Search Results

Search found 29935 results on 1198 pages for 'open ldap'.

Page 358/1198 | < Previous Page | 354 355 356 357 358 359 360 361 362 363 364 365  | Next Page >

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • Using OSX home directories from linux

    - by Steffen
    I'm running an OSX (Snow Leopard) Server with OpenDirectory, which is nothing else than a modified OpenLDAP with some Apple-specific schemas. However, I want to reuse this directory on some of my Linux (Debian Squeeze) boxes. It's no problem to authenticate against OSXs LDAP Server, this works fine already. What I struggle with is the way the home folders are specified in OSX. If I query the passwd config on one of my linux machines, the OSX imported entries are looking like this myaccount:x:1034:1026:Firstname Lastname:/Network/Servers/hostname.example.com/Volumes/MyShare/Users/myaccount:/bin/bash While those network home folders might be fine for OSX-Clients, I don't want those server based paths on my linux machines. I saw that there is an NFSHomeDirectory Attribute in the OSX User inspector, but if I change this the whole user home path gets changed. Since my users should be able to login on both systems, OSX and Linux, this is not what I want. Does anyone have an idea how I must configure OSX to make my linux machines use home folders like /net/myaccount and leave the configuration for OSX clients untouched?

    Read the article

  • importing a project into a svn repository question

    - by ajsie
    im using netbeans for svn. i open a project in netbeans and then i import it to a svn repo. it seems that although im only importing the project folder, svn creates .svn folders in all folders within this project folder. why is that? i thought that i was only creating .svn folders to checked out projects, not imported ones? now this folder acts very weird, when i open this folder as a project in netbeans, netbeans treats it like a svn folder some way. is this normal? cause i want this one to not be under SVN.

    Read the article

  • writing header in csv python with DictWriter

    - by user248237
    assume I have a csv.DictReader object and I want to write it out as a csv file. How can I do this? I thought of the following: dr = csv.DictReader(open(f), delimiter='\t') # process my dr object # ... # write out object output = csv.DictWriter(open(f2, 'w'), delimiter='\t') for item in dr: output.writerow(item) Is that the best way? More importantly, how can I make it so a header is written out too, in this case the object "dr"s .fieldnames property? thanks.

    Read the article

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • Jquery UI accordion question - how would you approach this?

    - by E.J. Brennan
    I am using jquery UI accordion control in one of my apps asp.net apps. The data for the accordion comes from a database, and each database record has an ID, a Title Field and a content field. The title is the heading, and the content is the data that shows up when the draw is opened... I'd like to be able to call my page like this: http://www.mywebsite.com/mypage.aspx?ID=123 and have it display all the data (as it does now), but then have the default 'drawer' of the accordion open to the section that corresponds to the ID number passed in on the url...there are about 50 sections on the page. Any suggestions on how to approach this? My questions is specific to the jquery accordion function, the rest I know. So where would be the best place to 'tag' the drawer with the unique ID's, and then what is the snippet of javascript code (I assume) that I would use 'open' that drawer based on the ID passed in?? Thanks!

    Read the article

  • Why can't I get Python's urlopen() method to work?

    - by froadie
    Why isn't this simple Python code working? import urllib file = urllib.urlopen('http://www.google.com') print file.read() This is the error that I get: Traceback (most recent call last): File "C:\workspace\GarchUpdate\src\Practice.py", line 26, in <module> file = urllib.urlopen('http://www.google.com') File "C:\Python26\lib\urllib.py", line 87, in urlopen return opener.open(url) File "C:\Python26\lib\urllib.py", line 206, in open return getattr(self, name)(url) File "C:\Python26\lib\urllib.py", line 345, in open_http h.endheaders() File "C:\Python26\lib\httplib.py", line 892, in endheaders self._send_output() File "C:\Python26\lib\httplib.py", line 764, in _send_output self.send(msg) File "C:\Python26\lib\httplib.py", line 723, in send self.connect() File "C:\Python26\lib\httplib.py", line 704, in connect self.timeout) File "C:\Python26\lib\socket.py", line 514, in create_connection raise error, msg IOError: [Errno socket error] [Errno 10060] A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond I've tried it with several different pages but I can never get the urlopen method to execute correctly.

    Read the article

  • Excel 2010 Access to path is denied temp

    - by Chris Anderson
    I am using excel data reader to read data from an excel file. FileStream stream = File.Open(filePath, FileMode.Open, FileAccess.Read); //1. Reading from a binary Excel file ('97-2003 format; *.xls) IExcelDataReader excelReader = ExcelReaderFactory.CreateBinaryReader(stream); //2. Reading from a OpenXml Excel file (2007 format; *.xlsx) IExcelDataReader excelReader = ExcelReaderFactory.CreateOpenXmlReader(stream); http://exceldatareader.codeplex.com/ This reads excel 1997-2003 format and excel 2007 format on my local machine and when we move it to our test server. However, when moved to production, it works for excel 97-2003 files, but when I try to read 2007 files I receive the following error: Access to the path 'C:\Documents and Settings\PORTALS03\ASPNET\LOCALS~1\Temp\TMP_Z129388041687919815' is denied. How is it possible that the 97-2003 excel file can be read but the 2007 files throw access is denied?

