Search Results

Search found 29935 results on 1198 pages for 'open ldap'.

Page 358/1198 | < Previous Page | 354 355 356 357 358 359 360 361 362 363 364 365  | Next Page >

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • Why Read In UTF-16LE File Won't Convert "\r\n" Into "\n" In Windows

    - by Dbger
    I am using Perl to read UTF-16LE files in Windows 7. If I read in an ascii file with following code: open CUR_FILE, "<", $asciiFile; Then each "\r\n" in file will be converted into a "\n" in memory; if I read in an UTF-16LE(windows 1200) file with following code: open CUR_FILE, "<:encoding(UTF-16LE)", $utf16leFile; Then "\r\n" will keep unchanged. This inconsistency cause problems when I trying to regexp lines with line breaks. My questions is: Is this how unicode works in Perl & Windows? Or Am I using the wrong code? Thanks so much!

    Read the article

  • writing header in csv python with DictWriter

    - by user248237
    assume I have a csv.DictReader object and I want to write it out as a csv file. How can I do this? I thought of the following: dr = csv.DictReader(open(f), delimiter='\t') # process my dr object # ... # write out object output = csv.DictWriter(open(f2, 'w'), delimiter='\t') for item in dr: output.writerow(item) Is that the best way? More importantly, how can I make it so a header is written out too, in this case the object "dr"s .fieldnames property? thanks.

    Read the article

  • Ctrl+Click / Command+Click not working with analytics

    - by user347998
    Hi All, I created my own analytics for my site to track outbound click events using jquery. Now the thing with preventDefault() is that it does not allow for the Ctrl+Click or COmmand+click operation in the browser to open the link in new tab/window. So my solution was to detect e.metaKey || e.ctrlKey and use window.open. This does not work very great with safari unless the user changes browser behavior. I am wondering if anyone here knows what other analytics users do - like how does google etc deal with this problem in tracking outbound links? From this link: http://www.google.com/support/googleanalytics/bin/answer.py?hl=en&answer=55527 - looks like google will also face the same problem. Thoughts?

    Read the article

  • .attr("disabled", "disabled") problem

    - by meo
    i have this function where basically add and remove the disabled attribute form a input field: $(bla).click(function(){ if (something) { console.log($target.prev("input")) // gives out the right object $target.toggleClass("open").prev("input").attr("disabled", "disabled"); }else{ $target.toggleClass("open").prev("input").removeAttr("disabled"); //this works } }) the removeAttr works fine but when i need to add the disabled again it does just nothing. My console.log is triggering (and giving me back the right input field) so I'm sure my that my if statement works. But if i inspect the DOM with firebug the disabled attribute does not appear. can someone help me? PS: please don't focus on the function or the if statement itself, works fine its just that attr that dies not work for disabled...

    Read the article

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • Running a service with a user from a different domain not working

    - by EWood
    I've been stuck on this for a while, not sure what permission I'm missing. I've got domain A and domain B, A trusts B, but B does not trust A. I'm trying to run a service in domain A with a user account from domain B and I keep getting Access is Denied. I'm using the FQDN after the username and the password is correct. The user account from domain B is a local administrator on the domain A server, the user account has the logon locally, and as a service permissions. Must. Get. This. Working. Update: I found something interesting in the logs I must have missed. This ought to get me pointed in the right direction. Event ID: 40961 - LsaSrv : The Security System could not establish a secured connection with the server ldap/{server fqdn/fqdn@fqdn} No authentication protocol was available. I've found a few fixes for 40961 but nothing has worked so far. I've verified reverse lookup zones. nslookup resolves the correct dc properly. still workin' at it. Upadte: In response to Evan; I ran " runas /env /user:ftp_user@fqdn "notepad" " then entered the users password and notepad came up. It seems to work successfully. This issue is now resolved. The problem is visible in the screenshot. Windows tries to use the UPN for the user account if you dig your user out of AD with the Browse button. This fails every time even with the right user and password. Simply using the SAM format (Domain\User) works. So simple, yet so annoying. Can't believe I missed this. Thanks to everyone who helped.

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • Joining Samba to Active Directory with local user authentication

    - by Ansel Pol
    I apologise that this is somewhat incoherent, but hopefully someone will be able to make enough sense of this to understand what I'm trying to achieve and provide pointers. I have a machine with two network interfaces connected to two different networks (one of which it's providing several other services for, such as DNS), running two separate instances of Samba, one bound to each interface. One of the instances is just a workgroup-style setup using share-level authentication, which is all working fine. The problem is that I'm looking to join the other instance to an MS Active Directory domain (provided by MS Windows Small Business Server 2003) to enable a subset of the domain users to access the shares from Windows machines on the other network. The users who need access from the domain environment have accounts (whose names are all-lowercase versions of their domain usernames) on the machine running Samba, but I'm not sure about how to map the UIDs and everything I've read concerns authenticating accounts on that machine against either AD or another LDAP server. To clarify: I only want the credentials for AD users accessing the non-workgroup Samba instance to be authenticated against AD, not the accounts on the machine running Samba. I hope this is sufficiently clear. EDIT: In addition to being able to access the Samba shares from AD, I do also need to be able to access a share on the domain from the machine running Samba but would still like everything non-Samba-related to authenticate locally.

    Read the article

  • Why can't I get Python's urlopen() method to work?

