" + keyCode + ", event=" + event); switch (keyCode) { case KeyEvent.KEYCODE_DPAD_UP: select(selX, selY - 1); break; case KeyEvent.KEYCODE_DPAD_DOWN: select(selX, selY + 1); break; case KeyEvent.KEYCODE_DPAD_LEFT: select(selX - 1, selY); break; case KeyEvent.KEYCODE_DPAD_RIGHT: select(selX + 1, selY); break; default: return super.onKeyDown(keyCode, event); } return true; } private void getRect(int x, int y, Rect rect) { rect.set((int) (x * width), (int) (y * height), (int) (x * width + width), (int) (y * height + height)); } } }

    Read the article

  • problem processing xml in flex3

    - by john
    Hi All, First time here asking a question and still learning on how to format things better... so sorry about the format as it does not look too well. I have started learning flex and picked up a book and tried to follow the examples in it. However, I got stuck with a problem. I have a jsp page which returns xml which basically have a list of products. I am trying to parse this xml, in other words go through products, and create Objects for each product node and store them in an ArrayCollection. The problem I believe I am having is I am not using the right way of navigating through xml. The xml that is being returned from the server looks like this: <?xml version="1.0" encoding="ISO-8859-1"?><result type="success"> <products> <product> <id>6</id> <cat>electronics</cat> <name>Plasma Television</name> <desc>65 inch screen with 1080p</desc> <price>$3000.0</price> </product> <product> <id>7</id> <cat>electronics</cat> <name>Surround Sound Stereo</name> <desc>7.1 surround sound receiver with wireless speakers</desc> <price>$1000.0</price> </product> <product> <id>8</id> <cat>appliances</cat> <name>Refrigerator</name> <desc>Bottom drawer freezer with water and ice on the door</desc> <price>$1200.0</price> </product> <product> <id>9</id> <cat>appliances</cat> <name>Dishwasher</name> <desc>Large capacity with water saver setting</desc> <price>$500.0</price> </product> <product> <id>10</id> <cat>furniture</cat> <name>Leather Sectional</name> <desc>Plush leather with room for 6 people</desc> <price>$1500.0</price> </product> </products></result> And I have flex code that tries to iterate over products like following: private function productListHandler(e:JavaFlexStoreEvent):void { productData = new ArrayCollection(); trace(JavaServiceHandler(e.currentTarget).response); for each (var item:XML in JavaServiceHandler(e.currentTarget).response..product ) { productData.addItem( { id:item.id, item:item.name, price:item.price, description:item.desc }); } } with trace, I can see the xml being returned from the server. However, I cannot get inside the loop as if the xml was empty. In other words, JavaServiceHandler(e.currentTarget).response..product must be returning nothing. Can someone please help/point out what I could be doing wrong. My JavaServiceHandler class looks like this: package com.wiley.jfib.store.data { import com.wiley.jfib.store.events.JavaFlexStoreEvent; import flash.events.Event; import flash.events.EventDispatcher; import flash.net.URLLoader; import flash.net.URLRequest; public class JavaServiceHandler extends EventDispatcher { public var serviceURL:String = ""; public var response:XML; public function JavaServiceHandler() { } public function callServer():void { if(serviceURL == "") { throw new Error("serviceURL is a required parameter"); return; } var loader:URLLoader = new URLLoader(); loader.addEventListener(Event.COMPLETE, handleResponse); loader.load(new URLRequest(serviceURL)); // var httpService:HTTPService = new HTTPService(); // httpService.url = serviceURL; // httpService.resultFormat = "e4x"; // httpService.addEventListener(Event.COMPLETE, handleResponse); // httpService.send(); } private function handleResponse(e:Event):void { var loader:URLLoader = URLLoader(e.currentTarget); response = XML(loader.data); dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); // var httpService:HTTPService = HTTPService(e.currentTarget); // response = httpService.lastResult.product; // dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); } } } Even though I refer to this as mine and it is not in reality. This is from a Flex book as a code sample which does not work, go figure. Any help is appreciated. Thanks john

    Read the article

  • JSF2 - Why does render response not rerender component setting?

    - by fekete-kamosh
    From the tutorial: "If the request is a postback and errors were encountered during the apply request values phase, process validations phase, or update model values phase, the original page is rendered during Render response phase" (http://java.sun.com/javaee/5/docs/tutorial/doc/bnaqq.html) Does it mean that if view is restored in "Restore View" phase and then any apply request/validation/update model phase fails and skips to "Render response" that Render response only passes restored view without any changes to client? Managed Bean: package cz.test; import javax.faces.bean.ManagedBean; import javax.faces.bean.RequestScoped; @ManagedBean @RequestScoped public class TesterBean { // Simple DataStore (in real world EJB) private static String storedSomeValue = null; private String someValue; public TesterBean() { } public String storeValue() { storedSomeValue = someValue; return "index"; } public String eraseValue() { storedSomeValue = null; return "index"; } public String getSomeValue() { someValue = storedSomeValue; return someValue; } public void setSomeValue(String someValue) { this.someValue = someValue; } } Composite component: <?xml version='1.0' encoding='ISO-8859-1' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:composite="http://java.sun.com/jsf/composite" xmlns:c="http://java.sun.com/jsp/jstl/core"> <!-- INTERFACE --> <composite:interface> <composite:attribute name="currentBehaviour" type="java.lang.String" required="true"/> <composite:attribute name="fieldValue" required="true"/> </composite:interface> <!-- IMPLEMENTATION --> <composite:implementation> <h:panelGrid columns="3"> <c:choose> <c:when test="#{cc.attrs.currentBehaviour == 'READONLY'}" > <h:outputText id="fieldValue" value="#{cc.attrs.fieldValue}"> </h:outputText> </c:when> <c:when test="#{cc.attrs.currentBehaviour == 'MANDATORY'}" > <h:inputText id="fieldValue" value="#{cc.attrs.fieldValue}" required="true"> <f:attribute name="requiredMessage" value="Field is mandatory"/> <c:if test="#{empty cc.attrs.fieldValue}"> <f:attribute name="style" value="background-color: yellow;"/> </c:if> </h:inputText>&nbsp;* </c:when> <c:when test="#{cc.attrs.currentBehaviour == 'OPTIONAL'}" > <h:inputText id="fieldValue" value="#{cc.attrs.fieldValue}"> </h:inputText> </c:when> </c:choose> <h:message for="fieldValue" style="color:red;" /> </h:panelGrid> </composite:implementation> Page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:ez="http://java.sun.com/jsf/composite/components"> <h:head> <title>Testing page</title> </h:head> <h:body> <h:form> <h:outputText value="Some value:"/> <ez:field-component currentBehaviour="MANDATORY" fieldValue="#{testerBean.someValue}"/> <h:commandButton value="Store" action="#{testerBean.storeValue}"/> <h:commandButton value="Erase" action="#{testerBean.eraseValue}" immediate="true"/> </h:form> <br/><br/> <b>Why is field's background color not set to yellow?</b> <ol> <li>NOTICE: Field has yellow background color (mandatory field with no value)</li> <li>Fill in any value (eg. "Hello") and press Store</li> <li>NOTICE: Yellow background disappeared (as mandatory field has value)</li> <li>Clear text in the field and press Store</li> <li><b>QUESTION: Why is field's background color not set to yellow?</b></li> <li>Press Erase</li> <li>NOTICE: Field has yellow background color (mandatory field with no value)</li> </ol> </h:body>

