Search Results

Search found 21098 results on 844 pages for 'model import'.

Page 353/844 | < Previous Page | 349 350 351 352 353 354 355 356 357 358 359 360  | Next Page >

  • java timer on current instance

    - by hspim
    import java.util.Scanner; import java.util.Timer; import java.util.TimerTask; public class Boggle { Board board; Player player; Timer timer; boolean active; static Scanner in = new Scanner(System.in); public Boggle() { board = new Board(4); timer = new Timer(); } public void newGame() { System.out.println("Please enter your name: "); String line = in.nextLine(); player = new Player(line); active = true; board.shuffle(); System.out.println(board); timer.schedule(new timesUP(), 20000); while(active) { String temp = in.nextLine(); player.addGuess(temp); } } public void endGame() { active = false; int score = Scoring.calculate(player, board); System.out.println(score); } class timesUP extends TimerTask { public void run() { endGame(); } } public static void main(String[] args) { Boggle boggle = new Boggle(); boggle.newGame(); } } I have the above class which should perform a loop for a given length of time and afterwards invoke an instance method. Essentially I need the loop in newGame() to run for a minute or so before endGame() is invoked on the current instance. However, using the Timer class I'm not sure how I would invoke the method I need on the current instance since I can't pass any parameters to the timertasks run method? Is there an easy way to do this or am I going about this the wrong way? (note: this is a console project only, no GUI) ========== code edited I've changed the code to the above following the recommendations, and it works almost as I expect however the thread still doesnt seem to end properly. I was the while loop would die and control would eventually come back to the main method. Any ideas?

    Read the article

  • Importing a spreadsheet into an asp.net program and listing the worksheets

    - by Bob Avallone
    I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

    Read the article

  • Why is django admin not accepting Nullable foreign keys?

    - by p.g.l.hall
    Here is a simplified version of one of my models: class ImportRule(models.Model): feed = models.ForeignKey(Feed) name = models.CharField(max_length=255) feed_provider_category = models.ForeignKey(FeedProviderCategory, null=True) target_subcategories = models.ManyToManyField(Subcategory) This class manages a rule for importing a list of items from a feed into the database. The admin system won't let me add an ImportRule without selecting a feed_provider_category despite it being declared in the model as nullable. The database (SQLite at the moment) even checks out ok: >>> .schema ... CREATE TABLE "someapp_importrule" ( "id" integer NOT NULL PRIMARY KEY, "feed_id" integer NOT NULL REFERENCES "someapp_feed" ("id"), "name" varchar(255) NOT NULL, "feed_provider_category_id" integer REFERENCES "someapp_feedprovidercategory" ("id"), ); ... I can create the object in the python shell easily enough: f = Feed.objects.get(pk=1) i = ImportRule(name='test', feed=f) i.save() ...but the admin system won't let me edit it, of course. How can I get the admin to let me edit/create objects without specifying that foreign key?

    Read the article

  • create_or_update in ModelForm

    - by ykaganovich
    I want to have a ModelForm that can create_or_update a model instance based on the request parameters. I've been trying to cobble something together, but am realizing that my python fu is not strong enough, and the ModelForm implementation code is a quite hairy. I found this create_or_update snipplet for working with a Model, but I think it would be incredibly useful if it were integrated with a ModelForm. I would expect it to behave similarly to ModelForm.save(): class BetterModelForm(forms.ModelForm): def init(self, *args, **kwargs) def create_or_update(self): #magic return (instance, created, updated) Conversely I'd also be interested in hearing compelling reasons why this is not a good idea.

    Read the article

  • MacRuby + Interface Builder: How to display, then close, then display a window again