    Read the article

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • "Look" of page changes a bit after uploading it to IIS - looks good on computer same IE8

    - by J Smith
    No it's not a path issue...or else the site won't have a design. The website looks fine if I open it with IE8 in my computer. But after I upload it to IIS 6.0 two things change on positioning. I see a rendering problem. But if I open it with IE 8.0 on my machine it looks good, but opening it when uploaded to IIS , it changes a bit. Same exact files. Same browser, same computer. The only different thing is that it has been uploaded to IIS. IT has no programming in aspx whatsoever just .html .css and .js

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Configured Samba to join our domain, but logon fails from Windows machine

    - by jasonh
    I've configured a Fedora 11 installation to join our domain. It seems to join successfully (though it reports a DNS update failure) but when I try to access \\fedoraserver.test.mycompany.com I'm prompted for a password. So I enter adminuser and the password and that fails, so I try test.mycompany.com\adminuser and that too fails. What am I missing? EDIT (Update 9/1/09): I can now connect to the machine and see the shares on it (see my response to djhowell's answer) but when I try to connect, I get an error saying The network path was not found. I checked the log entry on the Fedora computer for the computer I'm connecting from (/var/log/samba/log.ComputerX) and it reads: [2009/09/01 12:02:46, 1] libads/cldap.c:recv_cldap_netlogon(157) no reply received to cldap netlogon [2009/09/01 12:02:46, 1] libads/ldap.c:ads_find_dc(417) ads_find_dc: failed to find a valid DC on our site (Default-First-Site-Name), trying to find another DC Config files as of 9/1/09: smb.conf: [global] Workgroup = TEST realm = TEST.MYCOMPANY.COM password server = DC.TEST.MYCOMPANY.COM security = DOMAIN server string = Test Samba Server log file = /var/log/samba/log.%m max log size = 50 idmap uid = 15000-20000 idmap gid = 15000-20000 windbind use default domain = yes cups options = raw client use spnego = no server signing = auto client signing = auto [share] comment = Test Share path = /mnt/storage1 valid users = adminuser admin users = adminuser read list = adminuser write list = adminuser read only = No I also set the krb5.conf file to look like this: [logging] default = FILE:/var/log/krb5libs.log kdc = FILE:/var/log/krb5kdc.log admin_server = FILE:/var/log/kadmind.log [libdefaults] default_realm = test.mycompany.com dns_lookup_realm = false dns_lookup_kdc = false ticket_lifetime = 24h forwardable = yes [realms] TEST.MYCOMPANY.COM = { kdc = dc.test.mycompany.com admin_server = dc.test.mycompany.com default_domain = test.mycompany.com } [domain_realm] dc.test.mycompany.com = test.mycompany.com .dc.test.mycompany.com = test.mycompany.com [appdefaults] pam = { debug = false ticket_lifetime = 36000 renew_lifetime = 36000 forwardable = true krb4_convert = false } I realize that there might be an issue with EXAMPLE.COM in there, however if I change it to TEST.MYCOMPANY.COM then it fails to join the domain with a preauthentication failure. As of 9/1/09, this is no longer the case.

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • Firefox proxy authentication with Kerberos: one service ticket per connection (Linux)

    - by Dari
    I am trying to enable proxy authentication via Kerberos for Firefox. The setup is: Active Directory domain (for LDAP and Kerberos; this works and I can log in the computer and get Kerberos tickets without problems) Microsoft Windows witness machine (on which Firefox runs fine with no ticket problem) CentOS 6.3 system with Firefox (the tests were performed with both the 10.0.1 ESR found in the CentOS package repositories and the 15.0.1 downloaded from Mozilla's website) BlueCoat proxy with Kerberos authentication enabled For the moment, Firefox requests an element of a website, gets an HTTP error code of "407 Proxy Authentication Required" from the proxy, gets a ticket granting service (TGS) from the domain for the proxy and performs the request again while passing the ticket. The transaction runs fine. However, when more elements are requested (in parallel), Firefox requests one more ticket per proxy connection. And this takes many DNS queries, Kerberos interactions with domain controllers and costs a lot of time (for example, the home page of Adobe takes several minutes to load and at the end, I have about 30 valid Kerberos tickets). I am stuck on this since a while, and help would be greatly appreciated. Minor information: the CentOS operating system is virtualized with VMware Player 3.1.3, but I do not think this would be a game changer.