    Read the article

  • python- scipy optimization

    - by pear
    In scipy fmin_slsqp (Sequential Least Squares Quadratic Programming), I tried reading the code 'slsqp.py' provided with the scipy package, to find what are the criteria to get the exit_modes 0? I cannot find which statements in the code produce this exit mode? Please help me 'slsqp.py' code as follows, exit_modes = { -1 : "Gradient evaluation required (g & a)", 0 : "Optimization terminated successfully.", 1 : "Function evaluation required (f & c)", 2 : "More equality constraints than independent variables", 3 : "More than 3*n iterations in LSQ subproblem", 4 : "Inequality constraints incompatible", 5 : "Singular matrix E in LSQ subproblem", 6 : "Singular matrix C in LSQ subproblem", 7 : "Rank-deficient equality constraint subproblem HFTI", 8 : "Positive directional derivative for linesearch", 9 : "Iteration limit exceeded" } def fmin_slsqp( func, x0 , eqcons=[], f_eqcons=None, ieqcons=[], f_ieqcons=None, bounds = [], fprime = None, fprime_eqcons=None, fprime_ieqcons=None, args = (), iter = 100, acc = 1.0E-6, iprint = 1, full_output = 0, epsilon = _epsilon ): # Now do a lot of function wrapping # Wrap func feval, func = wrap_function(func, args) # Wrap fprime, if provided, or approx_fprime if not if fprime: geval, fprime = wrap_function(fprime,args) else: geval, fprime = wrap_function(approx_fprime,(func,epsilon)) if f_eqcons: # Equality constraints provided via f_eqcons ceval, f_eqcons = wrap_function(f_eqcons,args) if fprime_eqcons: # Wrap fprime_eqcons geval, fprime_eqcons = wrap_function(fprime_eqcons,args) else: # Wrap approx_jacobian geval, fprime_eqcons = wrap_function(approx_jacobian, (f_eqcons,epsilon)) else: # Equality constraints provided via eqcons[] eqcons_prime = [] for i in range(len(eqcons)): eqcons_prime.append(None) if eqcons[i]: # Wrap eqcons and eqcons_prime ceval, eqcons[i] = wrap_function(eqcons[i],args) geval, eqcons_prime[i] = wrap_function(approx_fprime, (eqcons[i],epsilon)) if f_ieqcons: # Inequality constraints provided via f_ieqcons ceval, f_ieqcons = wrap_function(f_ieqcons,args) if fprime_ieqcons: # Wrap fprime_ieqcons geval, fprime_ieqcons = wrap_function(fprime_ieqcons,args) else: # Wrap approx_jacobian geval, fprime_ieqcons = wrap_function(approx_jacobian, (f_ieqcons,epsilon)) else: # Inequality constraints provided via ieqcons[] ieqcons_prime = [] for i in range(len(ieqcons)): ieqcons_prime.append(None) if ieqcons[i]: # Wrap ieqcons and ieqcons_prime ceval, ieqcons[i] = wrap_function(ieqcons[i],args) geval, ieqcons_prime[i] = wrap_function(approx_fprime, (ieqcons[i],epsilon)) # Transform x0 into an array. x = asfarray(x0).flatten() # Set the parameters that SLSQP will need # meq = The number of equality constraints if f_eqcons: meq = len(f_eqcons(x)) else: meq = len(eqcons) if f_ieqcons: mieq = len(f_ieqcons(x)) else: mieq = len(ieqcons) # m = The total number of constraints m = meq + mieq # la = The number of constraints, or 1 if there are no constraints la = array([1,m]).max() # n = The number of independent variables n = len(x) # Define the workspaces for SLSQP n1 = n+1 mineq = m - meq + n1 + n1 len_w = (3*n1+m)*(n1+1)+(n1-meq+1)*(mineq+2) + 2*mineq+(n1+mineq)*(n1-meq) \ + 2*meq + n1 +(n+1)*n/2 + 2*m + 3*n + 3*n1 + 1 len_jw = mineq w = zeros(len_w) jw = zeros(len_jw) # Decompose bounds into xl and xu if len(bounds) == 0: bounds = [(-1.0E12, 1.0E12) for i in range(n)] elif len(bounds) != n: raise IndexError, \ 'SLSQP Error: If bounds is specified, len(bounds) == len(x0)' else: for i in range(len(bounds)): if bounds[i][0] > bounds[i][1]: raise ValueError, \ 'SLSQP Error: lb > ub in bounds[' + str(i) +'] ' + str(bounds[4]) xl = array( [ b[0] for b in bounds ] ) xu = array( [ b[1] for b in bounds ] ) # Initialize the iteration counter and the mode value mode = array(0,int) acc = array(acc,float) majiter = array(iter,int) majiter_prev = 0 # Print the header if iprint >= 2 if iprint >= 2: print "%5s %5s %16s %16s" % ("NIT","FC","OBJFUN","GNORM") while 1: if mode == 0 or mode == 1: # objective and constraint evaluation requird # Compute objective function fx = func(x) # Compute the constraints if f_eqcons: c_eq = f_eqcons(x) else: c_eq = array([ eqcons[i](x) for i in range(meq) ]) if f_ieqcons: c_ieq = f_ieqcons(x) else: c_ieq = array([ ieqcons[i](x) for i in range(len(ieqcons)) ]) # Now combine c_eq and c_ieq into a single matrix if m == 0: # no constraints c = zeros([la]) else: # constraints exist if meq > 0 and mieq == 0: # only equality constraints c = c_eq if meq == 0 and mieq > 0: # only inequality constraints c = c_ieq if meq > 0 and mieq > 0: # both equality and inequality constraints exist c = append(c_eq, c_ieq) if mode == 0 or mode == -1: # gradient evaluation required # Compute the derivatives of the objective function # For some reason SLSQP wants g dimensioned to n+1 g = append(fprime(x),0.0) # Compute the normals of the constraints if fprime_eqcons: a_eq = fprime_eqcons(x) else: a_eq = zeros([meq,n]) for i in range(meq): a_eq[i] = eqcons_prime[i](x) if fprime_ieqcons: a_ieq = fprime_ieqcons(x) else: a_ieq = zeros([mieq,n]) for i in range(mieq): a_ieq[i] = ieqcons_prime[i](x) # Now combine a_eq and a_ieq into a single a matrix if m == 0: # no constraints a = zeros([la,n]) elif meq > 0 and mieq == 0: # only equality constraints a = a_eq elif meq == 0 and mieq > 0: # only inequality constraints a = a_ieq elif meq > 0 and mieq > 0: # both equality and inequality constraints exist a = vstack((a_eq,a_ieq)) a = concatenate((a,zeros([la,1])),1) # Call SLSQP slsqp(m, meq, x, xl, xu, fx, c, g, a, acc, majiter, mode, w, jw) # Print the status of the current iterate if iprint > 2 and the # major iteration has incremented if iprint >= 2 and majiter > majiter_prev: print "%5i %5i % 16.6E % 16.6E" % (majiter,feval[0], fx,linalg.norm(g)) # If exit mode is not -1 or 1, slsqp has completed if abs(mode) != 1: break majiter_prev = int(majiter) # Optimization loop complete. Print status if requested if iprint >= 1: print exit_modes[int(mode)] + " (Exit mode " + str(mode) + ')' print " Current function value:", fx print " Iterations:", majiter print " Function evaluations:", feval[0] print " Gradient evaluations:", geval[0] if not full_output: return x else: return [list(x), float(fx), int(majiter), int(mode), exit_modes[int(mode)] ]