    - by Derick Bailey
    I'm a complete n00b with MacRuby and Cocoa, though I've got more than a year of Ruby experience, so keep that in mind when answering - I need lots of details and explanation. :) I've set up a simple project that has 2 windows in it, both of which are built with Interface Builder. The first window is a simple list of accounts using a table view. It has a "+" button below the table. When I click the + button, I want to show an "Add New Account" window. I also have an AccountsController < NSWindowController and a AddNewAccountController class, set up as the delegates for these windows, with the appropriate button click methods wired up, and outlets to reference the needed windows. When I click the "+" button in the Accounts window, I have this code fire: @add_account.center @add_account.display @add_account.makeKeyAndOrderFront(nil) @add_account.orderFrontRegardless this works great the first time I click the + button. Everything shows up, I'm able to enter my data and have it bind to my model. however, when I close the add new account form, things start going bad. if I set the add new account window to release on close, then the second time I click the + button, the window will still pop up but it's frozen. i can't click any buttons, enter any data, or even close the form. i assume this is because the form's code has been released, so there is no message loop processing the form... but i'm not entirely sure about this. if i set the add new account window to not release on close, then the second time i click the + button, the window shows up fine and it is usable - but it still has all the data that i had previously entered... it's still bound to my previous Account class instance. what am I doing wrong? what's the correct way to create a new instance of the Add New Account form, create a new Account model, bind that model to the form and show the form, when I click the + button on the Accounts form? ... this is all being done on OSX 10.6.6, 64bit, with XCode 3.2.4

    Read the article

  • one variable and multiple controllers..

    - by Simon
    I'm working on a web application, using the CAKEPHP framework. Herefor i need to request one variable on multiple pages (all pages have different controllers). it is oubvious that i get a error on several pages, since the variable isn't declared in all the different controllers. Is there a workaround for this? i've already tried the app:: import to import a controller in another controller, but this doens't seem to work (still get a undefined variable error). Thnx for your cooperation! Regards, Simon

    Read the article

  • UML tool required for C#

    - by Peter Morris
    I need some help - here are my requirements. 1: I should be able to modify the UML model without affecting the code, and then later apply the changes. This is because I need to print the changes, get them confirmed, and then develop them. 2: I should be able to reuse parts of the model. For example I would create one project which outputs A.dll assembly, and then another UML project would use the classes in the first to crate B.dll 3: Project stored as text so I can see changes in version control history. 4: Together is too expensive :-)

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • How to validate a ComboBox programatically?

    - by PhOeNiX
    How can i validate a ComboBox for null entry? My combobox is in a model as i am generating it dynamically. Now what i want is that when the the columns are generated dynamically, the border of combobox should be red as no value is selected and once the value is selected the border shud become normal. The following is my combobox in model : DataGridTemplateColumn dataGridComboBoxTemplateColumnObj = new DataGridTemplateColumn(); dataGridComboBoxTemplateColumnObj.Header = column.Header; FrameworkElementFactory comboBoxFactory = new FrameworkElementFactory(typeof(ComboBox)); Binding bindingItemSourceObj = new Binding(column.ItemsSourcePropertyName); comboBoxFactory.SetValue(ComboBox.HorizontalAlignmentProperty, HorizontalAlignment.Stretch); comboBoxFactory.SetValue(ComboBox.ItemsSourceProperty, bindingItemSourceObj); comboBoxFactory.SetValue(ComboBox.SelectedValuePathProperty, column.ValuePropertyName); dataGridComboBoxTemplateColumnObj.CellTemplate = new DataTemplate(); dataGridComboBoxTemplateColumnObj.CellTemplate.VisualTree = comboBoxFactory;

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • for a single-table inheritance in rails, how do I know the 'type' when creating a record?

    - by Angela
    I have several models which are very similar: Contact_Emails, Contact_Letters, Contact_Calls -- and I think life could be easier making them into a Single Table Inheritance called Contact_Event. However, the way I have it set up now is when something is created for a Contact_Email, I have a dedicated controller that I call and know that I am passing the arguments that are approrpriate. For example, new_contact_email(contact, email). I then have: Emails.find(email.contact_id), etcera, all very specific to that Model. I'm not sure how I extract the class/models to use. For example, I currently have the following because I have separate controllers for each model: def do_event(contact, call_or_email_or_letter) model_name = call_or_email_or_letter.class.name.tableize.singularize link_to( "#{model_name.camelize}", send("new_contact_#{model_name}_path", :contact => contact, :status => 'done', :"#{model_name}" => call_or_email_or_letter ) ) end What I really want is to: link_to("#model_name.camelize}", send("new_contact_event_path(contact,call_or_email_or_letter)"

    Read the article

  • Why is the destructor called when the CPython garbage collector is disabled?