    - by froadie
    Why isn't this simple Python code working? import urllib file = urllib.urlopen('http://www.google.com') print file.read() This is the error that I get: Traceback (most recent call last): File "C:\workspace\GarchUpdate\src\Practice.py", line 26, in <module> file = urllib.urlopen('http://www.google.com') File "C:\Python26\lib\urllib.py", line 87, in urlopen return opener.open(url) File "C:\Python26\lib\urllib.py", line 206, in open return getattr(self, name)(url) File "C:\Python26\lib\urllib.py", line 345, in open_http h.endheaders() File "C:\Python26\lib\httplib.py", line 892, in endheaders self._send_output() File "C:\Python26\lib\httplib.py", line 764, in _send_output self.send(msg) File "C:\Python26\lib\httplib.py", line 723, in send self.connect() File "C:\Python26\lib\httplib.py", line 704, in connect self.timeout) File "C:\Python26\lib\socket.py", line 514, in create_connection raise error, msg IOError: [Errno socket error] [Errno 10060] A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond I've tried it with several different pages but I can never get the urlopen method to execute correctly.

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • bind9 named.conf zones size limit

    - by mox601
    I am trying to set up a test environment on my local machine, and I am trying to start a DNS daemon that loads tha configuration from a named.conf.custom file. As long as the size of that file is like 3-4 zones, the bind9 daemon loads fine, but when i enter the config file i need (like 10000 lines long), bind can't startup and in the syslog i find this message: starting BIND 9.7.0-P1 -u bind Jun 14 17:06:06 cibionte-pc named[9785]: built with '--prefix=/usr' '--mandir=/usr/share/man' '--infodir=/usr/share/info' '--sysconfdir=/etc/bind' '--localstatedir=/var' '--enable-threads' '--enable-largefile' '--with-libtool' '--enable-shared' '--enable-static' '--with-openssl=/usr' '--with-gssapi=/usr' '--with-gnu-ld' '--with-dlz-postgres=no' '--with-dlz-mysql=no' '--with-dlz-bdb=yes' '--with-dlz-filesystem=yes' '--with-dlz-ldap=yes' '--with-dlz-stub=yes' '--with-geoip=/usr' '--enable-ipv6' 'CFLAGS=-fno-strict-aliasing -DDIG_SIGCHASE -O2' 'LDFLAGS=-Wl,-Bsymbolic-functions' 'CPPFLAGS=' Jun 14 17:06:06 cibionte-pc named[9785]: adjusted limit on open files from 1024 to 1048576 Jun 14 17:06:06 cibionte-pc named[9785]: found 1 CPU, using 1 worker thread Jun 14 17:06:06 cibionte-pc named[9785]: using up to 4096 sockets Jun 14 17:06:06 cibionte-pc named[9785]: loading configuration from '/etc/bind/named.conf' Jun 14 17:06:06 cibionte-pc named[9785]: /etc/bind/named.conf.saferinternet:1: unknown option 'zone' Jun 14 17:06:06 cibionte-pc named[9785]: loading configuration: failure Jun 14 17:06:06 cibionte-pc named[9785]: exiting (due to fatal error) Are there any limits on the file size bind9 is allowed to load?

    Read the article

  • Firefox proxy authentication with Kerberos: one service ticket per connection (Linux)

    - by Dari
    I am trying to enable proxy authentication via Kerberos for Firefox. The setup is: Active Directory domain (for LDAP and Kerberos; this works and I can log in the computer and get Kerberos tickets without problems) Microsoft Windows witness machine (on which Firefox runs fine with no ticket problem) CentOS 6.3 system with Firefox (the tests were performed with both the 10.0.1 ESR found in the CentOS package repositories and the 15.0.1 downloaded from Mozilla's website) BlueCoat proxy with Kerberos authentication enabled For the moment, Firefox requests an element of a website, gets an HTTP error code of "407 Proxy Authentication Required" from the proxy, gets a ticket granting service (TGS) from the domain for the proxy and performs the request again while passing the ticket. The transaction runs fine. However, when more elements are requested (in parallel), Firefox requests one more ticket per proxy connection. And this takes many DNS queries, Kerberos interactions with domain controllers and costs a lot of time (for example, the home page of Adobe takes several minutes to load and at the end, I have about 30 valid Kerberos tickets). I am stuck on this since a while, and help would be greatly appreciated. Minor information: the CentOS operating system is virtualized with VMware Player 3.1.3, but I do not think this would be a game changer.

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • Jquery UI accordion question - how would you approach this?

    - by E.J. Brennan
    I am using jquery UI accordion control in one of my apps asp.net apps. The data for the accordion comes from a database, and each database record has an ID, a Title Field and a content field. The title is the heading, and the content is the data that shows up when the draw is opened... I'd like to be able to call my page like this: http://www.mywebsite.com/mypage.aspx?ID=123 and have it display all the data (as it does now), but then have the default 'drawer' of the accordion open to the section that corresponds to the ID number passed in on the url...there are about 50 sections on the page. Any suggestions on how to approach this? My questions is specific to the jquery accordion function, the rest I know. So where would be the best place to 'tag' the drawer with the unique ID's, and then what is the snippet of javascript code (I assume) that I would use 'open' that drawer based on the ID passed in?? Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • ADO.NET: Faster way to check if the database server is accessible?

    - by lotana
    At the moment I am using this code to check if the database is accessible: public bool IsDatabaseOnline(string con) { bool isConnected = false; SQLConnection connect = null; try { connect = new SQLConnection(con); connect.Open(); isConnected = true; } catch (Exception e) { isConnected = false; } finally { if (connect != null) connect.Close(); } return isConnected; } While this code works fine, there is a disadvantage. If the server is not online it spends about 4 full seconds trying to open the connection before deciding that it is not available. Is there a way to test the connection without trying to actually opening it and waiting for the timeout? Something like a database-equivalent of ping?

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

< Previous Page | 354 355 356 357 358 359 360 361 362 363 364 365  | Next Page >