    Read the article

  • Why cant i draw an elipse in with code?

    - by bvivek88
    package test; import java.awt.*; import java.awt.event.*; import java.awt.geom.Ellipse2D; import java.awt.image.BufferedImage; import javax.swing.*; public class test_bmp extends JPanel implements MouseListener,MouseMotionListener,ActionListener { static BufferedImage image; Color color; Point start=new Point(); Point end =new Point(); JButton elipse=new JButton("Elipse"); JButton rectangle=new JButton("Rectangle"); JButton line=new JButton("Line"); String selected; public test_bmp() { color = Color.black; setBorder(BorderFactory.createLineBorder(Color.black)); addMouseListener(this); addMouseMotionListener(this); } public void paintComponent(Graphics g) { //super.paintComponent(g); g.drawImage(image, 0, 0, this); Graphics2D g2 = (Graphics2D)g; g2.setPaint(Color.black); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } if(selected=="line") g2.drawLine(start.x,start.y,end.x,end.y); } //Draw on Buffered image public void draw() { Graphics2D g2 = image.createGraphics(); g2.setPaint(color); System.out.println("draw"); if(selected=="line") g2.drawLine(start.x, start.y, end.x, end.y); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } repaint(); g2.dispose(); } public JPanel addButtons() { JPanel buttonpanel=new JPanel(); buttonpanel.setBackground(color.lightGray); buttonpanel.setLayout(new BoxLayout(buttonpanel,BoxLayout.Y_AXIS)); elipse.addActionListener(this); rectangle.addActionListener(this); line.addActionListener(this); buttonpanel.add(elipse); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(rectangle); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(line); return buttonpanel; } public static void main(String args[]) { test_bmp application=new test_bmp(); //Main window JFrame frame=new JFrame("Whiteboard"); frame.setLayout(new BorderLayout()); frame.add(application.addButtons(),BorderLayout.WEST); frame.add(application); //size of the window frame.setSize(600,400); frame.setLocation(0,0); frame.setVisible(true); int w = frame.getWidth(); int h = frame.getHeight(); image = new BufferedImage(w, h, BufferedImage.TYPE_INT_RGB); Graphics2D g2 = image.createGraphics(); g2.setPaint(Color.white); g2.fillRect(0,0,w,h); g2.dispose(); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); } @Override public void mouseClicked(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseEntered(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseExited(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mousePressed(MouseEvent event) { start = event.getPoint(); } @Override public void mouseReleased(MouseEvent event) { end = event.getPoint(); draw(); } @Override public void mouseDragged(MouseEvent e) { end=e.getPoint(); repaint(); } @Override public void mouseMoved(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void actionPerformed(ActionEvent e) { if(e.getSource()==elipse) selected="elipse"; if(e.getSource()==line) selected="line"; draw(); } } I need to create a paint application, when i draw elipse by dragging mouse from left to right it displays nothing, why?? should i use any other function here?

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • How do I add the j2ee.jar to a Java2WSDL ant script programmatically?