    - by Frederik
    I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

    Read the article

  • declarative authorization and has_and_belongs_to_many

    - by Michael Balsiger
    Hi, I have a little problem with declarative-authorization. I have a User and Role Model with a has_and_belongs_to_many association. I've created a Role named :moderator in my authorization_rules.rb Is it possible that a User with the Role Moderator only gets the Users that have the Moderator Role assigned to it?? -- User.with_permissions_to(:index) I thought it would be possible like that: role :moderator do has_permission_on :users, :to => :index do if_attribute :roles => contains { ????? } end end I also created a named_scope in my User Model because I thought it would help... class User has_and_belongs_to_many :roles named_scope :by_role, lambda { |role| { :include => :roles, :conditions => {"roles.name" => role} } } end Does anyone knows if it's possible to do this with declarative_authorization? Thanks for your help!

    Read the article

  • Hierarchical Data in MySQL is fast to retrieve?

    - by ajsie
    i've got a list of all countries - states - cities (- subcities/villages etc) in a XML file and to retrieve for example a state's all cities it's really quick with XML (using xml parser). i wonder, if i put all this information in mysql, is retrieving a state's all cities as fast as with XML? cause XML is designed to store hierarchical data while relational databases like mysql are not. the list contains like 500 000 entities. so i wonder if its as fast as XML using either of: Adjacency list model Nested Set model And which one should i use? Cause (theoretically) there could be unlimited levels under a state. And which is fastest for this huge dataset? Thanks!

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Binding command to button in silverlight 4 using mvvm

    - by Archie
    Hello, I have a user control called HomePage.xaml. I'm creating a model instance (using MVVM pattern) in the code behind file in the constructor of page as MainViewModel model = new MainViewModel(); I have a button in HomePage.xaml which I want to bind to the command inside MainViewModel called GetData() and want to populate the data in datagrid. MainViewModel has an ObservableCollection which I would use to bind the data in datagrid. Populating the data in datagrid without binding command works fine. I'm binding the button as: <StackPanel x:Name="stkPanelInput" Orientation="Horizontal" VerticalAlignment="Center" HorizontalAlignment="Center"> <Button x:Name="buttonGetData" Width="70" Content="GetData" Command="{Binding GetData}" Click="buttonGetData_Click"/> </StackPanel> How shall I bind the command using MVVM? Thanks.

    Read the article

  • How to Cache image when src is some action which returns image?

    - by Bipul
    There are lots of questions about how to force the browser to cache or not to cache any image. But, I am facing slightly different situation. In several places of my web page, I am using following code for the images. <img title="<%= Html.Encode(Model.title)%>" src="<%= Url.Action(MVC.FrontEnd.Actions.RetrieveImage(Model.SystemId))%>"/> So, in the generated HTML it is like <img title="blahblah" src="http://xyz.com/FrontEnd/Actions/RetrieveImage?imageId=X"> Where X is some integer. I have seen that though the browser (IE or Mozilla) caches images by default, it is not caching images generated by above method. Is there any way I can tell browser to cache images of above type? Thanks in advance.

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • SQLAlchemy automatically converts str to unicode on commit

    - by Victor Stanciu
    Hello, When inserting an object into a database with SQLAlchemy, all it's properties that correspond to String() columns are automatically transformed from <type 'str'> to <type 'unicode'>. Is there a way to prevent this behavior? Here is the code: from sqlalchemy import create_engine, Table, Column, Integer, String, MetaData from sqlalchemy.orm import mapper, sessionmaker engine = create_engine('sqlite:///:memory:', echo=False) metadata = MetaData() table = Table('projects', metadata, Column('id', Integer, primary_key=True), Column('name', String(50)) ) class Project(object): def __init__(self, name): self.name = name mapper(Project, table) metadata.create_all(engine) session = sessionmaker(bind=engine)() project = Project("Lorem ipsum") print(type(project.name)) session.add(project) session.commit() print(type(project.name)) And here is the output: <type 'str'> <type 'unicode'> I know I should probably just work with unicode, but this would involve digging through some third-party code and I don't have the Python skills for that yet :)