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • bind9 named.conf zones size limit

    - by mox601
    I am trying to set up a test environment on my local machine, and I am trying to start a DNS daemon that loads tha configuration from a named.conf.custom file. As long as the size of that file is like 3-4 zones, the bind9 daemon loads fine, but when i enter the config file i need (like 10000 lines long), bind can't startup and in the syslog i find this message: starting BIND 9.7.0-P1 -u bind Jun 14 17:06:06 cibionte-pc named[9785]: built with '--prefix=/usr' '--mandir=/usr/share/man' '--infodir=/usr/share/info' '--sysconfdir=/etc/bind' '--localstatedir=/var' '--enable-threads' '--enable-largefile' '--with-libtool' '--enable-shared' '--enable-static' '--with-openssl=/usr' '--with-gssapi=/usr' '--with-gnu-ld' '--with-dlz-postgres=no' '--with-dlz-mysql=no' '--with-dlz-bdb=yes' '--with-dlz-filesystem=yes' '--with-dlz-ldap=yes' '--with-dlz-stub=yes' '--with-geoip=/usr' '--enable-ipv6' 'CFLAGS=-fno-strict-aliasing -DDIG_SIGCHASE -O2' 'LDFLAGS=-Wl,-Bsymbolic-functions' 'CPPFLAGS=' Jun 14 17:06:06 cibionte-pc named[9785]: adjusted limit on open files from 1024 to 1048576 Jun 14 17:06:06 cibionte-pc named[9785]: found 1 CPU, using 1 worker thread Jun 14 17:06:06 cibionte-pc named[9785]: using up to 4096 sockets Jun 14 17:06:06 cibionte-pc named[9785]: loading configuration from '/etc/bind/named.conf' Jun 14 17:06:06 cibionte-pc named[9785]: /etc/bind/named.conf.saferinternet:1: unknown option 'zone' Jun 14 17:06:06 cibionte-pc named[9785]: loading configuration: failure Jun 14 17:06:06 cibionte-pc named[9785]: exiting (due to fatal error) Are there any limits on the file size bind9 is allowed to load?

    Read the article

  • Joining Samba to Active Directory with local user authentication

    - by Ansel Pol
    I apologise that this is somewhat incoherent, but hopefully someone will be able to make enough sense of this to understand what I'm trying to achieve and provide pointers. I have a machine with two network interfaces connected to two different networks (one of which it's providing several other services for, such as DNS), running two separate instances of Samba, one bound to each interface. One of the instances is just a workgroup-style setup using share-level authentication, which is all working fine. The problem is that I'm looking to join the other instance to an MS Active Directory domain (provided by MS Windows Small Business Server 2003) to enable a subset of the domain users to access the shares from Windows machines on the other network. The users who need access from the domain environment have accounts (whose names are all-lowercase versions of their domain usernames) on the machine running Samba, but I'm not sure about how to map the UIDs and everything I've read concerns authenticating accounts on that machine against either AD or another LDAP server. To clarify: I only want the credentials for AD users accessing the non-workgroup Samba instance to be authenticated against AD, not the accounts on the machine running Samba. I hope this is sufficiently clear. EDIT: In addition to being able to access the Samba shares from AD, I do also need to be able to access a share on the domain from the machine running Samba but would still like everything non-Samba-related to authenticate locally.

    Read the article

  • How to set source path of image within html pages to show in webbrowser control

    - by Royson
    Hi in my application there is web browser control to show some static html pages. The pages are displayed properly. but images are not displayed.. I tried with changing src-path but no success. my htmlpages folder is located at bin folder. And i am assigning it as. FileStream source = new FileStream(@"..\HtmlPages\supportHtml.html", FileMode.Open, FileAccess.Read); if i open html files in browser, the images are displayed properly.. So, What is the correct path for images..?? If i set full path to src attribute of <img> tag..it works. but i think its not a proper way. :( EDIT: If i assign d:\myapp\bin\HtmlPages\support.gif then image is displayed. And if i assign "..\HtmlPages\support.gif" or "support.gif" image is not shown.

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • PHP want to buy / find a eMall, Shopping Mall system with multiple vendor management backend

    - by Shiro
    Basically I am looking for a Shopping Mall system in PHP. User included Member / User Administrator Vendor Affiliate I find a lot ecommerce that support multiple shop, but each vendor don't have their own login and management. And in the front I would like to share the cart. and can buy from different shop. If multiple subdomain supported that would be more better. Web 2.0 design would be much more preferable. Any suggestion? I google some of it, hopefully can get more references. Buy / Open source also please advice. I don't think this kind of system got open source :p

    Read the article

< Previous Page | 354 355 356 357 358 359 360 361 362 363 364 365  | Next Page >