    - by Marcus
    I am using IBM's Rational Application Developer. I have an ant script that contains the Java2WSDL task. When I run it via IBM, it gives compiler errors unless I include the j2ee.jar file in the classpath via the run tool (it does not pick up the jar files in the classpath in the script). However, I need to be able to call this script programmatically, and it is giving me this error: "java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException" I'm not sure which jars need to be added or where? Since a simple echo script runs, I assume that it is the j2ee.jar or another ant jar that needs to be added. I've added it to the project's buildpath, but that doesn't help. (I also have ant.jar, wsanttasks.jar, all the ant jars from the plugin, tools.jar, remoteAnt.jar, and the swt - all which are included in the buildpath when you run the script by itself.) Script: <?xml version="1.0" encoding="UTF-8"?> <project default="build" basedir="."> <path id="lib.path"> <fileset dir="C:\Program Files\IBM\WebSphere\AppServer\lib" includes="*.jar"/> <!-- Adding these does not help. <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins\org.apache.ant_1.6.5\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\jdk\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\configuration\org.eclipse.osgi\bundles\1139\1\.cp\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins" includes="*.jar"/> --> </path> <taskdef name="java2wsdl" classname="com.ibm.websphere.ant.tasks.Java2WSDL"> <classpath refid="lib.path"/> </taskdef> <target name="build"> <echo message="Beginning build"/> <javac srcdir="C:\J2W_Test\Java2Wsdl_Example" destdir="C:\J2W_Test\Java2Wsdl_Example"> <classpath refid="lib.path"/> <include name="WSExample.java"/> </javac> <echo message="Set up javac"/> <echo message="Running java2wsdl"/> <java2wsdl output="C:\J2W_Test\Java2Wsdl_Example\example\META-INF\wsdl\WSExample.wsdl" classpath="C:\J2W_Test\Java2Wsdl_Example" className= "example.WSExample" namespace="http://example" namespaceImpl="http://example" location="http://localhost:9080/example/services/WSExample" style="document" use="literal"> <mapping namespace="http://example" package="example"/> </java2wsdl> <echo message="Complete"/> </target> </project> Code: File buildFile = new File("build.xml"); Project p = new Project(); p.setUserProperty("ant.file", buildFile.getAbsolutePath()); DefaultLogger consoleLogger = new DefaultLogger(); consoleLogger.setErrorPrintStream(System.err); consoleLogger.setOutputPrintStream(System.out); consoleLogger.setMessageOutputLevel(Project.MSG_INFO); p.addBuildListener(consoleLogger); try { p.fireBuildStarted(); p.init(); ProjectHelper helper = ProjectHelper.getProjectHelper(); p.addReference("ant.projectHelper", helper); helper.parse(p, buildFile); p.executeTarget(p.getDefaultTarget()); p.fireBuildFinished(null); } catch (BuildException e) { p.fireBuildFinished(e); } Error: [java2wsdl] java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException [java2wsdl] at java.lang.J9VMInternals.verifyImpl(Native Method) [java2wsdl] at java.lang.J9VMInternals.verify(J9VMInternals.java:68) [java2wsdl] at java.lang.J9VMInternals.initialize(J9VMInternals.java:129) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getDiscoveredServiceProviders(ServiceProviderManager.java:378) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getAllServiceProviders(ServiceProviderManager.java:214) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.initPluggableBindings(Emitter.java:2704) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.<init>(Emitter.java:389) [java2wsdl] at com.ibm.ws.webservices.tools.ant.Java2WSDL.execute(Java2WSDL.java:122) [java2wsdl] at org.apache.tools.ant.UnknownElement.execute(UnknownElement.java:275) [java2wsdl] at org.apache.tools.ant.Task.perform(Task.java:364) [java2wsdl] at org.apache.tools.ant.Target.execute(Target.java:341) [java2wsdl] at org.apache.tools.ant.Target.performTasks(Target.java:369) [java2wsdl] at org.apache.tools.ant.Project.executeSortedTargets(Project.java:1216) [java2wsdl] at org.apache.tools.ant.Project.executeTarget(Project.java:1185) [java2wsdl] at att.ant.RunAnt.main(RunAnt.java:32)

    Read the article

  • The Tab1.java from API Demo has exception.

    - by Kooper
    I don't know why.All my Tab programs have exception.Even from API Demo. Here is the code: package com.example.android.apis.view; import android.app.TabActivity; import android.os.Bundle; import android.widget.TabHost; import android.widget.TabHost.TabSpec; import android.view.LayoutInflater; import android.view.View; public class Tab1 extends TabActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); TabHost tabHost = getTabHost(); LayoutInflater.from(this).inflate(R.layout.main,tabHost.getTabContentView(), true); tabHost.addTab(tabHost.newTabSpec("tab1") .setIndicator("tab1") .setContent(R.id.view1)); tabHost.addTab(tabHost.newTabSpec("tab2") .setIndicator("tab2") .setContent(R.id.view2)); tabHost.addTab(tabHost.newTabSpec("tab3") .setIndicator("tab3") .setContent(R.id.view3)); } } Here is the log: 06-13 17:24:38.336: WARN/jdwp(262): Debugger is telling the VM to exit with code=1 06-13 17:24:38.336: INFO/dalvikvm(262): GC lifetime allocation: 2511 bytes 06-13 17:24:38.416: DEBUG/Zygote(30): Process 262 exited cleanly (1) 06-13 17:24:38.456: INFO/ActivityManager(54): Process com.example.android.apis.view (pid 262) has died. 06-13 17:24:38.696: INFO/UsageStats(54): Unexpected resume of com.android.launcher while already resumed in com.example.android.apis.view 06-13 17:24:38.736: WARN/InputManagerService(54): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@44dc4b38 06-13 17:24:48.337: DEBUG/AndroidRuntime(269): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:48.346: DEBUG/AndroidRuntime(269): CheckJNI is ON 06-13 17:24:48.856: DEBUG/AndroidRuntime(269): --- registering native functions --- 06-13 17:24:49.596: DEBUG/ddm-heap(269): Got feature list request 06-13 17:24:50.576: DEBUG/AndroidRuntime(269): Shutting down VM 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM shutting VM down 06-13 17:24:50.576: DEBUG/dalvikvm(269): HeapWorker thread shutting down 06-13 17:24:50.586: DEBUG/dalvikvm(269): HeapWorker thread has shut down 06-13 17:24:50.586: DEBUG/jdwp(269): JDWP shutting down net... 06-13 17:24:50.586: INFO/dalvikvm(269): Debugger has detached; object registry had 1 entries 06-13 17:24:50.596: ERROR/AndroidRuntime(269): ERROR: thread attach failed 06-13 17:24:50.606: DEBUG/dalvikvm(269): VM cleaning up 06-13 17:24:50.676: DEBUG/dalvikvm(269): LinearAlloc 0x0 used 628628 of 5242880 (11%) 06-13 17:24:51.476: DEBUG/AndroidRuntime(278): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:51.486: DEBUG/AndroidRuntime(278): CheckJNI is ON 06-13 17:24:51.986: DEBUG/AndroidRuntime(278): --- registering native functions --- 06-13 17:24:52.746: DEBUG/ddm-heap(278): Got feature list request 06-13 17:24:53.716: DEBUG/ActivityManager(54): Uninstalling process com.example.android.apis.view 06-13 17:24:53.726: INFO/ActivityManager(54): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.example.android.apis.view/.Tab1 } 06-13 17:24:53.876: DEBUG/AndroidRuntime(278): Shutting down VM 06-13 17:24:53.886: DEBUG/dalvikvm(278): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:53.916: DEBUG/dalvikvm(278): DestroyJavaVM shutting VM down 06-13 17:24:53.926: DEBUG/dalvikvm(278): HeapWorker thread shutting down 06-13 17:24:53.936: DEBUG/dalvikvm(278): HeapWorker thread has shut down 06-13 17:24:53.936: DEBUG/jdwp(278): JDWP shutting down net... 06-13 17:24:53.936: INFO/dalvikvm(278): Debugger has detached; object registry had 1 entries 06-13 17:24:53.957: DEBUG/dalvikvm(278): VM cleaning up 06-13 17:24:54.026: ERROR/AndroidRuntime(278): ERROR: thread attach failed 06-13 17:24:54.146: DEBUG/dalvikvm(278): LinearAlloc 0x0 used 638596 of 5242880 (12%) 06-13 17:24:54.286: INFO/ActivityManager(54): Start proc com.example.android.apis.view for activity com.example.android.apis.view/.Tab1: pid=285 uid=10054 gids={1015} 06-13 17:24:54.676: DEBUG/ddm-heap(285): Got feature list request 06-13 17:24:55.006: WARN/ActivityThread(285): Application com.example.android.apis.view is waiting for the debugger on port 8100... 06-13 17:24:55.126: INFO/System.out(285): Sending WAIT chunk 06-13 17:24:55.186: INFO/dalvikvm(285): Debugger is active 06-13 17:24:55.378: INFO/System.out(285): Debugger has connected 06-13 17:24:55.386: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.586: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.796: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.996: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.196: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.406: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.606: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.806: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.016: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.216: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.416: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.626: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.836: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.039: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.246: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.451: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.656: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.866: INFO/System.out(285): debugger has settled (1367) 06-13 17:24:59.126: ERROR/gralloc(54): [unregister] handle 0x129980 still locked (state=40000001) 06-13 17:25:03.816: WARN/ActivityManager(54): Launch timeout has expired, giving up wake lock! 06-13 17:25:04.906: WARN/ActivityManager(54): Activity idle timeout for HistoryRecord{44d60e10 com.example.android.apis.view/.Tab1}