    Read the article

  • keyDown works but i get beeps

    - by Oscar
    I just got my keydown method to work. But i get system beep everytime i press key. i have no idea whats wrong. Googled for hours and all people say is that if you have your keyDown method you should also implement the acceptsFirstResponder. did that to and it still doesn't work. #import <Cocoa/Cocoa.h> #import "PaddleView.h" #import "BallView.h" @interface GameController : NSView { PaddleView *leftPaddle; PaddleView *rightPaddle; BallView * ball; CGPoint ballVelocity; int gameState; int player1Score; int player2Score; } @property (retain) IBOutlet PaddleView *leftPaddle; @property (retain) IBOutlet PaddleView *rightPaddle; @property (retain) IBOutlet BallView *ball; - (void)reset:(BOOL)newGame; @end #import "GameController.h" #define GameStateRunning 1 #define GameStatePause 2 #define BallSpeedX 0.2 #define BallSpeedY 0.3 #define CompMoveSpeed 15 #define ScoreToWin 5 @implementation GameController @synthesize leftPaddle, rightPaddle, ball; - (id)initWithCoder:(NSCoder *)aDecoder { self = [super initWithCoder:aDecoder]; if(self) { gameState = GameStatePause; ballVelocity = CGPointMake(BallSpeedX, BallSpeedY); [NSTimer scheduledTimerWithTimeInterval:0.001 target:self selector:@selector(gameLoop) userInfo:nil repeats:YES]; } return self; } - (void)gameLoop { if(gameState == GameStateRunning) { [ball setFrameOrigin:CGPointMake(ball.frame.origin.x + ballVelocity.x, ball.frame.origin.y + ballVelocity.y)]; if(ball.frame.origin.x + 15 > self.frame.size.width || ball.frame.origin.x < 0) { ballVelocity.x =- ballVelocity.x; } if(ball.frame.origin.y + 35 > self.frame.size.height || ball.frame.origin.y < 0) { ballVelocity.y =- ballVelocity.y; } } if(CGRectIntersectsRect(ball.frame, leftPaddle.frame)) { if(ball.frame.origin.x > leftPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(CGRectIntersectsRect(ball.frame, rightPaddle.frame)) { if(ball.frame.origin.x +15 > rightPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(ball.frame.origin.x <= self.frame.size.width / 2) { if(ball.frame.origin.y < leftPaddle.frame.origin.y + 75 && leftPaddle.frame.origin.y > 0) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y - CompMoveSpeed)]; } if(ball.frame.origin.y > leftPaddle.frame.origin.y +75 && leftPaddle.frame.origin.y < 700 - leftPaddle.frame.size.height ) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y + CompMoveSpeed)]; } } if(ball.frame.origin.x <= 0) { player2Score++; [self reset:(player2Score >= ScoreToWin)]; } if(ball.frame.origin.x + 15 > self.frame.size.width) { player1Score++; [self reset:(player1Score >= ScoreToWin)]; } } - (void)reset:(BOOL)newGame { gameState = GameStatePause; [ball setFrameOrigin:CGPointMake((self.frame.size.width + 7.5) / 2, (self.frame.size.height + 7.5)/2)]; if(newGame) { if(player1Score > player2Score) { NSLog(@"Player 1 Wins!"); } else { NSLog(@"Player 2 Wins!"); } player1Score = 0; player2Score = 0; } else { NSLog(@"Press key to serve"); } NSLog(@"Player 1: %d",player1Score); NSLog(@"Player 2: %d",player2Score); } - (void)moveRightPaddleUp { if(rightPaddle.frame.origin.y < 700 - rightPaddle.frame.size.height) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y + 20)]; } } - (void)moveRightPaddleDown { if(rightPaddle.frame.origin.y > 0) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y - 20)]; } } - (BOOL)acceptsFirstResponder { return YES; } - (void)keyDown:(NSEvent *)theEvent { if ([theEvent modifierFlags] & NSNumericPadKeyMask) { NSString *theArrow = [theEvent charactersIgnoringModifiers]; unichar keyChar = 0; if ( [theArrow length] == 0 ) { return; // reject dead keys } if ( [theArrow length] == 1 ) { keyChar = [theArrow characterAtIndex:0]; if ( keyChar == NSLeftArrowFunctionKey ) { gameState = GameStateRunning; } if ( keyChar == NSRightArrowFunctionKey ) { } if ( keyChar == NSUpArrowFunctionKey ) { [self moveRightPaddleUp]; } if ( keyChar == NSDownArrowFunctionKey ) { [self moveRightPaddleDown]; } [super keyDown:theEvent]; } } else { [super keyDown:theEvent]; } } - (void)drawRect:(NSRect)dirtyRect { } - (void)dealloc { [ball release]; [rightPaddle release]; [leftPaddle release]; [super dealloc]; } @end

    Read the article

  • Hierarchical Data in MySQL is as fast as XML to retrieve?

