Search Results

Search found 51790 results on 2072 pages for 'long running'.

Page 36/2072 | < Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >

  • HP Laptop recognizes hard drive just long enough to install windows

    - by Joe
    I have an HP laptop, DV6500 (CTO). It refused to boot one day, so I ran some diagnostics (a friend lent me "Hirens Boot Disk", "UBCD" and "PC DR 6"). Everything passed, except for the hdd. I replaced the HDD with a used drive of unknown condition. Installed windows with no problems. Installed the wireless driver, tried to reboot ... no luck. So I went to Best Buy, bought a brand new Western Digital 320gb HDD. Put it in the machine, installed windows (vista home premium). Installed the wired networking driver. Tried to reboot. No luck. Put the first hdd back in the machine, reinstalled windows. Started to install some drivers, went to reboot, and the machine won't come back to life. Put the second hdd in the machine, rinse wash and repeat. I've replaced the memory, even though it passed diagnostics. Problem exists with both brand new memory, and old memory. The BIOS recognizes the hard drive. The computer freezes directly after the bios splash screen, and there is no hard drive activity light. I've tried two linux live distros (gentoo and ubuntu). Neither would run on this laptop, but will on a different HP laptop. UBCD and Hirens Boot Disk both ran, as did PC Doctor 6 which refuses to test anything (gets stuck at "enumerating hard disks"). Is there anything else I can try?

    Read the article

  • Hourly CRON task running more frequently than one hour

    - by Justin
    I have a cron task that calls a special PHP script via wget. Here is the crontab entry: 0 * * * * wget http://www.... It will work perfect for several days, running on the hour. However, after a few days the cron job will start to be called several times an hour. I have never seen CRON drift like this, so I imagine it can't really be a CRON issue. However, the logs of the script that is called clearly show it running several times an hour. Server details: Ubuntu Luci Apache MySQL PHP5 Time is showing correct @ command line Server is setup to sync with a NTP server In order for the script to run it must be passed a unique 50-character hash key in the URL, so this script isn't being called from any other source accidentally. What might cause CRON to drift like this?

    Read the article

  • Running a VM off of an external HD via USB

    - by Nelson LaQuet
    Is it viable to run (i.e. reference the vmx/vhd directly from the mounted drive) a VM (vmware running Windows Seven) off of an external HD via USB? I mean, I know it's possible, but I guess I'm asking if USB provides enough bandwidth for normal usage... If so, are there any particular brands that may be better or worse? I know that ESATA would be a more viable setup, but my laptop doesn't have an ESATA port. Currently I use the VM to segregate all of my work development servers and software from my main machine; so I will be running all development servers and tools on the VM directly.

    Read the article

  • Dir and Findstr commands taking a long time to complete in Batch File

    - by user2405934
    dir %DRIVE_NAME%: /S /C /A-D /Q /T:C | findstr ".zip$ .doc$ .xls$ .xpt$ .cpt$ .cpo$ .xlsx$ .pdf$ .dat$ .txt$ .docx$ .csv$" >> file.info I am using above command to list all information in file, as below: 03/27/2013 01:02 PM 86,280 uusr\fr02 h123_frf67_rk_20140327.txt 03/27/2013 01:02 PM 5,513 usr\fr02 h123_frf67_rk_20140328.txt %DRIVE_NAME%: is mapped drive. Folders will be the same; not more than 100 folders and their sub-folders, and there will only be 2 or 3 files at time in any one of the folders. Now the issues is that for one folder it works perfect, but for 80 to 90 folders it is taking too much time. I think it's because of findstr and the different extensions used. Is there any way to make it faster?

    Read the article

  • How long does it take for a server to get 'off greylisting'

    - by Michael
    Hi all, I asked a question regarding email delays a few months ago, and I think I found a workaround. I changed our email from "[email protected]" to "[email protected]", and it seems to work instantly again. After reading some articles, I believe this could be due to some form of greylisting, though some servers might call it something else -- if a server like yahoo or gmail receive email from a server that it is not used to receiving email from, then sometimes the delay occurs. But a name such as yahoo, gmail, which requires a user to sign up manually -- this delay can be avoided. My question is this: does anyone know more about this issue -- especially since it would be nice to send an email from our own site, instead of needing to use a whitelisted server? Thanks!

    Read the article

  • Sharing accounts between multiple computers running Ubuntu Linux

    - by john
    My school has a computer lab full of machines running Red Hat Linux. They have it set up so that you can log into any computer in the lab, and it automatically loads your desktop, home directory, etc, which makes it so all computers in the lab look the same to you, regardless or which one you're using. I have two computer at home running Ubuntu Linux. Could I do this same thing with my computers at home? What's it called, and how do I find documentation on how to set it up? Thanks!