    Read the article

  • How to determine errors in java

    - by user225269
    I'm just a java beginner. Do you have any tips there on how to determine errors. I'm trying to connect to mysql derby database. I don't know how to determine the error, there is no red line, but there is a message box that shows up when I try to run the program. All I want to do is to display the first record in the database. All I get is this in the output: E:\Users\users.netbeans\6.8\var\cache\executor-snippets\run.xml:45: package Employees; import java.sql.Statement; import javax.swing.JOptionPane; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.ResultSet; /** * * @author Nrew */ public class Students extends javax.swing.JFrame { Connection con; Statement stmt; ResultSet rs; /** Creates new form Students */ public Students() { initComponents(); DoConnect(); } public void DoConnect(){ try { String host= "jdbc:derby://localhost:1527/YURA"; String uname = "bart"; String pword = "12345"; con = DriverManager.getConnection(host, uname, pword); stmt = con.createStatement( ); String SQL = "SELECT * FROM APP.XROSS"; rs = stmt.executeQuery(SQL); rs.next(); rs.next( ); int ids = rs.getInt("IDNUM"); String idz = Integer.toString(ids); String fname = rs.getString("FNAME"); String lname = rs.getString("LNAME"); String course = rs.getString("COURSE"); String skul = rs.getString("SCHOOL"); String gen = rs.getString("GENDER"); TextIDNUM.setText(idz); TextFNAME.setText(fname); TextLNAME.setText(lname); textCOURSE.setText(course); textSCHOOL.setText(skul); textGENDER.setText(gen); } catch (SQLException err) { JOptionPane.showMessageDialog(Students.this, err.getMessage()); } } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { TextIDNUM = new javax.swing.JTextField(); TextFNAME = new javax.swing.JTextField(); TextLNAME = new javax.swing.JTextField(); textCOURSE = new javax.swing.JTextField(); textSCHOOL = new javax.swing.JTextField(); textGENDER = new javax.swing.JTextField(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(116, 116, 116) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.TRAILING, false) .addComponent(textGENDER, javax.swing.GroupLayout.Alignment.LEADING) .addComponent(textSCHOOL, javax.swing.GroupLayout.Alignment.LEADING) .addComponent(textCOURSE, javax.swing.GroupLayout.Alignment.LEADING) .addComponent(TextLNAME, javax.swing.GroupLayout.Alignment.LEADING) .addComponent(TextFNAME, javax.swing.GroupLayout.Alignment.LEADING) .addComponent(TextIDNUM, javax.swing.GroupLayout.Alignment.LEADING, javax.swing.GroupLayout.DEFAULT_SIZE, 151, Short.MAX_VALUE)) .addContainerGap(243, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(37, 37, 37) .addComponent(TextIDNUM, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addComponent(TextFNAME, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addComponent(TextLNAME, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addComponent(textCOURSE, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(textSCHOOL, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(textGENDER, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(67, Short.MAX_VALUE)) ); pack(); }// </editor-fold> /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { new Students().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JTextField TextFNAME; private javax.swing.JTextField TextIDNUM; private javax.swing.JTextField TextLNAME; private javax.swing.JTextField textCOURSE; private javax.swing.JTextField textGENDER; private javax.swing.JTextField textSCHOOL; // End of variables declaration }