    - by ajsie
    i've got a list of all countries - states - cities (- subcities/villages etc) in a XML file and to retrieve for example a state's all cities it's really quick with XML (using xml parser). i wonder, if i put all this information in mysql, is retrieving a state's all cities as fast as with XML? cause XML is designed to store hierarchical data while relational databases like mysql are not. the list contains like 500 000 entities. so i wonder if its as fast as XML using either of: Adjacency list model Nested Set model And which one should i use? Cause (theoretically) there could be unlimited levels under a state (i heard that adjacency isn't good for unlimited child-levels). And which is fastest for this huge dataset? Thanks!

    Read the article

  • What is the best practice for mvc2 confirm password field?

    - by Andrey
    I have asked a similar question recently but getting no answers i am taking a step back with a more broad approach. I am looking to create a confirm password field using asp.net MVC2 that works on the client. All my other client validation is done with MicrosoftMvcValidation.js by just adding the Html.EnableClientValidation(); call. Some of my considerations. Should the confirm password be part of the model object? Using that approach i have created server side validation by creating my own model binder. Are there any projects out there that have done this?

    Read the article

  • How to accept localized date format (e.g dd/mm/yy) in a DateField on an admin form ?

    - by tomjerry
    Is it possible to customize a django application to have accept localized date format (e.g dd/mm/yy) in a DateField on an admin form ? I have a model class : class MyModel(models.Model): date = models.DateField("Date") And associated admin class class MyModelAdmin(admin.ModelAdmin): pass On django administration interface, I would like to be able to input a date in following format : dd/mm/yyyy. However, the date field in the admin form expects yyyy-mm-dd. How can I customize things ? Nota bene : I have already specified my custom language code (fr-FR) in settings.py, but it seems to have no effect on this date input matter. Thanks in advance for your answer

    Read the article

  • java.util.zip - ZipInputStream v.s. ZipFile

    - by lucho
    Hello, community! I have some general questions regarding the java.util.zip library. What we basically do is an import and an export of many small components. Previously these components were imported and exported using a single big file, e.g.: <component-type-a id="1"/> <component-type-a id="2"/> <component-type-a id="N"/> <component-type-b id="1"/> <component-type-b id="2"/> <component-type-b id="N"/> Please note that the order of the components during import is relevant. Now every component should occupy its own file which should be externally versioned, QA-ed, bla, bla. We decided that the output of our export should be a zip file (with all these files in) and the input of our import should be a similar zip file. We do not want to explode the zip in our system. We do not want opening separate streams for each of the small files. My current questions: Q1. May the ZipInputStream guarantee that the zip entries (the little files) will be read in the same order in which they were inserted by our export that uses ZipOutputStream? I assume reading is something like: ZipInputStream zis = new ZipInputStream(new BufferedInputStream(fis)); ZipEntry entry; while((entry = zis.getNextEntry()) != null) { //read from zis until available } I know that the central zip directory is put at the end of the zip file but nevertheless the file entries inside have sequential order. I also know that relying on the order is an ugly idea but I just want to have all the facts in mind. Q2. If I use ZipFile (which I prefer) what is the performance impact of calling getInputStream() hundreds of times? Will it be much slower than the ZipInputStream solution? The zip is opened only once and ZipFile is backed by RandomAccessFile - is this correct? I assume reading is something like: ZipFile zipfile = new ZipFile(argv[0]); Enumeration e = zipfile.entries();//TODO: assure the order of the entries while(e.hasMoreElements()) { entry = (ZipEntry) e.nextElement(); is = zipfile.getInputStream(entry)); } Q3. Are the input streams retrieved from the same ZipFile thread safe (e.g. may I read different entries in different threads simultaneously)? Any performance penalties? Thanks for your answers!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 349 350 351 352 353 354 355 356 357 358 359 360  | Next Page >