    Read the article

  • Failover NIC with Windows 7 running Apache Server

    - by Benjamin Jones
    I have a Apache Server running on a Windows 7 Desktop for a internal website (Intranet). I am trying to figure out how I can make this system as failover safe as possible. One thing I want to do is use the 2nd NIC card that is currently disable. I only have one gateway address to my router. I do not have any computer running a Server O/S. If NIC1 crashes by chance(just humor me!), how could NIC2's IP take on the host name (I have mapped in host file) . I don't really care if the static IP of NIC2 changes seeing that the host name is the only thing I need. Could I add two IP's to the host file, with same host email and maybe create some script that will run IF NIC 1 fails? OR is there any failover software that will do this for me?

    Read the article

  • Network folder image thumbnails taking long time to load

    - by Steve
    Our internal network folder can take up to 5 seconds to generate a thumbnail for each photo in a network folder. Usually, only 10% of thumbnails actually display; the rest are default jpg icons. A thumbs.db file already exists inside this folder, so presumably the thumbnails have been generated before. Why do they have to be generated again? The PC is Win7 64-bit. The server is Windows 2003 Server SP2.

    Read the article

  • Web server freezing or taking too long to load page sometimes

    - by Samer
    This is happens once in a while, but sometimes when I try to load a web page from my server it just freezes there for a minute trying to load it. I'm not sure what's causing the issue, or have been able to recreate it. My guess is that one of the softwares I listed below is freezing or something. What are some techniques I can use to troubleshoot the situation? Specs: nginx php-fpm php5.5 freebsd 9.1

    Read the article

  • Server Running but unable to log in to it

    - by Funky Si
    I have a Windows Server 2003 server that is running sql server. Users can access the databases running on it fine, but I am unable to log on to it by remote desktop or directly at the machine. I am able to view the event logs remotely and I can't see anything that shouts out as being a problem. What options can people think of for regaining access to this server or finding out more information about the problem? I am able to reinstall the operating system but would like to leave that as a last resort.

    Read the article

  • running a web server with encrypted file system (all or part of it)

    - by Carlos
    Hi, I need a webserver (lamp) running inside a virtual machine (#1) running as a service (#2) in headless mode (#3) with part or the whole filesystem encrypted (#4). The virtual machine will be started with no user intervention and provide access to a web application for users in the host machine. Points #1,#2 and #3 are checked and proved to be working fine with Sun VirtualBox, so my question is for #4: Can I encrypt the all filesystem and still access the webserver (using a browser) or will grub ask me for a password? If encrypting the all filesystem is not an option, can I encrypt only /home and /var/www ? will apache/php be able to use files in /home or /var/www without asking for a password or mounting these partitions manually? Thanks

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Don't run cron job if already running

    - by webnoob
    Hi All, I know this question has been asked already but I either didn't understand the answer or it didn't apply to me. I have a php script that I am calling every 1 minute using CPanel to set up the Cron Job. The nature of the script means that it could overrun for just over the minute so I need to know how to stop the next one running if the first one hasn't completed. I have a VPS running CENTOS 5.5 and have access to WHM and CPanel. I have never used Linux before (only just got the server yesterday) so I have no idea what I am doing and would appreciate some help if possible. If I need to provide more information please let me know (I don't know what info you would need at the moment). Thanks.

    Read the article

  • Running Tomcat 7 and Apache 2 on the same server

    - by Thorn
    Part of my site needs to run over HTTPS and I'm creating a sub-domain for that part. I have apache httpd 2 AND Tomcat 7 running on the same server with the same IP, Apache is on port 80 of course, while Tomcat is running on port 8080. Right now I am doing domain forwarding for requests that need to run off tomcat. For example, mathteamhosting.com/mathApp can forward to mathteamhosting.com:8080/mathApp. I would like to have Tomcat handle the https requests for that subdomain. I don't think this forwarding technique can work in this case. How do I set that up so that Tomcat receives the requests on port 443 while apache handles port 80. To be more specific: http://proctinator.com == request goes to Apache web server https://private.proctinator.com == request goes to Apache web server