    Read the article

  • Adding an overlay to Google maps with path taken

    - by user341652
    Hi, I am trying to write a class to track a person's location(s), and to draw the path they've taken on a MapView. This feature of the program is for the user to track their speed, distance, path, etc. while running/cycling (or whatever else) using their Android phone. This is my first Android application, and I am not sure how to do the Overlay object for the MapView. I also wanted to see if anyone had opinions on the GPS-Tracking part I have written (if it would work, if there is a better way of doing it, code examples would be helpful). I currently have this for my GPSTrackerService: package org.drexel.itrain.logic; import java.util.Vector; import org.drexel.itrain.Constants; import android.app.Notification; import android.app.NotificationManager; import android.app.Service; import android.content.Context; import android.content.Intent; import android.content.SharedPreferences; import android.location.GpsSatellite; import android.location.GpsStatus; import android.location.Location; import android.location.LocationListener; import android.location.LocationManager; import android.location.GpsStatus.Listener; import android.os.Binder; import android.os.Bundle; import android.os.IBinder; import android.preference.PreferenceManager; public class GPSTrackingService extends Service { private static final int MAX_REASONABLE_SPEED = 60; private static final String TAG = "OGT.TrackingService"; private Context mContext; private LocationManager mLocationManager; private NotificationManager mNotificationManager; private Notification mNotification; private int mSatellites = 0; private int mTrackingState = Constants.GPS_TRACKING_UNKNOWN; private float mCurrentSpeed = 0; private float mTotalDistance = 0; private Location mPreviousLocation; private Vector<Location> mTrackedLocations; private LocationListener mLocationListener = null; private Listener mStatusListener = null; private IBinder binder = null; @Override public void onCreate() { super.onCreate(); this.mContext = getApplicationContext(); this.mLocationManager = (LocationManager) this.mContext.getSystemService( Context.LOCATION_SERVICE ); this.mNotificationManager = (NotificationManager) this.mContext.getSystemService( Context.NOTIFICATION_SERVICE ); this.mTrackedLocations = new Vector<Location>(); this.binder = new Binder(); SharedPreferences sharedPreferences = PreferenceManager.getDefaultSharedPreferences(this.mContext); binder = new Binder(); if(mTrackingState != Constants.GPS_TRACKING_UNKNOWN) { createListeners(); } } @Override public void onDestroy() { destroyListeneres(); } @Override public IBinder onBind(Intent intent) { return binder; } @Override public boolean onUnbind(Intent intent) { return true; } public boolean acceptLocation(Location proposedLocation) { if(!(proposedLocation.hasSpeed() || proposedLocation.hasAccuracy())) { return false; } else if(proposedLocation.getSpeed() >= MAX_REASONABLE_SPEED) { return false; } return true; } public void updateNotification() { //TODO Alert that no GPS sattelites are available (or are available) } public void startTracking() { this.mTrackingState = Constants.GPS_TRACKING_STARTED; this.mTotalDistance = 0; this.mCurrentSpeed = 0; this.mTrackedLocations = new Vector<Location>(); this.mPreviousLocation = null; createListeners(); } public void pauseTracking() { this.mTrackingState = Constants.GPS_TRACKING_PAUSED; this.mPreviousLocation = null; this.mCurrentSpeed = 0; } public void resumeTracking() { if(this.mTrackingState == Constants.GPS_TRACKING_STOPPED){ this.startTracking(); } this.mTrackingState = Constants.GPS_TRACKING_STARTED; } public void stopTracking() { this.mTrackingState = Constants.GPS_TRACKING_STOPPED; destroyListeneres(); } private void createListeners() { /** * LocationListener receives locations from */ this.mLocationListener = new LocationListener() { @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onLocationChanged(Location location) { if(mTrackingState == Constants.GPS_TRACKING_STARTED && acceptLocation(location)) { if(mPreviousLocation != null) { //Add the distance between the new location and the previous location mTotalDistance += mPreviousLocation.distanceTo(location); } if(location.hasSpeed()) { mCurrentSpeed = location.getSpeed(); } else { mCurrentSpeed = -1; //-1 means speed N/A } mPreviousLocation = location; mTrackedLocations.add(location); } } }; /** * Receives updates reguarding the GPS Status */ this.mStatusListener = new GpsStatus.Listener() { @Override public synchronized void onGpsStatusChanged(int event) { switch( event ) { case GpsStatus.GPS_EVENT_SATELLITE_STATUS: { GpsStatus status = mLocationManager.getGpsStatus( null ); mSatellites = 0; Iterable<GpsSatellite> list = status.getSatellites(); for( GpsSatellite satellite : list ) { if( satellite.usedInFix() ) { mSatellites++; } } updateNotification(); break; } default: break; } } }; } /** * Destroys the LocationListenere and the GPSStatusListener */ private void destroyListeneres() { this.mLocationListener = null; this.mStatusListener = null; } /** * Gets the total distance traveled by the * * @return the total distance traveled (in meters) */ public float getDistance() { return mTotalDistance; } /** * Gets the current speed of the last good location * * @return the current speed (in meters/second) */ public float getSpeed() { return mCurrentSpeed; } } Any assistance would be much appreciated. This is my group's first Android app, and we are a little pressed for time at the moment. The project is for a class, and is available from SourceForge (currently called iTrain, soon to be renamed). Thanks in Advance, Steve

    Read the article

  • How to match ColdFusion encryption with Java 1.4.2?

    - by JohnTheBarber
    * sweet - thanks to Edward Smith for the CF Technote that indicated the key from ColdFusion was Base64 encoded. See generateKey() for the 'fix' My task is to use Java 1.4.2 to match the results a given ColdFusion code sample for encryption. Known/given values: A 24-byte key A 16-byte salt (IVorSalt) Encoding is Hex Encryption algorithm is AES/CBC/PKCS5Padding A sample clear-text value The encrypted value of the sample clear-text after going through the ColdFusion code Assumptions: Number of iterations not specified in the ColdFusion code so I assume only one iteration 24-byte key so I assume 192-bit encryption Given/working ColdFusion encryption code sample: <cfset ThisSalt = "16byte-salt-here"> <cfset ThisAlgorithm = "AES/CBC/PKCS5Padding"> <cfset ThisKey = "a-24byte-key-string-here"> <cfset thisAdjustedNow = now()> <cfset ThisDateTimeVar = DateFormat( thisAdjustedNow , "yyyymmdd" )> <cfset ThisDateTimeVar = ThisDateTimeVar & TimeFormat( thisAdjustedNow , "HHmmss" )> <cfset ThisTAID = ThisDateTimeVar & "|" & someOtherData> <cfset ThisTAIDEnc = Encrypt( ThisTAID , ThisKey , ThisAlgorithm , "Hex" , ThisSalt)> My Java 1.4.2 encryption/decryption code swag: package so.example; import java.security.*; import javax.crypto.Cipher; import javax.crypto.spec.IvParameterSpec; import javax.crypto.spec.SecretKeySpec; import org.apache.commons.codec.binary.*; public class SO_AES192 { private static final String _AES = "AES"; private static final String _AES_CBC_PKCS5Padding = "AES/CBC/PKCS5Padding"; private static final String KEY_VALUE = "a-24byte-key-string-here"; private static final String SALT_VALUE = "16byte-salt-here"; private static final int ITERATIONS = 1; private static IvParameterSpec ivParameterSpec; public static String encryptHex(String value) throws Exception { Key key = generateKey(); Cipher c = Cipher.getInstance(_AES_CBC_PKCS5Padding); ivParameterSpec = new IvParameterSpec(SALT_VALUE.getBytes()); c.init(Cipher.ENCRYPT_MODE, key, ivParameterSpec); String valueToEncrypt = null; String eValue = value; for (int i = 0; i < ITERATIONS; i++) { // valueToEncrypt = SALT_VALUE + eValue; // pre-pend salt - Length > sample length valueToEncrypt = eValue; // don't pre-pend salt Length = sample length byte[] encValue = c.doFinal(valueToEncrypt.getBytes()); eValue = Hex.encodeHexString(encValue); } return eValue; } public static String decryptHex(String value) throws Exception { Key key = generateKey(); Cipher c = Cipher.getInstance(_AES_CBC_PKCS5Padding); ivParameterSpec = new IvParameterSpec(SALT_VALUE.getBytes()); c.init(Cipher.DECRYPT_MODE, key, ivParameterSpec); String dValue = null; char[] valueToDecrypt = value.toCharArray(); for (int i = 0; i < ITERATIONS; i++) { byte[] decordedValue = Hex.decodeHex(valueToDecrypt); byte[] decValue = c.doFinal(decordedValue); // dValue = new String(decValue).substring(SALT_VALUE.length()); // when salt is pre-pended dValue = new String(decValue); // when salt is not pre-pended valueToDecrypt = dValue.toCharArray(); } return dValue; } private static Key generateKey() throws Exception { // Key key = new SecretKeySpec(KEY_VALUE.getBytes(), _AES); // this was wrong Key key = new SecretKeySpec(new BASE64Decoder().decodeBuffer(keyValueString), _AES); // had to un-Base64 the 'known' 24-byte key. return key; } } I cannot create a matching encrypted value nor decrypt a given encrypted value. My guess is it's something to do with how I'm handling the initial vector/salt. I'm not very crypto-savvy but I'm thinking I should be able to take the sample clear-text and produce the same encrypted value in Java as ColdFusion produced. I am able to encrypt/decrypt my own data with my Java code (so I'm consistent) but I cannot match nor decrypt the ColdFusion sample encrypted value. I have access to a local webservice that can test the encrypted output. The given ColdFusion output sample passes/decrypts fine (of course). If I try to decrypt the same sample with my Java code (using the actual key and salt) I get a "Given final block not properly padded" error. I get the same net result when I pass my attempt at encryption (using the actual key and salt) to the test webservice. Any Ideas?

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Complex sound handling (I.E. pitch change while looping)

    - by Matthew
    Hi everyone I've been meaning to learn Java for a while now (I usually keep myself in languages like C and Lua) but buying an android phone seems like an excellent time to start. now after going through the lovely set of tutorials and a while spent buried in source code I'm beginning to get the feel for it so what's my next step? well to dive in with a fully featured application with graphics, sound, sensor use, touch response and a full menu. hmm now there's a slight conundrum since i can continue to use cryptic references to my project or risk telling you what the application is but at the same time its going to make me look like a raving sci-fi nerd so bare with me for the brief... A semi-working sonic screwdriver (oh yes!) my grand idea was to make an animated screwdriver where sliding the controls up and down modulate the frequency and that frequency dictates the sensor data it returns. now I have a semi-working sound system but its pretty poor for what its designed to represent and I just wouldn't be happy producing a sub-par end product whether its my first or not. the problem : sound must begin looping when the user presses down on the control the sound must stop when the user releases the control when moving the control up or down the sound effect must change pitch accordingly if the user doesn't remove there finger before backing out of the application it must plate the casing of there device with gold (Easter egg ;P) now I'm aware of how monolithic the first 3 look and that's why I would really appreciate any help I can get. sorry for how bad this code looks but my general plan is to create the functional components then refine the code later, no good painting the walls if the roofs not finished. here's my user input, he set slide stuff is used in the graphics for the control @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); //this is from my latest attempt at loop pitch change, look for this in my soundPool class mSonicAudio.startLoopedSound(); } } if(event.getAction() == MotionEvent.ACTION_MOVE) { if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); setSlideY ( (int) event.getY() ); } } if(event.getAction() == MotionEvent.ACTION_UP) { mSonicAudio.stopLoopedSound(); SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); } return true; } and here's where those methods end up in my sound pool class its horribly messy but that's because I've been trying a ton of variants to get this to work, you will also notice that I begin to hard code the index, again I was trying to get the methods to work before making them work well. package com.mattster.sonicscrewdriver; import java.util.HashMap; import android.content.Context; import android.media.AudioManager; import android.media.SoundPool; public class SoundManager { private float mPowerLvl = 1f; private SoundPool mSoundPool; private HashMap mSoundPoolMap; private AudioManager mAudioManager; private Context mContext; private int streamVolume; private int LoopState; private long mLastTime; public SoundManager() { } public void initSounds(Context theContext) { mContext = theContext; mSoundPool = new SoundPool(2, AudioManager.STREAM_MUSIC, 0); mSoundPoolMap = new HashMap<Integer, Integer>(); mAudioManager = (AudioManager)mContext.getSystemService(Context.AUDIO_SERVICE); streamVolume = mAudioManager.getStreamVolume(AudioManager.STREAM_MUSIC); } public void addSound(int index,int SoundID) { mSoundPoolMap.put(1, mSoundPool.load(mContext, SoundID, 1)); } public void playUpdate(int index) { if( LoopState == 1) { long now = System.currentTimeMillis(); if (now > mLastTime) { mSoundPool.play(mSoundPoolMap.get(1), streamVolume, streamVolume, 1, 0, mPowerLvl); mLastTime = System.currentTimeMillis() + 250; } } } public void stopLoopedSound() { LoopState = 0; mSoundPool.setVolume(mSoundPoolMap.get(1), 0, 0); mSoundPool.stop(mSoundPoolMap.get(1)); } public void startLoopedSound() { LoopState = 1; } public void setPower(int index, float mPower) { mPowerLvl = mPower; mSoundPool.setRate(mSoundPoolMap.get(1), mPowerLvl); } } ah ha! I almost forgot, that looks pretty ineffective but I omitted my thread which actuality updates it, nothing fancy it just calls : mSonicAudio.playUpdate(1); thanks in advance, Matthew

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Set Icon in Button LWUIT Java ME

    - by Muhamad Burhanudin
    Please help me, to set icon button : /* * To change this template, choose Tools | Templates * and open the template in the editor. */ package tajwed; import javax.microedition.midlet.*; import com.sun.lwuit.*; import com.sun.lwuit.animations.*; import com.sun.lwuit.events.*; import com.sun.lwuit.layouts.BoxLayout; import com.sun.lwuit.plaf.*; import java.io.IOException; import java.util.Hashtable; /** * @author Muhamad BUrhanudin */ public class tajwedMidlet extends MIDlet implements ActionListener{ Form mHomeForm; Form mAwayForm; Form mMenuTajwid; Command mExitCommand; Button btMenu; Button btNunSukun, btMimSukun, btNunTasjid; Button btLamtarif, btIdgham, btMaad, btRaa; Button btHelp; Button btExit; Command mBackCommand; public void startApp() { Display.init(this); installTheme(); createUI(); mHomeForm.show(); } public void pauseApp() { } public void destroyApp(boolean unconditional) { } public void actionPerformed(ActionEvent ae) { mAwayForm.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionOutAnimator( Transition3D.createCube(400, true)); mAwayForm.setTransitionOutAnimator( Transition3D.createCube(400, true)); if ((ae.getSource()==btMenu)|| (ae.getSource()==btHelp)) { //mAwayForm.show(); if(ae.getSource()== btMenu) { mMenuTajwid.show(); } } else if (ae.getSource() == mBackCommand) { mHomeForm.show(); } else if ((ae.getCommand() == mExitCommand) || (ae.getSource()== btExit)) notifyDestroyed(); } private void installTheme() { UIManager uim = UIManager.getInstance(); Hashtable ht = new Hashtable(); ht.put("sel#" + Style.BG_COLOR, "ffffff"); ht.put(Style.BG_COLOR, "d5fff9"); ht.put(Style.FG_COLOR, "000000"); uim.setThemeProps(ht); } private void createUI() { // Set up screen for transitions. mAwayForm = new Form("Away"); mAwayForm.addComponent(new Label("Choose Back to return to the home screen.")); mMenuTajwid = new Form("MENU DASAR TAJWID"); // mMenuTajwid mMenuTajwid.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btNunSukun = new Button("Hukum Nun Sukun & Tanwin"); btNunSukun.addActionListener(this); mMenuTajwid.addComponent(btNunSukun); btMimSukun = new Button("Hukum Mim Sukun"); btMimSukun.addActionListener(this); mMenuTajwid.addComponent(btMimSukun); btNunTasjid = new Button("Hukum Nun Tasydid & Min Tasydid"); btNunTasjid.addActionListener(this); mMenuTajwid.addComponent(btNunTasjid); btLamtarif = new Button("Hukum Laam Ta'rief"); btLamtarif.addActionListener(this); mMenuTajwid.addComponent(btLamtarif); btIdgham = new Button("Idgham"); btIdgham.addActionListener(this); mMenuTajwid.addComponent(btIdgham); btMaad = new Button("Maad"); btMaad.addActionListener(this); mMenuTajwid.addComponent(btMaad); btRaa = new Button("Raa'"); btRaa.addActionListener(this); mMenuTajwid.addComponent(btRaa); mBackCommand = new Command("Back"); mMenuTajwid.addCommand(mBackCommand); mMenuTajwid.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. // Set up main screen. mHomeForm = new Form("Java Mobile Learning"); mHomeForm.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btMenu = new Button("TAJWID LEARNING"); btMenu.addActionListener(this); mHomeForm.addComponent(btMenu); try { btHelp = new Button("HELP",Image.createImage("/help.ico")); btHelp.addActionListener(this); mHomeForm.addComponent(btHelp); } catch(IOException e) { } btExit = new Button("EXIT"); btExit.addActionListener(this); mHomeForm.addComponent(btExit); mExitCommand = new Command("Keluar"); mHomeForm.addCommand(mExitCommand); mHomeForm.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • context.getContextResolved appliaction stopped - begginner in java

    - by Szymad
    I have a problem with my app. I'm trying to execute query, but app stops every time. This error occurs while trying to execute query. I'm learing from Android Pro 3 book, but code presented in this book is deprecated. package com.example.contactsabuout; import android.net.Uri; import android.os.Bundle; import android.provider.Contacts; import android.provider.ContactsContract; import android.app.Activity; import android.database.Cursor; import android.util.Log; import android.content.Context; import android.view.Menu; import android.view.View; import android.widget.TextView; public class MainActivity extends Activity { private static Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); MainActivity.context = getApplicationContext(); Log.v("INFO", "Completed: onCreate."); } public static Context getAppContext() { return MainActivity.context; } public void doQuery(View view) { Uri peopleBaseUri = ContactsContract.Contacts.CONTENT_URI; Log.v("II","Button clicked."); Log.v("II", "Uri for ContactsContract.Contacts: " + peopleBaseUri); Context context = getAppContext(); Log.v("II", "Got context: " + context); Cursor cur; Log.v("II", "Created cursor: cur"); cur = context.getContentResolver().query(peopleBaseUri, null, null, null, null); } @Override public boolean onCreateOptionsMenu(Menu menu) { getMenuInflater().inflate(R.menu.activity_main, menu); return true; } } FROM LogCat 10-28 17:45:02.513: V/INFO(4677): Completed: onCreate. 10-28 17:45:02.613: D/libEGL(4677): loaded /system/lib/egl/libGLES_android.so 10-28 17:45:02.653: D/libEGL(4677): loaded /system/lib/egl/libEGL_adreno200.so 10-28 17:45:02.723: D/libEGL(4677): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 10-28 17:45:02.723: D/libEGL(4677): loaded /system/lib/egl/libGLESv2_adreno200.so 10-28 17:45:03.014: I/Adreno200-EGLSUB(4677): <ConfigWindowMatch:2078>: Format RGBA_8888. 10-28 17:45:03.054: D/OpenGLRenderer(4677): Enabling debug mode 0 10-28 17:45:03.254: D/OpenGLRenderer(4677): has fontRender patch 10-28 17:45:03.274: D/OpenGLRenderer(4677): has fontRender patch 10-28 17:45:12.873: V/II(4677): Button clicked. 10-28 17:45:12.873: V/II(4677): Uri for ContactsContract.Contacts: content://com.android.contacts/contacts, rest will be null 10-28 17:45:12.873: V/II(4677): Got context: android.app.Application@40d83d90 10-28 17:45:12.873: V/II(4677): Created cursor: cur 10-28 17:45:12.933: D/AndroidRuntime(4677): Shutting down VM 10-28 17:45:12.933: W/dalvikvm(4677): threadid=1: thread exiting with uncaught exception (group=0x40aaf228) 10-28 17:45:12.953: E/AndroidRuntime(4677): FATAL EXCEPTION: main 10-28 17:45:12.953: E/AndroidRuntime(4677): java.lang.IllegalStateException: Could not execute method of the activity 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$1.onClick(View.java:3071) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View.performClick(View.java:3538) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$PerformClick.run(View.java:14330) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Handler.handleCallback(Handler.java:608) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Handler.dispatchMessage(Handler.java:92) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Looper.loop(Looper.java:156) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.app.ActivityThread.main(ActivityThread.java:4977) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:784) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:551) 10-28 17:45:12.953: E/AndroidRuntime(4677): at dalvik.system.NativeStart.main(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): Caused by: java.lang.reflect.InvocationTargetException 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$1.onClick(View.java:3066) 10-28 17:45:12.953: E/AndroidRuntime(4677): ... 11 more 10-28 17:45:12.953: E/AndroidRuntime(4677): Caused by: java.lang.SecurityException: Permission Denial: reading com.android.providers.contacts.HtcContactsProvider2 uri content://com.android.contacts/contacts from pid=4677, uid=10155 requires android.permission.READ_CONTACTS 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Parcel.readException(Parcel.java:1332) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.database.DatabaseUtils.readExceptionFromParcel(DatabaseUtils.java:182) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.database.DatabaseUtils.readExceptionFromParcel(DatabaseUtils.java:136) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.content.ContentProviderProxy.query(ContentProviderNative.java:406) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.content.ContentResolver.query(ContentResolver.java:315) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.example.contactsabuout.MainActivity.doQuery(MainActivity.java:47) 10-28 17:45:12.953: E/AndroidRuntime(4677): ... 14 more I'm trying to learn android.

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

< Previous Page | 348 349 350 351 352 353 354 355 356 357 358 359  | Next Page >