    Read the article

  • It takes a long time until windows xp recognize I connected USB diks

    - by Pavol G
    Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

    Read the article

  • Remotely running batches on a Windows PC

    - by Eduardo León
    I want to remotely control my home desktop PC (running Windows 7 Professional), mainly to perform the following tasks: Downloading email attachments, and sending emails with attachments Running UI-less programs whose only inputs are files and whose only outputs are files So far, the only solution I have found is to use Remote Desktop to connect to my PC, but this is very slow and inefficient, especially when there is no fast Internet connection available other than my cell phone's. I would like to be able to send batch commands to my PC, like: Download an email attachment Use it as input for an UI-less program Save the program's output to a file Send that file to myself as an email attachment Is this possible? How could I do it?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Windows 7 extremely long startup

    - by Tyler
    Windows 7 before it even gets to login. On the "starting windows" splash screen takes no less than 15 minutes to finish more like 25 minutes most times. During this time the hard drive activity led indicator is blinking maybe once every 20 seconds. When I finally get to the desktop everything runs normally. I have unplugged all peripherals with same result. Ideas? It's 32bit. 4gig memory. Fast CPU which I can't recall off the top of my head.

    Read the article

  • Running commands on FreeBSD Live CD

    - by jmc
    I'm running FreeBSD 9.1-PRERELEASE on a vps running on XEN virtualization, I tried to update it to 9.1-RELEASE but mergemaster toasted my /etc/master.passwd and /etc/passwd so what i have now is a blank copies of the two files. What i did is use a mounted Live CD and mount my root partition to /mnt and manually re listed every entry to /mnt/etc/master.passwd and /mnt/etc/passwd from another freebsd server. I believe that everytime you edit master.passwd and passwd you have to run pwd_mkdb but this gives me "Read Only File" error. What I plan to do is enable PermitRootLogin and PermitEmptyPassword first so I can login as root first before I redo necessary changes again. But i have to run pwd_mkdb, so is there a way to run this command from Live CD?

    Read the article

  • Macbook Air Reboot after Wake when Windows 7 Running in VM

    - by rfastturnlow
    Is anyone who is running a Windows 7 VM on a new 2011 i5 Macbook Air (I have the 13" w/128 SSD) able to put their Macbook air to sleep for extended periods of time (like overnight) without manually shutting down or suspending a VM that's running in Parallels, VMware Fusion or VirtualBox? I've tried all three virtualization products with no success. With all three, if I forget to manually shutdown or suspend the VM, OSX reboots when I try and wake the Macbook. Same goes if I try and use the Deep Sleep widget. Parallels support openly admitted that this was an issue and thankfully gave me a refund. I've also tried the trial version of VMware and VirtualBox, but the behavior is the same. Should I just give up or is anyone out there having more success at this?

    Read the article

  • How long would this file transfer take?

    - by CT
    I have 12 hours to backup 2 TB of data. I would like to backup to a network share to a computer using consumer WD 2TB Black 7200rpm hard drives. Gigabit Ethernet. What other variables would I need to consider to see if this is feasible? How would I set up this calculation?

    Read the article

  • Windows takes a very long time to shut down even in safe mode

    - by user1526247
    On Windows 7 the computer freezes for about 5 minutes once it gets to "Shutting down...". I can't remember when it started happening. I just lived with it for a while. The first thing I tried was a full scan using Microsoft Security Essentials. This did not solve the problem. I then went into msconfig and turned off everything I could get away with in the startup and services tabs. This did not solve the problem. I then uninstalled every program on this computer save the most basic programs. This did not solve the problem (did not uninstall drivers or catalyst). I then went through and turned off every single service and did a reboot. This did not solve the problem. I then booted into safe mode and just tried shutting it down. The problem even happens in safe mode. I have tried examining the event logs but with no success. They just say things like "blah blah has entered the stopped state" with no real clues about what program is causing me all this grief. *it may be worth noting that Ubuntu is installed on the same computer and the ubuntu boot loader is the one being used.

    Read the article

  • ESXI 4.0 Slow response in opening anything accross the network on a Virtual Server running Win2008

    - by user40944
    Hi I recently installed a HP ML350G6 Server with Windows Small Business Server 200864bit, Exchange 2007. The server was running fantastically and we transferred all user data onto the new server and no problems for 2 weeks! We then installed SQL2008 and transferred the accounts package onto the server and this is where the problems started. Users are now complaining to open a work document can take 2 minutes and the same with regard to anything else. The server itself seems fine, the virtual server seems fine! No disk performance problems (doesn't go above 50% unless i really copy lots of things), no memory, (12Gb only using 7Gb) cpu (usage is low average about 15%) etc on both the VM and in Windows Task manager. I have made sure disk caching is enabled on the raid controller (which made no difference). Network cards are running 1Gb and plugged into HP GB switch. Please help!

    Read the article

< Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >