Search Results

Search found 59194 results on 2368 pages for 'depth first search'.

Page 369/2368 | < Previous Page | 365 366 367 368 369 370 371 372 373 374 375 376  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Read access to Active Directory property (uSNChanged)

    - by Tom Ligda
    I have an issue with read access to the uSNChanged property when doing LDAP searches. If I do an LDAP search with a user that is a member of the Domain Admins group (UserA), I can see the uSNChanged property for every user. The problem is that if I do an LDAP search with a user (UserB) that is not a member of the Domain Admins group, I can see the uSNChanged property for some users (UserGroupA) and not for some users (UserGroupB). When I look at the users in UserGroupA and compare them to the users in UserGroupB, I see a crucial difference in the "Security" tab. The users in UserGroupA have the "Include inheritable permissions from this object's parent" unchecked. The users in UserGroupB have that option checked. I also noticed that the users in UserGroupA are users that were created earlier. The users in UserGroupB are users created recently. It's difficult to quantify, but I estimate the border between creation time between the users in UserGroupA and UserGroupB is about 6 months ago. What can cause the user creation to default to having that security property checked as opposed to unchecked? A while back (maybe around 6 months ago?) I changed the domain functional level from Windows Server 2003 to Windows Server 2008 R2. Would that have had this effect? (I can't exactly downgrade the domain functional level to test it out.) Is this security property actually the cause of the issue with read access to the uSNChanged property on LDAP searches? It seems correlated, but I'm not sure about causation. What I want in the end is for all authenticated users to have read access to the uSNChanged property for all users when doing an LDAP search. I would also be OK if I could grant read access for that property to an AD group. Then I can control access by adding members to the group.

    Read the article

  • ESX Firewall Command Troubles

    - by John
    Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

    Read the article

  • Sudo asks for password twice with LDAP authentication

    - by Gnudiff
    I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

    Read the article

  • How to convert excel individual cell values to percentage change values over time

    - by cgalloway
    I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

    Read the article

  • Asterisk Register username with special character like "@"

    - by Najibul Huq
    I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

    - by cwd
    I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

    Read the article

  • Sublinear Extra Space MergeSort

    - by hulkmeister
    I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

    Read the article

  • Parallelism in .NET – Part 4, Imperative Data Parallelism: Aggregation

    - by Reed
    In the article on simple data parallelism, I described how to perform an operation on an entire collection of elements in parallel.  Often, this is not adequate, as the parallel operation is going to be performing some form of aggregation. Simple examples of this might include taking the sum of the results of processing a function on each element in the collection, or finding the minimum of the collection given some criteria.  This can be done using the techniques described in simple data parallelism, however, special care needs to be taken into account to synchronize the shared data appropriately.  The Task Parallel Library has tools to assist in this synchronization. The main issue with aggregation when parallelizing a routine is that you need to handle synchronization of data.  Since multiple threads will need to write to a shared portion of data.  Suppose, for example, that we wanted to parallelize a simple loop that looked for the minimum value within a dataset: double min = double.MaxValue; foreach(var item in collection) { double value = item.PerformComputation(); min = System.Math.Min(min, value); } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } This seems like a good candidate for parallelization, but there is a problem here.  If we just wrap this into a call to Parallel.ForEach, we’ll introduce a critical race condition, and get the wrong answer.  Let’s look at what happens here: // Buggy code! Do not use! double min = double.MaxValue; Parallel.ForEach(collection, item => { double value = item.PerformComputation(); min = System.Math.Min(min, value); }); This code has a fatal flaw: min will be checked, then set, by multiple threads simultaneously.  Two threads may perform the check at the same time, and set the wrong value for min.  Say we get a value of 1 in thread 1, and a value of 2 in thread 2, and these two elements are the first two to run.  If both hit the min check line at the same time, both will determine that min should change, to 1 and 2 respectively.  If element 1 happens to set the variable first, then element 2 sets the min variable, we’ll detect a min value of 2 instead of 1.  This can lead to wrong answers. Unfortunately, fixing this, with the Parallel.ForEach call we’re using, would require adding locking.  We would need to rewrite this like: // Safe, but slow double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach(collection, item => { double value = item.PerformComputation(); lock(syncObject) min = System.Math.Min(min, value); }); This will potentially add a huge amount of overhead to our calculation.  Since we can potentially block while waiting on the lock for every single iteration, we will most likely slow this down to where it is actually quite a bit slower than our serial implementation.  The problem is the lock statement – any time you use lock(object), you’re almost assuring reduced performance in a parallel situation.  This leads to two observations I’ll make: When parallelizing a routine, try to avoid locks. That being said: Always add any and all required synchronization to avoid race conditions. These two observations tend to be opposing forces – we often need to synchronize our algorithms, but we also want to avoid the synchronization when possible.  Looking at our routine, there is no way to directly avoid this lock, since each element is potentially being run on a separate thread, and this lock is necessary in order for our routine to function correctly every time. However, this isn’t the only way to design this routine to implement this algorithm.  Realize that, although our collection may have thousands or even millions of elements, we have a limited number of Processing Elements (PE).  Processing Element is the standard term for a hardware element which can process and execute instructions.  This typically is a core in your processor, but many modern systems have multiple hardware execution threads per core.  The Task Parallel Library will not execute the work for each item in the collection as a separate work item. Instead, when Parallel.ForEach executes, it will partition the collection into larger “chunks” which get processed on different threads via the ThreadPool.  This helps reduce the threading overhead, and help the overall speed.  In general, the Parallel class will only use one thread per PE in the system. Given the fact that there are typically fewer threads than work items, we can rethink our algorithm design.  We can parallelize our algorithm more effectively by approaching it differently.  Because the basic aggregation we are doing here (Min) is communitive, we do not need to perform this in a given order.  We knew this to be true already – otherwise, we wouldn’t have been able to parallelize this routine in the first place.  With this in mind, we can treat each thread’s work independently, allowing each thread to serially process many elements with no locking, then, after all the threads are complete, “merge” together the results. This can be accomplished via a different set of overloads in the Parallel class: Parallel.ForEach<TSource,TLocal>.  The idea behind these overloads is to allow each thread to begin by initializing some local state (TLocal).  The thread will then process an entire set of items in the source collection, providing that state to the delegate which processes an individual item.  Finally, at the end, a separate delegate is run which allows you to handle merging that local state into your final results. To rewriting our routine using Parallel.ForEach<TSource,TLocal>, we need to provide three delegates instead of one.  The most basic version of this function is declared as: public static ParallelLoopResult ForEach<TSource, TLocal>( IEnumerable<TSource> source, Func<TLocal> localInit, Func<TSource, ParallelLoopState, TLocal, TLocal> body, Action<TLocal> localFinally ) The first delegate (the localInit argument) is defined as Func<TLocal>.  This delegate initializes our local state.  It should return some object we can use to track the results of a single thread’s operations. The second delegate (the body argument) is where our main processing occurs, although now, instead of being an Action<T>, we actually provide a Func<TSource, ParallelLoopState, TLocal, TLocal> delegate.  This delegate will receive three arguments: our original element from the collection (TSource), a ParallelLoopState which we can use for early termination, and the instance of our local state we created (TLocal).  It should do whatever processing you wish to occur per element, then return the value of the local state after processing is completed. The third delegate (the localFinally argument) is defined as Action<TLocal>.  This delegate is passed our local state after it’s been processed by all of the elements this thread will handle.  This is where you can merge your final results together.  This may require synchronization, but now, instead of synchronizing once per element (potentially millions of times), you’ll only have to synchronize once per thread, which is an ideal situation. Now that I’ve explained how this works, lets look at the code: // Safe, and fast! double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach( collection, // First, we provide a local state initialization delegate. () => double.MaxValue, // Next, we supply the body, which takes the original item, loop state, // and local state, and returns a new local state (item, loopState, localState) => { double value = item.PerformComputation(); return System.Math.Min(localState, value); }, // Finally, we provide an Action<TLocal>, to "merge" results together localState => { // This requires locking, but it's only once per used thread lock(syncObj) min = System.Math.Min(min, localState); } ); Although this is a bit more complicated than the previous version, it is now both thread-safe, and has minimal locking.  This same approach can be used by Parallel.For, although now, it’s Parallel.For<TLocal>.  When working with Parallel.For<TLocal>, you use the same triplet of delegates, with the same purpose and results. Also, many times, you can completely avoid locking by using a method of the Interlocked class to perform the final aggregation in an atomic operation.  The MSDN example demonstrating this same technique using Parallel.For uses the Interlocked class instead of a lock, since they are doing a sum operation on a long variable, which is possible via Interlocked.Add. By taking advantage of local state, we can use the Parallel class methods to parallelize algorithms such as aggregation, which, at first, may seem like poor candidates for parallelization.  Doing so requires careful consideration, and often requires a slight redesign of the algorithm, but the performance gains can be significant if handled in a way to avoid excessive synchronization.

    Read the article

  • CodePlex Daily Summary for Tuesday, March 09, 2010

    CodePlex Daily Summary for Tuesday, March 09, 2010New Projects.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: .NET Excel Wrapper encapsulates the complexity of working with multiple Excel objects giving you one central point to do all your processing. It h...Advancement Voyage: Advancement Voyage is a high quality RPG experience that provides all the advancement and voyaging that a player could hope for.ASP.Net Routing configuration: ASP.NET routing configuration enables you to configure the routes in the web.config bbinjest: bbinjestBuildUp: BuildUp is a build number increment tool for C# .net projects. It is run as a post build step in Visual Studio.Controlled Vocabulary: This project is devoted to creating tools to assist with Controlling Vocabulary in communication. The initial delivery is an Outlook 2010 Add-in w...CycleList: A replacement for the WPF ListBox Control. Displays only a single item and allows the user to change the selected item by clicking on it once. Very...Forensic Suite: A suite of security softwareFREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat is a live chat solution and its DotNetNuke Chat Module helps to embed a live chat room into website with DotNetNuke(DNN) integrated ...HouseFly experimental controls: Experimental controls for use in HouseFly.ICatalogAll: junkMidiStylus: MidiStylus allows you to control MIDI-enabled hardware or software using your pressure-sensitive pen tablet. The program maps the X position, Y po...myTunes: Search for your favorite artistsNColony - Pluggable Socialism?: NColony will maximize the use of MEF to create flexible application architectures through a suite of plug-in solutions. If MEF is an outlet for plu...Network Monitor Decryption Expert: NmDecrypt is a Network Monitor Expert which when given a trace with encrypted frames, a security certificate, and a passkey will create a new trace...occulo: occulo is a free steganography program, meant to embed files within images with optional encrytion. Open Ant: A implementation of a Open Source Ant which is created to show what is possible in the serious game AntMe! The First implementation of that ProjectProgramming Patterns by example: Design patterns provide solutions to common software design problems. This project will contain samples, written in c# and ruby, of each design pat...project4k: Developing bulk mail system storing email informationQuail - Selenium Remote Control Made Easy: Quail makes it easy for Quality Assurance departments write automated tests against web applications. Both HTML and Silverlight applications can b...RedBulb for XNA Framework: RedBulb is a collection of utility functions and classes that make writing games with XNA a lot easier. Key features: Console,GUI (Labels, Buttons,...RegExpress: RegExpress is a WPF application that combines interactive demos of regular expressions with slide content. This was designed for a user group prese...RemoveFolder: Small utility program to remove empty foldersScrumTFS: ScrumTFSSharePoint - Open internal link in new window list definition: A simple SharePoint list definition to render SharePoint internal links with the option to open them in a new window.SqlSiteMap4MVC: SqlSiteMapProvider for ASP.Net MVC.T Sina .NET Client: t.sina.com.cn api 新浪微博APITest-Lint-Extensions: Test Lint is a free Typemock VS 2010 Extension that finds common problems in your unit tests as you type them. this project will host extensions ...ThinkGearNET: ThinkGearNET is a library for easy usage of the Neurosky Mindset headset from .NET .Wiki to Maml: This project enables you to write wiki syntax and have it converted into MAML syntax for Sandcastle documentation projects.WPF Undo/Redo Framework: This project attempts to solve the age-old programmer problem of supporting unlimited undo/redo in an application, in an easily reusable manner. Th...WPFValidators: WPF Validators Validações de campos para WPFWSP Listener: The WSP listener is a windows service application which waits for new WSC and WSP files in a specific folder. If a new WSC and WSP file are added, ...New Releases.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: First Release: This is the first release which includes the main library release..NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: Updated Version: New Features:SetRangeValue using multidimensional array Print current worksheet Print all worksheets Format ranges background, color, alig...ArkSwitch: ArkSwitch v1.1.2: This release removes all memory reporting information, and is focused on stability.BattLineSvc: V2.1: - Fixed a bug where on system start-up, it would pop up a notification box to let you know the service started. Annoying! And fixed! - Fixed the ...BuildUp: BuildUp 1.0 Alpha 1: Use at your own risk!Not yet feature complete. Basic build incrementing and attribute overriding works. Still working on cascading build incremen...Controlled Vocabulary: 1.0.0.1: Initial Alpha Release. System Requirements Outlook 2010 .Net Framework 3.5 Installation 1. Close Outlook (Use Task Manager to ensure no running i...CycleList: CycleList: The binaries contain the .NET 3.5 DLL ONLY. Please download source for usage examples.FluentNHibernate.Search: 0.3 Beta: 0.3 Beta take the following changes : Mappings : - Field Mapping without specifying "Name" - Id Mapping without specifiying "Field" - Builtin Anal...FREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat DNN Chat Module: With FREE DotNetNuke Chat Module of 123 Flash Chat, webmaster will be assist to add a chat room into DotNetNuke instantly and help to attract more ...GameStore League Manager: League Manager 1.0 release 3: This release includes a full installer so that you can get your league running faster and generate interest quicker.iExporter - iTunes playlist exporting: iExporter gui v2.3.1.0 - console v1.2.1.0: Paypal donate! Solved a big bug for iExporter ( Gui & Console ) When a track isn't located under the main iTunes library, iExporter would crash! ...jQuery.cssLess: jQuery.cssLess 0.3: New - Removed the dependency from XRegExp - Added comment support (both CSS style and C style) - Optimised it for speed - Added speed test TOD...jQuery.cssLess: jQuery.cssLess 0.4: NEW - @import directive - preserving of comments in the resulting CSS - code refactoring - more class oriented approach TODO - implement operation...MapWindow GIS: MapWindow 6.0 msi (March 8): Rewrote the shapefile saving code in the indexed case so that it uses the shape indices rather than trying to create features. This should allow s...MidiStylus: MidiStylus 0.5.1: MidiStylus Beta 0.5.1 This release contains basic functionality for transmitting MIDI data based on X position, Y position, and pressure value rea...MiniTwitter: 1.09.1: MiniTwitter 1.09.1 更新内容 修正 URL に & が含まれている時に短縮 URL がおかしくなるバグを修正Mosaictor: first executable: .exe file of the app in its current state. Mind you that this will likely be highly unstable due to heaps of uncaught errors.MvcContrib a Codeplex Foundation project: T4MVC: T4MVC is a T4 template that generates strongly typed helpers for ASP.NET MVC. You can download it below, and check out the documention here.N2 CMS: 2.0 beta: Major Changes ASP.NET MVC 2 templates Refreshed management UI LINQ support Performance improvements Auto image resize Upgrade Make a comp...NotesForGallery: ASP.NET AJAX Photo Gallery Control: NotesForGallery 2.0: PresentationNotesForGallery is an open source control on top of the Microsoft ASP.NET AJAX framework for easy displaying image galleries in the as...occulo: occulo 0.1 binaries: Windows binaries. Tested on Windows XP SP2.occulo: occulo 0.1 source: Initial source release.Open NFe: DANFE 1.9.5: Ajuste de layout e correção dos campos de ISS.patterns & practices Web Client Developer Guidance: Web Application Guidance -- March 8th Drop: This iteration we focused on documentation and bug fixes.PoshConsole: PoshConsole 2.0 Beta: With this release, I am refocusing PoshConsole... It will be a PowerShell 2 host, without support for PowerShell 1.0 I have used some of the new P...Quick Performance Monitor: QPerfmon 1.1: Now you can specify different updating frequencies.RedBulb for XNA Framework: Cipher Puzzle (Sample) Creators Club Package: RedBulb Sample Game: Cipher Puzzle http://bayimg.com/image/galgfaacb.jpgRedBulb for XNA Framework: RedBulbStarter (Base Code): This is the code you need to start with. Quick Start Guide: Download the latest version of RedBulb: http://redbulb.codeplex.com/releases/view/415...RoTwee: RoTwee 7.0.0.0 (Alpha): Now this version is under improvement of code structure and may be buggy. However movement of rotation is quite good in this version thanks to clea...SCSI Interface for Multimedia and Block Devices: Release 9 - Improvements and Bug Fixes: Changes I have made in this version: Fixed INQUIRY command timeout problem Lowered ISOBurn's memory usage significantly by not explicitly setting...SharePoint - Open internal link in new window list definition: Open link in new window list definition: First release, with english and italian localization supportSharePoint Outlook Connector: Version 1.2.3.2: Few bug fixing and some ui enhancementsSysI: sysi, release build: Better than ever -- now allows for escalation to adminThe Silverlight Hyper Video Player [http://slhvp.com]: Beta 1: Beta (1.1) The code is ready for intensive testing. I will update the code at least every second day until we are ready to freeze for V1, which wi...Truecrafting: Truecrafting 0.52: fixed several trinkets that broke just before i released 0.51, sorry fixed water elemental not doing anything while summoned if not using glyph o...Truecrafting: Truecrafting 0.53: fixed mp5 calculations when gear contained mp5 and made the formulas more efficient no need to rebuild profiles with this release if placed in th...umbracoSamplePackageCreator (beta): Working Beta: For Visual Studio 2008 creating packages for Umbraco 4.0.3.VCC: Latest build, v2.1.30307.0: Automatic drop of latest buildVCC: Latest build, v2.1.30308.0: Automatic drop of latest buildVOB2MKV: vob2mkv-1.0.3: This is a maintenance update of the VOB2MKV utility. The MKVMUX filter now describes the cluster locations using a separate SeekHead element at th...WPFValidators: WPFValidators 1.0 Beta: Primeira versão do componente ainda em Beta, pode ser utilizada em produção pois esta funcionando bem e as futuras alterações não sofreram muito im...WSDLGenerator: WSDLGenerator 0.0.06: - Added option to generate SharePoint compatible *disco.aspx file. - Changed commandline optionsWSP Listener: WSP Listener version 1.0.0.0: First version of the WSP Listener includes: Easy cop[y paste installation of WSP solutions Extended logging E-mail when installation is finish...Yet another pali text reader: Pali Text Reader App v1.1: new features/updates + search history is now a tab + format codes in dictionary + add/edit terms in the dictionary + pali keyboard inserts symbols...Most Popular ProjectsMetaSharpi4o - Indexed LINQResExBraintree Client LibraryGeek's LibrarySharepoint Feature ManagerConfiguration ManagementOragon Architecture SqlBuilderTerrain Independant Navigating Automaton v2.0WBFS ManagerMost Active ProjectsUmbraco CMSRawrSDS: Scientific DataSet library and toolsBlogEngine.NETjQuery Library for SharePoint Web ServicesFasterflect - A Fast and Simple Reflection APIFarseer Physics Enginepatterns & practices – Enterprise LibraryTeam FTW - Software ProjectIonics Isapi Rewrite Filter

    Read the article

  • Please guide this self-taught Web Developer.

    - by ChickenPuke
    One of the major regrets in life is that I didn't do something with my introversion. I didn't manage to get past the first year of college because of that. I have chosen the path where there are no video games and other time sinks, all I have is the internet to quench my thirst of learning the ins and outs of the field of Web Developing/Designing. Though currently, I'm taking a Web Design Associate course at one of the best Computer Arts and this is the last month of the class. Even though I'm still a sapling, I love this field so much. So basically, At school I'm learning web design while at home I'm teaching myself web-developing. First thing first, returning to college seems impossible at the moment because of some financial problems. I'm pretty comfortable with CSS and HTML and I'm into PHP/MySQL at the moment. Could you please provide me a web-development Curriculum to follow. And do I need to learn about the theories behind? And I think I'm still young(I'm 18 at the time of writing). Is it a good thing or bad thing for choosing this path? I'm glad with my decision but in all honesty, I'm worrying about my future and employment because I'm an undergrad, coming from a country where companies are degree b!tches, it saddens me so. Thank you. (My questions are the bold parts. )

    Read the article

  • CodePlex Daily Summary for Friday, March 05, 2010

    CodePlex Daily Summary for Friday, March 05, 2010New Projects.svn Folders Cleanup Tool: dotSVN Cleanup is a tool that allows you to remove the .svn folders . Just click, browse, say abracadabra ...and the magic is done. Have fun with...Accord: The Accord framework creates an easy we to integrate any Dependency Injection framework into your project, while abstracting the details of your im...Asp.net MVC Lab: Try asp.net mvc outASP.NET Themes management with Webforms: The provided source is an example for how to use themes in ASP.NET Webforms. this source is the "up to date" support for the article I wroteB&W Port Scanner: B&W Port Scanner (formerly Net Inspector) is a fast TCP Port scan utility. The main idea is support of customizable operations to be performed f...BizTalk SWAT - Simple Web Activity Tracker: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. Some of th...C# Linear Hash Table: A C# dictionary-like implementation of a linear hash table. It is more memory efficiant than the .NET dictionary, and also almost as fast. NOTE: On...DBF Import Export Wizard: DBF Import Export Wizard is a tool for anyone needing to import DBF files into SQL Server or to export SQL Server tables to a DBF file. This proje...Domain as XML - Driven Development: Visual Studio Code Samples: Domain as XML - Driven Development: Visual Studio Code SamplesEasyDownload: This application allows to manage downloads handling an stack of files and several useful configurationsEos2: .FlightTickets: This application allows to buy flight ticketsFotofly PhotoViewer: A Silverlight control that uses the Fotofly metadata library to show the people in a photo (using Windows Live Photo Gallery People metadata) and a...Fujiy source code: Source code examplesGameSet: This application allows to play games with distributed users.Injectivity (Dependency Injection): Injectivity is a dependency injection framework (written in C#) with a strong focus on the ease of configuration and performance. Having been writt...Inventory: Keep track of inputs, materias and salesLoanTin.Com Source Code: LoanTin.Com - a Social Networking Website as same as Tumblr.com, based on source code of Loantiner Project, allow anyone can share anything to anyo...mysln: my solutions.NumTextBox: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 修改自:http://www.codeproject.com/KB/edit/num...Quick Performance Monitor: This small utility helps to monitor performance counters without using the full blown perfmon tool from Windows. It supports a number of command li...Runo: Runo ResearchSales: This application allows to manage a hardware storeScrewWiki Form Auth Provider: Enables your ASP.NET site to use Forms Authentication to integrate with your ScrewWiki. User management is performed on a parent site, and cookie i...SDS: Scientific DataSet library and tools: The SDS library makes it easy for .Net developers to read, write and share scalars, vectors, matrices and multidimensional grids which are very com...ShapeSweeper: Minesweeper-like game for the Zune HD. Each hidden object has three properties to discover--location, color, and shape--and all three must be corre...SilverlightExcel: an Excel file viewer in Silverlight 4: SilverlightExcel is a Silverlight application allowing you to open and view Excel files and also create graphs.sPWadmin: pwAdmin is an Web Interface based on JSP that uses the PW-Java API to control an PW-Server.Video Player control in Silverlight: A control for playing video in Silverlight 4 with chapters on timeline control. This player will be easily skinnable and customizable. More Featur...XNA Light Pre Pass Renderer: A demo/sample that shows how to write a light pre pass renderer in XNA.Zimms: Collaboration Site for friends, a code depot, and scratch padNew Releases.svn Folders Cleanup Tool: dotSVN Cleanup Tool: dotSVN Cleanup Tool executableAccord: Alpha: Initial build of the Accord framework.AcPrac: AcPrac Ver 0.1: The first version of AcPrac. It is not fully functional, but rather a version to get the bugs out. Please report all bugs.ASP.NET: ASP.NET Browser Definition Files: This download contains: ASP.NET 4 Browser Definition Files -- You can use the new ASP.NET 4 browser definition files with earlier versions of ASP....B&W Port Scanner: Black`n`White Port Scanner 1.0: B&W Port Scanner 1.0 Final Release Date: 03.03.2010 Black`n`WhiteBizTalk SWAT - Simple Web Activity Tracker: BizTalk SWAT: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. It uses th...BTP Tools: CSB+CUV+HCSB dict files 2010-03-04: 5. is now missing a space between the Strong’s number and the Count: >CSB Translation: 圣所 7, 至圣所G39+G394 it should be: CSB Translation: 圣所 7, 至圣所G...C# Linear Hash Table: Linear Hash Table: First working version of the Linear Hash Table.Cassiopeia: WinTools 1.0 beta: First ReleaseComposure: Caliburn-44007-trunk-vs2010.net40: This is a very simple conversion of the Caliburn trunk (rev 44007) for use in Visual Studio 2010 RC1 built against .NET40. Because the conversion w...Cover Creator: CoverCreator 1.3.0: English and Polish version. Functionality to add image to the front page. Load / save covers.DBF Import Export Wizard: DBF Import Export Wizard Source Code: Version 0.1.0.3DBF Import Export Wizard: DBF_Import_Export_Wizard Setup 0.1.0.3: Zip file contains Setup.exeESB Toolkit Extensions: Tellago BizTalk ESB 2.0 Toolkit Extensions v0.2: Windows Installer file that installs Library on a BizTalk ESB 2.0 system. This Install automatically configures the esb.config to use the new compo...Fotofly PhotoViewer: Fotofly Photoview v0.1: The first public release. Based on a Silverlight application I have been using for over a year at www.tassography.com. This version uses Fotofly v0...HPC with GPUs applied to CG: Cuda Soft Bodies simulation: Cuda src for soft bodiesHPC with GPUs applied to CG: Full Soft Bodies src: full src code for soft bodies simulationInjectivity (Dependency Injection): 2.8.166.2135: Release 2.8.166.2135 of the Injectivity dependency injection framework.Line Counter: 1.5 (Code Outline Preview): This version contains preview of the code outline feature, you can now view C# code outline within Line Counter. Note that the code outline now onl...Micajah Mindtouch Deki Wiki Copier: MicajahWikiCopier: You should use the following line arguments: WikiCopier.exe "http://oldwikiwithdata.wik.is/@api/deki" "login" "password" "http://newwiki.somename.l...ncontrols: Alpha 0.4.0.1: Added some example on the Console Project.NumTextBox: NumTextBox初始版本: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 此为初始版本PSCodeplex: PS CodePlex 0.2: PS CodePlex 0.2 has some breaking changes to the parameters. A few of the parameters are renamed and a few are made as switch parameters. Add-Rele...Quick Performance Monitor: QPerfMon First release - Version 1.0.0: The first release of the utility.RapidWebDev - .NET Enterprise Software Development Infrastructure: ProductManagement Quick Sample 0.2: This is a sample product management application to demonstrate how to develop enterprise software in RapidWebDev. The glossary of the system are ro...ScrewWiki Form Auth Provider: ScrewWiki Forms Authentication: Initial ReleaseSee.Sharper: See.Sharper.Docs-1.10.3.4: HTML documentation (including Doxygen project)See.Sharper: See.Sharper-1.10.3.4: Solution (Source files, debug and release binaries)Solar.Generic: Solar.Generic 0.8.0.0 Beta (Revised, Renamed): Solar.Generic 0.8.0.0 (Revised & Renamed) Renamed project from Solar.Commons to Solar.Generic. Project solution file is now in format of Visual ...Solar.Security: Solar.Security 1.1.0.0: Performed several major refactorings of code base. Stripped In-Memory implementation of IConfiguration interface of transactional behavior due to...sPWadmin: pwAdmin v0.7: -Star System Simulator: Star System Simulator 2.3: Changes in this release: Fixed several localisation issues. Features in this release: Model star systems in 3D. Euler-Cromer method. Improved...SysI: sysi, stable and ready: This time for sure.TheWhiteAmbit: TheWhiteAmbit - Demo: Two little demos demonstrating: - fast realtime raytracing - generating bent normals for shading (CUDA capable GPU needed = nVidia GeForce >8x00)VsTortoise - a TortoiseSVN add-in for Microsoft Visual Studio: VsTortoise Build 22 Beta: Build 22 (beta) New: Visual Studio 2010 RC support (VsTortoise for Visual Studio 2010 RC screenshots) New: VsTortoise integrates in to Solution E...WinMergeFS: WinMergeFS 0.1.42128alpha: WinMergeFS provides AuFS functionality for windows. With WinMergeFS users can mount multiple directories into a virtual drive. Plugin based root se...WSDLGenerator: WSDLGenerator 0.0.0.2: - Bugs fixed - Code refactored - Added support for custom typesXNA Light Pre Pass Renderer: LightPrePassRendererXNA: Zipped source code for the light pre pass renderer made with XNA.Most Popular ProjectsMetaSharpRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)LiveUpload to FacebookASP.NETMicrosoft SQL Server Community & SamplesMost Active ProjectsUmbraco CMSRawrBlogEngine.NETSDS: Scientific DataSet library and toolsMapWindow GISpatterns & practices – Enterprise LibraryjQuery Library for SharePoint Web ServicesIonics Isapi Rewrite FilterMDT Web FrontEndDiffPlex - a .NET Diff Generator

    Read the article

  • Ten - oh, wait, eleven - Eleven things you should know about the ASP.NET Fall 2012 Update

    - by Jon Galloway
    Today, just a little over two months after the big ASP.NET 4.5 / ASP.NET MVC 4 / ASP.NET Web API / Visual Studio 2012 / Web Matrix 2 release, the first preview of the ASP.NET Fall 2012 Update is out. Here's what you need to know: There are no new framework bits in this release - there's no change or update to ASP.NET Core, ASP.NET MVC or Web Forms features. This means that you can start using it without any updates to your server, upgrade concerns, etc. This update is really an update to the project templates and Visual Studio tooling, conceptually similar to the ASP.NET MVC 3 Tools Update. It's a relatively lightweight install. It's a 41MB download. I've installed it many times and usually takes 5-7 minutes; it's never required a reboot. It adds some new project templates to ASP.NET MVC: Facebook Application and Single Page Application templates. It adds a lot of cool enhancements to ASP.NET Web API. It adds some tooling that makes it easy to take advantage of features like SignalR, Friendly URLs, and Windows Azure Authentication. Most of the new features are installed via NuGet packages. Since ASP.NET is open source, nightly NuGet packages are available, and the roadmap is published, most of this has really been publicly available for a while. The official name of this drop is the ASP.NET Fall 2012 Update BUILD Prerelease. Please do not attempt to say that ten times fast. While the EULA doesn't prohibit it, it WILL legally change your first name to Scott. As with all new releases, you can find out everything you need to know about the Fall Update at http://asp.net/vnext (especially the release notes!) I'm going to be showing all of this off, assisted by special guest code monkey Scott Hanselman, this Friday at BUILD: Bleeding edge ASP.NET: See what is next for MVC, Web API, SignalR and more… (and I've heard it will be livestreamed). Let's look at some of those things in more detail. No new bits ASP.NET 4.5, MVC 4 and Web API have a lot of great core features. I see the goal of this update release as making it easier to put those features to use to solve some useful scenarios by taking advantage of NuGet packages and template code. If you create a new ASP.NET MVC application using one of the new templates, you'll see that it's using the ASP.NET MVC 4 RTM NuGet package (4.0.20710.0): This means you can install and use the Fall Update without any impact on your existing projects and no worries about upgrading or compatibility. New Facebook Application Template ASP.NET MVC 4 (and ASP.NET 4.5 Web Forms) included the ability to authenticate your users via OAuth and OpenID, so you could let users log in to your site using a Facebook account. One of the new changes in the Fall Update is a new template that makes it really easy to create full Facebook applications. You could create Facebook application in ASP.NET already, you'd just need to go through a few steps: Search around to find a good Facebook NuGet package, like the Facebook C# SDK (written by my friend Nathan Totten and some other Facebook SDK brainiacs). Read the Facebook developer documentation to figure out how to authenticate and integrate with them. Write some code, debug it and repeat until you got something working. Get started with the application you'd originally wanted to write. What this template does for you: eliminate steps 1-3. Erik Porter, Nathan and some other experts built out the Facebook Application template so it automatically pulls in and configures the Facebook NuGet package and makes it really easy to take advantage of it in an ASP.NET MVC application. One great example is the the way you access a Facebook user's information. Take a look at the following code in a File / New / MVC / Facebook Application site. First, the Home Controller Index action: [FacebookAuthorize(Permissions = "email")] public ActionResult Index(MyAppUser user, FacebookObjectList<MyAppUserFriend> userFriends) { ViewBag.Message = "Modify this template to jump-start your Facebook application using ASP.NET MVC."; ViewBag.User = user; ViewBag.Friends = userFriends.Take(5); return View(); } First, notice that there's a FacebookAuthorize attribute which requires the user is authenticated via Facebook and requires permissions to access their e-mail address. It binds to two things: a custom MyAppUser object and a list of friends. Let's look at the MyAppUser code: using Microsoft.AspNet.Mvc.Facebook.Attributes; using Microsoft.AspNet.Mvc.Facebook.Models; // Add any fields you want to be saved for each user and specify the field name in the JSON coming back from Facebook // https://developers.facebook.com/docs/reference/api/user/ namespace MvcApplication3.Models { public class MyAppUser : FacebookUser { public string Name { get; set; } [FacebookField(FieldName = "picture", JsonField = "picture.data.url")] public string PictureUrl { get; set; } public string Email { get; set; } } } You can add in other custom fields if you want, but you can also just bind to a FacebookUser and it will automatically pull in the available fields. You can even just bind directly to a FacebookUser and check for what's available in debug mode, which makes it really easy to explore. For more information and some walkthroughs on creating Facebook applications, see: Deploying your first Facebook App on Azure using ASP.NET MVC Facebook Template (Yao Huang Lin) Facebook Application Template Tutorial (Erik Porter) Single Page Application template Early releases of ASP.NET MVC 4 included a Single Page Application template, but it was removed for the official release. There was a lot of interest in it, but it was kind of complex, as it handled features for things like data management. The new Single Page Application template that ships with the Fall Update is more lightweight. It uses Knockout.js on the client and ASP.NET Web API on the server, and it includes a sample application that shows how they all work together. I think the real benefit of this application is that it shows a good pattern for using ASP.NET Web API and Knockout.js. For instance, it's easy to end up with a mess of JavaScript when you're building out a client-side application. This template uses three separate JavaScript files (delivered via a Bundle, of course): todoList.js - this is where the main client-side logic lives todoList.dataAccess.js - this defines how the client-side application interacts with the back-end services todoList.bindings.js - this is where you set up events and overrides for the Knockout bindings - for instance, hooking up jQuery validation and defining some client-side events This is a fun one to play with, because you can just create a new Single Page Application and hit F5. Quick, easy install (with one gotcha) One of the cool engineering changes for this release is a big update to the installer to make it more lightweight and efficient. I've been running nightly builds of this for a few weeks to prep for my BUILD demos, and the install has been really quick and easy to use. The install takes about 5 minutes, has never required a reboot for me, and the uninstall is just as simple. There's one gotcha, though. In this preview release, you may hit an issue that will require you to uninstall and re-install the NuGet VSIX package. The problem comes up when you create a new MVC application and see this dialog: The solution, as explained in the release notes, is to uninstall and re-install the NuGet VSIX package: Start Visual Studio 2012 as an Administrator Go to Tools->Extensions and Updates and uninstall NuGet. Close Visual Studio Navigate to the ASP.NET Fall 2012 Update installation folder: For Visual Studio 2012: Program Files\Microsoft ASP.NET\ASP.NET Web Stack\Visual Studio 2012 For Visual Studio 2012 Express for Web: Program Files\Microsoft ASP.NET\ASP.NET Web Stack\Visual Studio Express 2012 for Web Double click on the NuGet.Tools.vsix to reinstall NuGet This took me under a minute to do, and I was up and running. ASP.NET Web API Update Extravaganza! Uh, the Web API team is out of hand. They added a ton of new stuff: OData support, Tracing, and API Help Page generation. OData support Some people like OData. Some people start twitching when you mention it. If you're in the first group, this is for you. You can add a [Queryable] attribute to an API that returns an IQueryable<Whatever> and you get OData query support from your clients. Then, without any extra changes to your client or server code, your clients can send filters like this: /Suppliers?$filter=Name eq ‘Microsoft’ For more information about OData support in ASP.NET Web API, see Alex James' mega-post about it: OData support in ASP.NET Web API ASP.NET Web API Tracing Tracing makes it really easy to leverage the .NET Tracing system from within your ASP.NET Web API's. If you look at the \App_Start\WebApiConfig.cs file in new ASP.NET Web API project, you'll see a call to TraceConfig.Register(config). That calls into some code in the new \App_Start\TraceConfig.cs file: public static void Register(HttpConfiguration configuration) { if (configuration == null) { throw new ArgumentNullException("configuration"); } SystemDiagnosticsTraceWriter traceWriter = new SystemDiagnosticsTraceWriter() { MinimumLevel = TraceLevel.Info, IsVerbose = false }; configuration.Services.Replace(typeof(ITraceWriter), traceWriter); } As you can see, this is using the standard trace system, so you can extend it to any other trace listeners you'd like. To see how it works with the built in diagnostics trace writer, just run the application call some API's, and look at the Visual Studio Output window: iisexpress.exe Information: 0 : Request, Method=GET, Url=http://localhost:11147/api/Values, Message='http://localhost:11147/api/Values' iisexpress.exe Information: 0 : Message='Values', Operation=DefaultHttpControllerSelector.SelectController iisexpress.exe Information: 0 : Message='WebAPI.Controllers.ValuesController', Operation=DefaultHttpControllerActivator.Create iisexpress.exe Information: 0 : Message='WebAPI.Controllers.ValuesController', Operation=HttpControllerDescriptor.CreateController iisexpress.exe Information: 0 : Message='Selected action 'Get()'', Operation=ApiControllerActionSelector.SelectAction iisexpress.exe Information: 0 : Operation=HttpActionBinding.ExecuteBindingAsync iisexpress.exe Information: 0 : Operation=QueryableAttribute.ActionExecuting iisexpress.exe Information: 0 : Message='Action returned 'System.String[]'', Operation=ReflectedHttpActionDescriptor.ExecuteAsync iisexpress.exe Information: 0 : Message='Will use same 'JsonMediaTypeFormatter' formatter', Operation=JsonMediaTypeFormatter.GetPerRequestFormatterInstance iisexpress.exe Information: 0 : Message='Selected formatter='JsonMediaTypeFormatter', content-type='application/json; charset=utf-8'', Operation=DefaultContentNegotiator.Negotiate iisexpress.exe Information: 0 : Operation=ApiControllerActionInvoker.InvokeActionAsync, Status=200 (OK) iisexpress.exe Information: 0 : Operation=QueryableAttribute.ActionExecuted, Status=200 (OK) iisexpress.exe Information: 0 : Operation=ValuesController.ExecuteAsync, Status=200 (OK) iisexpress.exe Information: 0 : Response, Status=200 (OK), Method=GET, Url=http://localhost:11147/api/Values, Message='Content-type='application/json; charset=utf-8', content-length=unknown' iisexpress.exe Information: 0 : Operation=JsonMediaTypeFormatter.WriteToStreamAsync iisexpress.exe Information: 0 : Operation=ValuesController.Dispose API Help Page When you create a new ASP.NET Web API project, you'll see an API link in the header: Clicking the API link shows generated help documentation for your ASP.NET Web API controllers: And clicking on any of those APIs shows specific information: What's great is that this information is dynamically generated, so if you add your own new APIs it will automatically show useful and up to date help. This system is also completely extensible, so you can generate documentation in other formats or customize the HTML help as much as you'd like. The Help generation code is all included in an ASP.NET MVC Area: SignalR SignalR is a really slick open source project that was started by some ASP.NET team members in their spare time to add real-time communications capabilities to ASP.NET - and .NET applications in general. It allows you to handle long running communications channels between your server and multiple connected clients using the best communications channel they can both support - websockets if available, falling back all the way to old technologies like long polling if necessary for old browsers. SignalR remains an open source project, but now it's being included in ASP.NET (also open source, hooray!). That means there's real, official ASP.NET engineering work being put into SignalR, and it's even easier to use in an ASP.NET application. Now in any ASP.NET project type, you can right-click / Add / New Item... SignalR Hub or Persistent Connection. And much more... There's quite a bit more. You can find more info at http://asp.net/vnext, and we'll be adding more content as fast as we can. Watch my BUILD talk to see as I demonstrate these and other features in the ASP.NET Fall 2012 Update, as well as some other even futurey-er stuff!

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • SQLAuthority Book Review – DBA Survivor: Become a Rock Star DBA

    - by pinaldave
    DBA Survivor: Become a Rock Star DBA – Thomas LaRock Link to Amazon Link to Flipkart First of all, I thank all my readers when I wrote that I could not get this book in any local book stores, because they offered me to send a copy of this good book. A very special mention goes to Sripada and Jayesh for they gave so much effort in finding my home address and sending me the hard copy. Before, I did not have the copy of the book, but now I have two of it already! It surprises me how my readers were able to find my home address, which I have not publicly shared. Quick Review: This is indeed a one easy-to-read and fun book. We all work day and night with technology yet we should not forget to show our love and care for our family at home. For our souls that starve for peace and guidance, this one book is the “it” book for all the technology enthusiasts. Though this book was specifically written for DBAs, the reach is not limited to DBAs only because the lessons incorporated in it actually applies to all. This is one of the most motivating technical books I have read. Detailed Review: Let us go over a few questions first: Who wants to be as famous as rockstars in the field of Database Administration? How can one learn what it takes to become a top notch software developer? If you are a beginner in your field, how will you go to next level? Your boss may be very kind or like Dilbert’s Boss, what will you do? How do you keep growing when Eco-system around you does not support you? You are almost at top but there is someone else at the TOP, what do you do and how do you avoid office politics? As a database developer what should be your basic responsibility? and many more… I was able to completely read book in one sitting and I loved it. Before I continue with my opinion, I want to echo the opinion of Kevin Kline who has written the Forward of the book. He has truly suggested that “You hold in your hands a collection of insights and wisdom on the topic of database administration gained through many years of hard-won experience, long nights of study, and direct mentorship under some of the industry’s most talented database professionals and information technology (IT) experts.” Today, IT field is getting bigger and better, while talking about terabytes of the database becomes “more” normal every single day. The gods and demigods of database professionals are taking care of these large scale databases and are carefully maintaining them. In this world, there are only a few beginnings on the first step. There are many experts in different technology fields who are asked to address the issues with databases. There is YOU and ME, who is just new to this work. So we ask ourselves WHERE to begin and HOW to begin. We adore and follow the religion of our rockstars, but oftentimes we really have no idea about their background and their struggles. Every rockstar has his success story which needs to be digested before learning his tricks and tips. This book starts with the same note and teaches the two most important lessons for anybody who wants to be a DBA Rockstar –  to focus on their single goal of learning and to excel the technology. The story starts with three simple guidelines – Get Prepared, Get Trained, Get Certified. Once a person learns the skills, and then, it would be about time that he needs to enrich or to improve those skills you have learned. I am sure that the right opportunity will come finding themselves and they will not have to go run behind it. However, the real challenge for any person is the first day or first week. A new employee, no matter how much experienced he is, sometimes has no clue about what should one do at new job. Chapter 2 and chapter 3 precisely talk about what one should do as soon as the new job begins. It is also written with keeping the fact in focus that each job can be very much different but there are few infrastructure setups and programming concepts are the same. Learning basics of database was really interesting. I like to focus on the roots of any technology. It is important to understand the structure of the database before suggesting what indexes needs to be created, the same way this book covers the most essential knowledge one must learn by most database developers. I think the title of the fourth chapter is my favorite sentence in this book. I can see that I will be saying this again and again in the future – “A Development Server Is a Production Server to a Developer“. I have worked in the software industry for almost 8 years now and I have seen so many developers sitting on their chairs and waiting for instructions from their lead about how to improve the code or what to do the next. When I talk to them, I suggest that the experiment with their server and try various techniques. I think they all should understand that for them, a development server is their production server and needs to pay proper attention to the code from the beginning. There should be NO any inappropriate code from the beginning. One has to fully focus and give their best, if they are not sure they should ask but should do something and stay active. Chapter 5 and 6 talks about two essential skills for any developer and database administration – what are the ethics of developers when they are working with production server and how to support software which is running on the production server. I have met many people who know the theory by heart but when put in front of keyboard they do not know where to start. The first thing they do opening the browser and searching online, instead of opening SQL Server Management Studio. This can very well happen to anybody who is experienced as well. Chapter 5 and 6 addresses that situation as well includes the handy scripts which can solve almost all the basic trouble shooting issues. “Where’s the Buffet?” By far, this is the best chapter in this book. If you have ever met me, you would know that I love food. I think after reading this chapter, I felt Thomas has written this just keeping me in mind. I think there will be many other people who feel the same way, too. Even my wife who read this chapter thought this was specifically written for me. I will not talk any more about this chapter as this is one must read chapter. And of course this is about real ‘FOOD‘. I am an SQL Server Trainer and Consultant and I totally agree with the point made in the chapter 8 of this book. Yes, it says here that what is necessary to train employees and people. Millions of dollars worth the labor is continuously done in the world which has faults and incorrect. Once something goes wrong, very expensive consultant comes in and fixes the problem. This whole cycle which can be stopped and improved if proper training is done. There is plenty of free trainings available as well, if one cannot afford paid training. “Connect. Learn. Share” – I think this is a great summary and bird’s eye view of this book. Networking is the key. Everything which is discussed in this book can be taken to next level if one properly uses this tips and continuously grow with it. Connecting with others, helping learn each other and building the good knowledge sharing environment should be the goal of everyone. Before I end the review I want to share a real experience. I have personally met one DBA who has worked in a single department in a company for so long that when he was put in a different department in his company due to closing that department, he could not adjust and quit the job despite the same people and company around him. Adjusting in the new environment gets much tougher as one person gets more and more experienced. This book precisely addresses the same issue along with their solutions. I just cannot stop comparing the book with my personal journey. I found so many things which are coincidently in the book is written as how we developer and DBA think. I must express special thanks to Thomas for taking time in his personal life and write this book for us. This book is indeed a book for everybody who wants to grow healthy in the tough and competitive environment. Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Book Review, SQLAuthority News, SQLServer, T SQL, Technology

    Read the article

  • Passing multiple simple POST Values to ASP.NET Web API

    - by Rick Strahl
    A few weeks backs I posted a blog post  about what does and doesn't work with ASP.NET Web API when it comes to POSTing data to a Web API controller. One of the features that doesn't work out of the box - somewhat unexpectedly -  is the ability to map POST form variables to simple parameters of a Web API method. For example imagine you have this form and you want to post this data to a Web API end point like this via AJAX: <form> Name: <input type="name" name="name" value="Rick" /> Value: <input type="value" name="value" value="12" /> Entered: <input type="entered" name="entered" value="12/01/2011" /> <input type="button" id="btnSend" value="Send" /> </form> <script type="text/javascript"> $("#btnSend").click( function() { $.post("samples/PostMultipleSimpleValues?action=kazam", $("form").serialize(), function (result) { alert(result); }); }); </script> or you might do this more explicitly by creating a simple client map and specifying the POST values directly by hand:$.post("samples/PostMultipleSimpleValues?action=kazam", { name: "Rick", value: 1, entered: "12/01/2012" }, $("form").serialize(), function (result) { alert(result); }); On the wire this generates a simple POST request with Url Encoded values in the content:POST /AspNetWebApi/samples/PostMultipleSimpleValues?action=kazam HTTP/1.1 Host: localhost User-Agent: Mozilla/5.0 (Windows NT 6.2; WOW64; rv:15.0) Gecko/20100101 Firefox/15.0.1 Accept: application/json Connection: keep-alive Content-Type: application/x-www-form-urlencoded; charset=UTF-8 X-Requested-With: XMLHttpRequest Referer: http://localhost/AspNetWebApi/FormPostTest.html Content-Length: 41 Pragma: no-cache Cache-Control: no-cachename=Rick&value=12&entered=12%2F10%2F2011 Seems simple enough, right? We are basically posting 3 form variables and 1 query string value to the server. Unfortunately Web API can't handle request out of the box. If I create a method like this:[HttpPost] public string PostMultipleSimpleValues(string name, int value, DateTime entered, string action = null) { return string.Format("Name: {0}, Value: {1}, Date: {2}, Action: {3}", name, value, entered, action); }You'll find that you get an HTTP 404 error and { "Message": "No HTTP resource was found that matches the request URI…"} Yes, it's possible to pass multiple POST parameters of course, but Web API expects you to use Model Binding for this - mapping the post parameters to a strongly typed .NET object, not to single parameters. Alternately you can also accept a FormDataCollection parameter on your API method to get a name value collection of all POSTed values. If you're using JSON only, using the dynamic JObject/JValue objects might also work. ModelBinding is fine in many use cases, but can quickly become overkill if you only need to pass a couple of simple parameters to many methods. Especially in applications with many, many AJAX callbacks the 'parameter mapping type' per method signature can lead to serious class pollution in a project very quickly. Simple POST variables are also commonly used in AJAX applications to pass data to the server, even in many complex public APIs. So this is not an uncommon use case, and - maybe more so a behavior that I would have expected Web API to support natively. The question "Why aren't my POST parameters mapping to Web API method parameters" is already a frequent one… So this is something that I think is fairly important, but unfortunately missing in the base Web API installation. Creating a Custom Parameter Binder Luckily Web API is greatly extensible and there's a way to create a custom Parameter Binding to provide this functionality! Although this solution took me a long while to find and then only with the help of some folks Microsoft (thanks Hong Mei!!!), it's not difficult to hook up in your own projects. It requires one small class and a GlobalConfiguration hookup. Web API parameter bindings allow you to intercept processing of individual parameters - they deal with mapping parameters to the signature as well as converting the parameters to the actual values that are returned. Here's the implementation of the SimplePostVariableParameterBinding class:public class SimplePostVariableParameterBinding : HttpParameterBinding { private const string MultipleBodyParameters = "MultipleBodyParameters"; public SimplePostVariableParameterBinding(HttpParameterDescriptor descriptor) : base(descriptor) { } /// <summary> /// Check for simple binding parameters in POST data. Bind POST /// data as well as query string data /// </summary> public override Task ExecuteBindingAsync(ModelMetadataProvider metadataProvider, HttpActionContext actionContext, CancellationToken cancellationToken) { // Body can only be read once, so read and cache it NameValueCollection col = TryReadBody(actionContext.Request); string stringValue = null; if (col != null) stringValue = col[Descriptor.ParameterName]; // try reading query string if we have no POST/PUT match if (stringValue == null) { var query = actionContext.Request.GetQueryNameValuePairs(); if (query != null) { var matches = query.Where(kv => kv.Key.ToLower() == Descriptor.ParameterName.ToLower()); if (matches.Count() > 0) stringValue = matches.First().Value; } } object value = StringToType(stringValue); // Set the binding result here SetValue(actionContext, value); // now, we can return a completed task with no result TaskCompletionSource<AsyncVoid> tcs = new TaskCompletionSource<AsyncVoid>(); tcs.SetResult(default(AsyncVoid)); return tcs.Task; } private object StringToType(string stringValue) { object value = null; if (stringValue == null) value = null; else if (Descriptor.ParameterType == typeof(string)) value = stringValue; else if (Descriptor.ParameterType == typeof(int)) value = int.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(Int32)) value = Int32.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(Int64)) value = Int64.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(decimal)) value = decimal.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(double)) value = double.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(DateTime)) value = DateTime.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(bool)) { value = false; if (stringValue == "true" || stringValue == "on" || stringValue == "1") value = true; } else value = stringValue; return value; } /// <summary> /// Read and cache the request body /// </summary> /// <param name="request"></param> /// <returns></returns> private NameValueCollection TryReadBody(HttpRequestMessage request) { object result = null; // try to read out of cache first if (!request.Properties.TryGetValue(MultipleBodyParameters, out result)) { // parsing the string like firstname=Hongmei&lastname=Ge result = request.Content.ReadAsFormDataAsync().Result; request.Properties.Add(MultipleBodyParameters, result); } return result as NameValueCollection; } private struct AsyncVoid { } }   The ExecuteBindingAsync method is fired for each parameter that is mapped and sent for conversion. This custom binding is fired only if the incoming parameter is a simple type (that gets defined later when I hook up the binding), so this binding never fires on complex types or if the first type is not a simple type. For the first parameter of a request the Binding first reads the request body into a NameValueCollection and caches that in the request.Properties collection. The request body can only be read once, so the first parameter request reads it and then caches it. Subsequent parameters then use the cached POST value collection. Once the form collection is available the value of the parameter is read, and the value is translated into the target type requested by the Descriptor. SetValue writes out the value to be mapped. Once you have the ParameterBinding in place, the binding has to be assigned. This is done along with all other Web API configuration tasks at application startup in global.asax's Application_Start:GlobalConfiguration.Configuration.ParameterBindingRules .Insert(0, (HttpParameterDescriptor descriptor) => { var supportedMethods = descriptor.ActionDescriptor.SupportedHttpMethods; // Only apply this binder on POST and PUT operations if (supportedMethods.Contains(HttpMethod.Post) || supportedMethods.Contains(HttpMethod.Put)) { var supportedTypes = new Type[] { typeof(string), typeof(int), typeof(decimal), typeof(double), typeof(bool), typeof(DateTime) }; if (supportedTypes.Where(typ => typ == descriptor.ParameterType).Count() > 0) return new SimplePostVariableParameterBinding(descriptor); } // let the default bindings do their work return null; });   The ParameterBindingRules.Insert method takes a delegate that checks which type of requests it should handle. The logic here checks whether the request is POST or PUT and whether the parameter type is a simple type that is supported. Web API calls this delegate once for each method signature it tries to map and the delegate returns null to indicate it's not handling this parameter, or it returns a new parameter binding instance - in this case the SimplePostVariableParameterBinding. Once the parameter binding and this hook up code is in place, you can now pass simple POST values to methods with simple parameters. The examples I showed above should now work in addition to the standard bindings. Summary Clearly this is not easy to discover. I spent quite a bit of time digging through the Web API source trying to figure this out on my own without much luck. It took Hong Mei at Micrsoft to provide a base example as I asked around so I can't take credit for this solution :-). But once you know where to look, Web API is brilliantly extensible to make it relatively easy to customize the parameter behavior. I'm very stoked that this got resolved  - in the last two months I've had two customers with projects that decided not to use Web API in AJAX heavy SPA applications because this POST variable mapping wasn't available. This might actually change their mind to still switch back and take advantage of the many great features in Web API. I too frequently use plain POST variables for communicating with server AJAX handlers and while I could have worked around this (with untyped JObject or the Form collection mostly), having proper POST to parameter mapping makes things much easier. I said this in my last post on POST data and say it again here: I think POST to method parameter mapping should have been shipped in the box with Web API, because without knowing about this limitation the expectation is that simple POST variables map to parameters just like query string values do. I hope Microsoft considers including this type of functionality natively in the next version of Web API natively or at least as a built-in HttpParameterBinding that can be just added. This is especially true, since this binding doesn't affect existing bindings. Resources SimplePostVariableParameterBinding Source on GitHub Global.asax hookup source Mapping URL Encoded Post Values in  ASP.NET Web API© Rick Strahl, West Wind Technologies, 2005-2012Posted in Web Api  AJAX   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Exam 70-480 Study Material: Programming in HTML5 with JavaScript and CSS3

    - by Stacy Vicknair
    Here’s a list of sources of information for the different elements that comprise the 70-480 exam: General Resources http://www.w3schools.com (As pointed out in David Pallmann’s blog some of this content is unverified, but it is a decent source of information. For more about when it isn’t decent, see http://www.w3fools.com ) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/ (A guy who did a lot of what I did already, sadly I found this halfway through finishing my resources list. This list is expertly put together so I would recommend checking it out.) http://davidpallmann.blogspot.com/2012/08/microsoft-certification-exam-70-480.html http://pluralsight.com/training/Courses (Yes, this isn’t free, but if you look at the course listing there is an entire section on HTML5, CSS3 and Javascript. You can always try the trial!)   Some of the links I put below will overlap with the other resources above, but I tried to find explanations that looked beneficial to me on links outside those already mentioned.   Test Breakdown Implement and Manipulate Document Structures and Objects (24%) Create the document structure. o This objective may include but is not limited to: structure the UI by using semantic markup, including for search engines and screen readers (Section, Article, Nav, Header, Footer, and Aside); create a layout container in HTML http://www.w3schools.com/html/html5_new_elements.asp   Write code that interacts with UI controls. o This objective may include but is not limited to: programmatically add and modify HTML elements; implement media controls; implement HTML5 canvas and SVG graphics http://www.w3schools.com/html/html5_canvas.asp http://www.w3schools.com/html/html5_svg.asp   Apply styling to HTML elements programmatically. o This objective may include but is not limited to: change the location of an element; apply a transform; show and hide elements   Implement HTML5 APIs. o This objective may include but is not limited to: implement storage APIs, AppCache API, and Geolocation API http://www.w3schools.com/html/html5_geolocation.asp http://www.w3schools.com/html/html5_webstorage.asp http://www.w3schools.com/html/html5_app_cache.asp   Establish the scope of objects and variables. o This objective may include but is not limited to: define the lifetime of variables; keep objects out of the global namespace; use the “this” keyword to reference an object that fired an event; scope variables locally and globally http://robertnyman.com/2008/10/09/explaining-javascript-scope-and-closures/ http://www.quirksmode.org/js/this.html   Create and implement objects and methods. o This objective may include but is not limited to: implement native objects; create custom objects and custom properties for native objects using prototypes and functions; inherit from an object; implement native methods and create custom methods http://www.javascriptkit.com/javatutors/object.shtml http://www.crockford.com/javascript/inheritance.html http://stackoverflow.com/questions/1635116/javascript-class-method-vs-class-prototype-method http://www.javascriptkit.com/javatutors/proto.shtml     Implement Program Flow (25%) Implement program flow. o This objective may include but is not limited to: iterate across collections and array items; manage program decisions by using switch statements, if/then, and operators; evaluate expressions http://www.javascriptkit.com/jsref/looping.shtml http://www.javascriptkit.com/javatutors/varshort.shtml http://www.javascriptkit.com/javatutors/switch.shtml   Raise and handle an event. o This objective may include but is not limited to: handle common events exposed by DOM (OnBlur, OnFocus, OnClick); declare and handle bubbled events; handle an event by using an anonymous function http://dev.w3.org/2006/webapi/DOM-Level-3-Events/html/DOM3-Events.html http://javascript.info/tutorial/bubbling-and-capturing   Implement exception handling. o This objective may include but is not limited to: set and respond to error codes; throw an exception; request for null checks; implement try-catch-finally blocks http://www.javascriptkit.com/javatutors/trycatch.shtml   Implement a callback. o This objective may include but is not limited to: receive messages from the HTML5 WebSocket API; use jQuery to make an AJAX call; wire up an event; implement a callback by using anonymous functions; handle the “this” pointer http://www.w3.org/TR/2011/WD-websockets-20110419/ http://www.html5rocks.com/en/tutorials/websockets/basics/ http://api.jquery.com/jQuery.ajax/   Create a web worker process. o This objective may include but is not limited to: start and stop a web worker; pass data to a web worker; configure timeouts and intervals on the web worker; register an event listener for the web worker; limitations of a web worker https://developer.mozilla.org/en-US/docs/DOM/Using_web_workers http://www.html5rocks.com/en/tutorials/workers/basics/   Access and Secure Data (26%) Validate user input by using HTML5 elements. o This objective may include but is not limited to: choose the appropriate controls based on requirements; implement HTML input types and content attributes (for example, required) to collect user input http://diveintohtml5.info/forms.html   Validate user input by using JavaScript. o This objective may include but is not limited to: evaluate a regular expression to validate the input format; validate that you are getting the right kind of data type by using built-in functions; prevent code injection http://www.regular-expressions.info/javascript.html http://msdn.microsoft.com/en-us/library/66ztdbe6(v=vs.94).aspx https://developer.mozilla.org/en-US/docs/JavaScript/Reference/Operators/typeof http://blog.stackoverflow.com/2008/06/safe-html-and-xss/ http://stackoverflow.com/questions/942011/how-to-prevent-javascript-injection-attacks-within-user-generated-html   Consume data. o This objective may include but is not limited to: consume JSON and XML data; retrieve data by using web services; load data or get data from other sources by using XMLHTTPRequest http://www.erichynds.com/jquery/working-with-xml-jquery-and-javascript/ http://www.webdevstuff.com/86/javascript-xmlhttprequest-object.html http://www.json.org/ http://stackoverflow.com/questions/4935632/how-to-parse-json-in-javascript   Serialize, deserialize, and transmit data. o This objective may include but is not limited to: binary data; text data (JSON, XML); implement the jQuery serialize method; Form.Submit; parse data; send data by using XMLHTTPRequest; sanitize input by using URI/form encoding http://api.jquery.com/serialize/ http://www.javascript-coder.com/javascript-form/javascript-form-submit.phtml http://stackoverflow.com/questions/327685/is-there-a-way-to-read-binary-data-into-javascript https://developer.mozilla.org/en-US/docs/JavaScript/Reference/Global_Objects/encodeURI     Use CSS3 in Applications (25%) Style HTML text properties. o This objective may include but is not limited to: apply styles to text appearance (color, bold, italics); apply styles to text font (WOFF and @font-face, size); apply styles to text alignment, spacing, and indentation; apply styles to text hyphenation; apply styles for a text drop shadow http://www.w3schools.com/css/css_text.asp http://www.w3schools.com/css/css_font.asp http://nicewebtype.com/notes/2009/10/30/how-to-use-css-font-face/ http://webdesign.about.com/od/beginningcss/p/aacss5text.htm http://www.w3.org/TR/css3-text/ http://www.css3.info/preview/box-shadow/   Style HTML box properties. o This objective may include but is not limited to: apply styles to alter appearance attributes (size, border and rounding border corners, outline, padding, margin); apply styles to alter graphic effects (transparency, opacity, background image, gradients, shadow, clipping); apply styles to establish and change an element’s position (static, relative, absolute, fixed) http://net.tutsplus.com/tutorials/html-css-techniques/10-css3-properties-you-need-to-be-familiar-with/ http://www.w3schools.com/css/css_image_transparency.asp http://www.w3schools.com/cssref/pr_background-image.asp http://ie.microsoft.com/testdrive/graphics/cssgradientbackgroundmaker/default.html http://www.w3.org/TR/CSS21/visufx.html http://www.barelyfitz.com/screencast/html-training/css/positioning/ http://davidwalsh.name/css-fixed-position   Create a flexible content layout. o This objective may include but is not limited to: implement a layout using a flexible box model; implement a layout using multi-column; implement a layout using position floating and exclusions; implement a layout using grid alignment; implement a layout using regions, grouping, and nesting http://www.html5rocks.com/en/tutorials/flexbox/quick/ http://www.css3.info/preview/multi-column-layout/ http://msdn.microsoft.com/en-us/library/ie/hh673558(v=vs.85).aspx http://dev.w3.org/csswg/css3-grid-layout/ http://dev.w3.org/csswg/css3-regions/   Create an animated and adaptive UI. o This objective may include but is not limited to: animate objects by applying CSS transitions; apply 3-D and 2-D transformations; adjust UI based on media queries (device adaptations for output formats, displays, and representations); hide or disable controls http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Find elements by using CSS selectors and jQuery. o This objective may include but is not limited to: choose the correct selector to reference an element; define element, style, and attribute selectors; find elements by using pseudo-elements and pseudo-classes (for example, :before, :first-line, :first-letter, :target, :lang, :checked, :first-child) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Structure a CSS file by using CSS selectors. o This objective may include but is not limited to: reference elements correctly; implement inheritance; override inheritance by using !important; style an element based on pseudo-elements and pseudo-classes (for example, :before, :first-line, :first-letter, :target, :lang, :checked, :first-child) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Technorati Tags: 70-480,CSS3,HTML5,HTML,CSS,JavaScript,Certification

    Read the article

  • CodePlex Daily Summary for Tuesday, February 23, 2010

    CodePlex Daily Summary for Tuesday, February 23, 2010New Projects.NET Beginners: This project is a summary of project for first time developer and .net beginners. the aim is to provide tools and libraries to get startet with dev...A simple ASP.NET Currency / Money TextBox User Control: A ASP.NET TextBox control used with AJAX maskeditextender makes it possible to enter numbers but it's not very intuitive to use. CurrencyTextBox co...Academiki: Academik The project aims to be a university social network with content sharing and intellectual property. Academik makes it easier for students t...Acessando Campos com XPath Expression: Esse é um exemplo de como usar Xpath Expression na orchestration do Biztalk 2006. O Artigo do exemplo esta em www.biztalkbrasil.blogspot.comAg.CommandManager: A command manager implementation for Silverlights. Supports commanding to more or less any event using the ICommand interfaceApunta Notas: Apunta notas is just a note taking program that I created to learn WPF. Now you can write everything you need to remember or tell somebody. Or you...AzureKit: AzureKit provides a more direct approach to Azure's Table Service, which takes more advantage of the NoSQL nature of the storage medium.CRM 4.0 Distribute Workflow Activity: This plugin allows to execute a workflow for each entity that has a 1:N or N:N relationship to a given entity. For example: execute a workflow for...Dbg Shell: Dbg Shell replaces WinDbg for debugging dumps. All standard Dbg commands are supported. You can also write scripts in .Net assemblies to automated ...Egg Timer: Egg Timer is a very simple Windows Form application for setting short time-frame alarms.Enterprise Library Extensions: Extensions for the Microsoft Enterprise Library applications blocks which makes programming applications even easier.Event Calendar 2.0 Data Extractor: Really simple app to recover event calendar 2.0 information from iGoogle settings files and turn them into CSV format info for importing to other c...iTwiit: Silverlight Twitter Clientlibtym: Have your complete movie collection at a glance to manage all your movie files very comfortably!Metabolite Enterprise Libraries for EPiServer CMS using Page Type Builder: The Metabolite Enterprise libraries are a set of C# Class Libraries developed for use with EPiServer 5 R2 SP2+ projects using PageTypeBuilder. They...Metro UX: Metro UXMTI: -Personal Expense Tracker: Personal Expense Tracker helps you track your expenses. I tried to find simple win forms expense tracker but found none interesting, so i made one...rarouš: repository for rarouš.weblog articlesSacDotNetUG: SacDotNetUG is an ASP.NET MVC 2 Web application intended for the Sacramento .NET user group. This project servers 2 main goals: to promote the adop...ShellLight: ShellLight is essentially a graphical shell for Silverlight applications that enables a quick auto-complete launcher for features in your solution.Sina Weibo(Microblog): sina weibo .NET libraries and applications.Terrain Independant Navigating Automaton v2.0: This is where members of the Robot Design Team from Stony Brook University come together and work on our unique TINA. This project is for a self-go...Url Rewrite.Net: Url Rewrite.Net is an open-source SEO project which contains Custom Http Module example and Custom Configrutaion Module.It is developed in C#.NET 2...WebPart and WebService Currency Converter: This is only a sample code how to get data from yahoo finance and how to implementing on Sharepoint WebPart or WebServices. This code it is freely...WPF AutoComplete TextBox Control: A AutoComplete TextBox Control written in WPF, Looks like the system built-in auto-completion(SHAutoComplete).ZWaveAPI: This project is aim to create an open class library on ZWave. It is based on article from digiWave.dk New Releases.NET Beginners: MathLab Visual Studio Project Template: First preview to a mathlab beginners library..NET Beginners: Turtle Visual Studio Project Template: The turtle engine is a very simlpe turtle which runs over a beach and leaves a track.A simple ASP.NET Currency / Money TextBox User Control: CurrencyTextBox Source v1.0: Source code with a test project.A simple ASP.NET Currency / Money TextBox User Control: CurrencyTextBox.dll: The User Control for use in projects.Acessando Campos com XPath Expression: Source Code SampleXPathExpression: O Source code contem o Projeto em Visual Studio 2005.Actipro WPF Controls Contrib: v2009.2 build 515: Minor tweaks and updated to target Actipro WPF Studio 2009.2 (build 515).Analysis Management System: 1.0.0.1 Update: Fix - Issue 4004 Nieuw - Beschikbare klanten kunnen nu bekeken worden via Extra/Aanvragers (Ctrl R)Apunta Notas: Apunta Notas 1.0 Release Candidate: There is the Release Candidate of Apunta Notas.ARSoft.Tools.Net - C# DNS and SPF Library: 1.2.0: Added asynchronous operations for DNS client.CRM 4.0 Distribute Workflow Activity: Beta: Initial release. Complete functionality, limited testing.Dbg Shell: First Public Release: First ReleaseDnDns and PocketDnDns - A .NET DNS Client Resolver Library: DnDns Library Release 2: A DNS protocol library written completely in managed code (C#). Supports common DNS records types like A, CNAME, MX, SRV, and more. Works on Window...Egg Timer: Egg Timer v1.0: Pretty simple application. Set the time directly or use the 5 minute and 1 hour increment/decrement buttons.EnhSim: EnhSim v1.9.7.2 BETA: 1.9.7.2 BETAImportant!: This beta version includes the changes to the Flame shock damage-over-time component which are currently on the PTR. Downlo...EnhSim: EnhSim v1.9.7.3 BETA: Important!: This beta version includes the changes to the Flame shock damage-over-time component which are currently on the PTR. Download 1.9.7.1 f...Esendex SMS SDK and Downloads for Microsoft.NET languages: Esendex .NET SDK v0.4.0: Features Messaging Service: Send a single SMS message and multiple SMS messages. Send a single Voice Message and multiple Voice Messages. Send...Event Calendar 2.0 Data Extractor: V1.0: First ever build of extractorExcelDna: ExcelDna Version 0.22: An important bugfix release that fixes a critical bug in the MultiThreaded marshaling support (under Excel 2007).InfoService: InfoService v1.5 Beta 8: InfoService Beta Release Please note this is a BETA. It should be stable, but i can't gurantee that! So use it on your own risk. Please read Plugi...Krypton Palette Selectors: Release 1.2: Adds the new KryptonPaletteContextMenu and refactors the KryptonPaletteDropButton to use it.kuuy static system: kss_v1.0beta: kuuy static sytem 1.0 beta editionlibtym: libtym: First public release version. Full functionality, tested. Please notify about bugs.mojoPortal: 2.3.3.9: see release notes on mojoPortal.com http://www.mojoportal.com/mojoportal-2339-released.aspx This release makes it easy to use Artisteer html templa...Net Tool: v1.01: User interface has been changedOpen NFSe: Open NFSe 0.1 (Salvador): Open NFSe 0.1 (Salvador)Paint.NET PSD Plugin: 1.0.7: Further substantial improvements in speed of both loading and saving. In particular, loading is about 5x as fast as in version 1.0.6. Saving is ...Project Starlight: 2.0: Release 2.0 final Changes: -Numerous stability fixes -Firefox 3.5 support -Safari 64 bit support (Snow Leopard) Mac and Windows Binaries are avai...RoTwee: RoTwee 5.0.0.1: This version fix for 16620Secure Data: Secure Data 2010.02.22.01: This version has been rewritten and contains many enhancements and I encourage anyone interested to download the source code and work through the Q...TreeSizeNet: TreeSizeNet 0.10.1: - Complete Redesign - Improved Stability - Improved Performance - PieChart for directory contentUrl Rewrite.Net: Beta V0.1 Release: Includes : -Custom Http Module -Custom Configuration Section Module ( in web.config) -Rewriting ModuleVCC: Latest build, v2.1.30222.0: Automatic drop of latest buildWebPart and WebService Currency Converter: CurrencyConverter.zip: CurrencyConverter.zip Have 3 Project on this files: 1. Library Project 2. Load Library Project Using Web Services 3. Load Library Project Using We...WSUS Smart Approve: 1.0.0.2: Fix: 25903ZuneConsole: ZuneConsole: Console GUI for the Zune Customs library, which should make everything work. This is what you should download.ZuneConsole: ZuneConsole How-To Manual: A quick (only 9 pages lol) tutorial on how to add custom artist info to your Zune.Most Popular ProjectsRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)ASP.NETDotNetNuke® Community EditionImage Resizer Powertoy Clone for WindowsMicrosoft SQL Server Community & SamplesMost Active ProjectsDinnerNow.netRawrBlogEngine.NETNB_Store - Free DotNetNuke Ecommerce Catalog ModuleSharpyInfoServicejQuery Library for SharePoint Web ServicesPHPExcelpatterns & practices – Enterprise LibrarySharePoint Contrib

    Read the article

  • Getting WCF Services in a Silverlight solution to play nice on deployment

    - by brendonpage
    I have come across 2 issues with deploying WCF services in a Silverlight solution, admittedly the one is more of a hiccup, and only occurs if you take the easy way out and reference your services through visual studio. The First Issue This occurs when you deploy your WFC services to an IIS server. When browse to the services using your web browser, you are greeted with “This collection already contains an address with scheme http.  There can be at most one address per scheme in this collection.”. When you make a call to this service from your Silverlight application, you get the extremely helpful “NotFound” error, this error message can be found in the error property of the event arguments on the complete event handler for that call. As it did with me this will leave most people scratching their head, because the very same services work just fine on the ASP.NET Development Web Server and on my local IIS server. Now I’m no server/hosting/IIS expert so I did a bit of searching when I first encountered this issue. I found out this happens because IIS supports multiple address bindings per protocol (http/https/ftp … etc) per web site, but WCF only supports binding to one address per protocol. This causes a problem when the WCF service is hosted on a site with multiple address bindings, because IIS provides all of the bindings to the host factory when running the service. While this problem occurs mainly on shared hosting solutions, it is not limited to shared hosting, it just seems like all shared hosting providers setup sites on their servers with multiple address bindings. For interests sake I added functionality to the example project attached to this post to dump the addresses given to the WCF service by IIS into a log file. This was the output on the shared hosting solution I use: http://mydomain.co.za/Services/TestService.svc http://www.mydomain.co.za/Services/TestService.svc http://mydomain-co-za.win13.wadns.net/Services/TestService.svc http://win13/Services/TestService.svc As you can see all these addresses are for the http protocol, which is where it all goes wrong for WCF. Fixes for the First Issue There are a few ways to get around this. The first being the easiest, target .NET 4! Yes that's right in .NET 4 WCF services support multiple addresses per protocol. This functionality is enabled by an option, which is on by default if you create a new project, you will need to turn on if you are upgrading to .NET 4. To do this set the multipleSiteBindingsEnabled property of the serviceHostingEnviroment tag in the web.config file to true, as shown below: <system.serviceModel>     <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> Beware this ONLY works in .NET 4, so if you don’t have a server with .NET 4 installed on that you can deploy to, you will need to employ one of the other work a rounds. The second option will work for .NET 3.5 & 4. For this option all you need to do is modify the web.config file and add baseAddressPrefixFilters to the serviceHostingEnviroment tag as shown below: <system.serviceModel>     <serviceHostingEnvironment>         <baseAddressPrefixFilters>              <add prefix="http://www.mydomain.co.za"/>         </baseAddressPrefixFilters>     </serviceHostingEnvironment> </system.serviceModel> These will be used to filter the list of base addresses that IIS provides to the host factory. When specifying these prefix filters be sure to specify filters which will only allow 1 result through, otherwise the entire exercise will be pointless. There is however a problem with this work a round, you are only allowed to specify 1 prefix filter per protocol. Which means you can’t add filters for all your environments, this will therefore add to the list of things to do before deploying or switching dev machines. The third option is the one I currently employ, it will work for .NET 3, 3.5 & 4, although it is not needed for .NET 4. For this option you create a custom host factory which inherits from the ServiceHostFactory class. In the implementation of the ServiceHostFactory you employ logic to figure out which of the base addresses, that are give by IIS, to use when creating the service host. The logic you use to do this is completely up to you, I have seen quite a few solutions that simply statically reference an index from the list of base addresses, this works for most situations but falls short in others. For instance, if the order of the base addresses where to change, it might end up returning an address that only resolves on the servers local network, like the last one in the example I gave at the beginning. Another instance, if a request comes in on a different protocol, like https, you will be creating the service host using an address which is on the incorrect protocol, like http. To reliably find the correct address to use, I use the address that the service was requested on. To accomplish this I use the HttpContext, which requires the service to operate with AspNetCompatibilityRequirements set on. If for some reason running you services with AspNetCompatibilityRequirements on isn’t an option, you can still use this method, you will just have to come up with your own logic for selecting the correct address. First you will need to enable AspNetCompatibilityRequirements for your hosting environment, to do this you will need to set it to true in the web.config file as shown below: <system.serviceModel>     <serviceHostingEnvironment AspNetCompatibilityRequirements="true" /> </system.serviceModel> You will then need to mark any services that are going to use the custom host factory, to allow AspNetCompatibilityRequirements, as shown below: [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] public class TestService { } Now for the custom host factory, this is where the logic lives that selects the correct address to create service host with. The one i use is shown below: public class CustomHostFactory : ServiceHostFactory { protected override ServiceHost CreateServiceHost(Type serviceType, Uri[] baseAddresses) { // // Compose a prefix filter based on the requested uri // string prefixFilter = HttpContext.Current.Request.Url.Scheme + "://" + HttpContext.Current.Request.Url.DnsSafeHost; if (!HttpContext.Current.Request.Url.IsDefaultPort) { prefixFilter += ":" + HttpContext.Current.Request.Url.Port.ToString() + "/"; } // // Find a base address that matches the prefix filter // foreach (Uri baseAddress in baseAddresses) { if (baseAddress.OriginalString.StartsWith(prefixFilter)) { return new ServiceHost(serviceType, baseAddress); } } // // Throw exception if no matching base address was found // throw new Exception("Custom Host Factory: No base address matching '" + prefixFilter + "' was found."); } } The most important line in the custom host factory is the one that returns a new service host. This has to return a service host that specifies only one base address per protocol. Since I filter by the address the request came on in, I only need to create the service host with one address, since this address will always be of the correct protocol. Now you have a custom host factory you have to tell your services to use it. To do this you view the markup of the service by right clicking on it in the solution explorer and choosing “View Markup”. Then you add/set the value of the Factory property to the full namespace path of you custom host factory, as shown below. And that is it done, the service will now use the specified custom host factory. The Second Issue As I mentioned earlier this issue is more of a hiccup, but I thought worthy of a mention so I included it. This issue only occurs when you add a service reference to a Silverlight project. Visual Studio will generate a lot of code for you, part of that generated code is the ServiceReferences.ClientConfig file. This file stores the endpoint configuration that is used when accessing your services using the generated proxy classes. Here is what that file looks like: <configuration>     <system.serviceModel>         <bindings>             <customBinding>                 <binding name="CustomBinding_TestService">                     <binaryMessageEncoding />                     <httpTransport maxReceivedMessageSize="2147483647" maxBufferSize="2147483647" />                 </binding>                 <binding name="CustomBinding_BrokenService">                     <binaryMessageEncoding />                     <httpTransport maxReceivedMessageSize="2147483647" maxBufferSize="2147483647" />                 </binding>             </customBinding>         </bindings>         <client>             <endpoint address="http://localhost:49347/services/TestService.svc"                 binding="customBinding" bindingConfiguration="CustomBinding_TestService"                 contract="TestService.TestService" name="CustomBinding_TestService" />             <endpoint address="http://localhost:49347/Services/BrokenService.svc"                 binding="customBinding" bindingConfiguration="CustomBinding_BrokenService"                 contract="BrokenService.BrokenService" name="CustomBinding_BrokenService" />         </client>     </system.serviceModel> </configuration> As you will notice the addresses for the end points are set to the addresses of the services you added the service references from, so unless you are adding the service references from your live services, you will have to change these addresses before you deploy. This is little more than an annoyance really, but it adds to the list of things to do before you can deploy, and if left unchecked that list can get out of control. Fix for the Second Issue The way you would usually access a service added this way is to create an instance of the proxy class like so: BrokenServiceClient proxy = new BrokenServiceClient(); Closer inspection of these generated proxy classes reveals that there are a few overloaded constructors, one of which allows you to specify the end point address to use when creating the proxy. From here all you have to do is come up with some logic that will provide you with the relative path to your services. Since my WCF services are usually hosted in the same project as my Silverlight app I use the class shown below: public class ServiceProxyHelper { /// <summary> /// Create a broken service proxy /// </summary> /// <returns>A broken service proxy</returns> public static BrokenServiceClient CreateBrokenServiceProxy() { Uri address = new Uri(Application.Current.Host.Source, "../Services/BrokenService.svc"); return new BrokenServiceClient("CustomBinding_BrokenService", address.AbsoluteUri); } } Then I will create an instance of the proxy class using my service helper class like so: BrokenServiceClient proxy = ServiceProxyHelper.CreateBrokenServiceProxy(); The way this works is “Application.Current.Host.Source” will return the URL to the ClientBin folder the Silverlight app is hosted in, the “../Services/BrokenService.svc” is then used as the relative path to the service from the ClientBin folder, combined by the Uri object this gives me the URL to my service. The “CustomBinding_BrokenService” is a reference to the end point configuration in the ServiceReferences.ClientConfig file. Yes this means you still need the ServiceReferences.ClientConfig file. All this is doing is using a different end point address than the one specified in the ServiceReferences.ClientConfig file, all the other settings form the ServiceReferences.ClientConfig file are still used when creating the proxy. I have uploaded an example project which covers the custom host factory solution from the first issue and everything from the second issue. I included the code to write a list of base addresses to a log file in my implementation of the custom host factory, this is not need for the custom host factory to function and can safely be removed. Download (WCFServicesDeploymentExample.zip)

    Read the article

  • Tween Animation Cannot Start

    - by David Dimalanta
    Do you have any reasons why my tween code didn't run or work? I already add the tween engine onto the library folder under LibGDX project folder and "Order and Export" it under Java Build Path at the Properties menu. My first two classes ran correctly and workly but my third class didn't work. Here's the sequence: First class is the first screen. Fade animation works on the company's logo. Second class is the second screen. Fade animation for the loading screen works. Third class is the third screen. After the second screen, now calls for the third screen. Animation stopped or won't run since I want the black screen to fade out at the start when the menu is here. Can you check if I did right? Look carefully by comment lines for explanation. //-----[ Animation Setup ]----- Tween.registerAccessor(Sprite.class, new Tween_Animation()); // --> Tween_Animation.java Tween_Manager = new TweenManager(); // --> I initialized it the TweenManager and seems okay. cb_start = new TweenCallback() // --> I'll use this when I choose START and the menu will fade in black. { @Override public void onEvent(int arg0, BaseTween<?> arg1) { goTo(); } }; Tween // --> This is where I focused the problem. .to(black_Sprite, Tween_Animation.ALPHA, 3f) .target(1) .ease(TweenEquations.easeInQuad) .repeatYoyo(200, 2.5f) // --> I set the repeat for 200 times when I noticed that the animation won't work! .start(Tween_Manager);

    Read the article

  • CodePlex Daily Summary for Wednesday, June 09, 2010

    CodePlex Daily Summary for Wednesday, June 09, 2010New Projects.NET Transactional File Manager: Transactional File Manager is a .NET API that supports including file system operations such as file copy, move, delete in a transaction. It's an i...3D World Studio Content Pipeline for Windows Phone 7: This is a port of PhotonicGames' project: http://xna3dws.codeplex.com/releases/view/42994 for the Windows Phone 7 tools (XNA 4.0 CTP).Advanced Script Editor for 3D Rad: Advanced Script Editor makes it easier for 3D Rad coders to write scripts. Developed in C#, it features a functions list, a favourites list, object...Ajax ASP.Net Forum: A fast & lightweight open source free forum developed in ASP.Net 3.5, AJAX, CSS, SQL & Javascript Cache (filter-sort-move through table records at ...Axon: Axon is the home automation system that I will be running in my home. It will be a collection of different technologies and projects, often experim...BigBallz: Projeto de site de Bolões para campeonatos diversos. A princípio pensado para copa do mundo de futebol de 2010BigfootMVC: MVC Framework for DotNetNukeBigfootSQL: A StringBuilder for SQL. BigfootSQL was built with simplicity in mind. It assumes that you are comfortable writing SQL but dislike effort required ...Bxf (Basic XAML Framework): Basic Xaml Framework (Bxf) is a simple, streamlined set of UI components designed to demonstrate the minimum framework functionality required to ma...elZerf - elektronische Zeiterfassung: elektronisches Zeiterfassungsystem im Rahmen der Seminararbeit im Modul Web-Anwendungsprogrammierung.IntoFactories.Net - Samples: Project to host samples created by members of the IntoFactories.NET Team blog.Lanchonete: Sistema para controle de lanchonetes. Medieval Dynasties: Medieval Dynasties is a game written in C# 3.5 and XNA 3.1 at the moment. It is inspired by Crusader Kings, Total War and Civilization.PMMsg: A project to replace the standard messaging client on the Windows Mobile platform. Mainly geared towards Windows Mobile 6.5.3 VGA devices. Also an...PunkPong: PunkPong is an open source "Pong" alike game totally written in DHTML (JavaScript, CSS and HTML) that uses keyboard or mouse. This cross-platform a...Renegade Legion Fighter Calculator: In working on assigning fighters to squadrons, flights, and groups for a campaign, I was struck by the sheer amount of calculations I had to make. ...Sharpotify - Spotify .Net Library: Sharpotify is a Spotify library in C#. It is based in Jotify and SharPot projects. It is not a libspotify wrapper, It is a full .Net Spotify protoc...Silverlight load on demand with MEF: With MEF, a Silverlight control can be split in several packages(xap files). Each package can contain one or more pages and it will download on dem...SOLID by example: Source code examples to undestood solid design principles. Most of them were taken from http://www.lostechies.com/SQL Server 2008 Reporting Services RS.EXE Supporting Forms Authentication: A version of RS.EXE that you can use with Forms Authentication in Native Mode. Use the following arguments to specify credentials (just like Basic ...Stripper: Stripper Remove Diacritics and other unwanted caracter to fabric a more standardized file naming.study: studyUncoverPIC: UncoverPIC is a Silverlight Game strongly inspired to the famous Arcade Game "GalsPanic" (see http://en.wikipedia.org/wiki/Gals_Panic ). It was dev...Unity3D Untitled MMO: Unity3D Untitled MMO FrameworkUnnamedShop: UnnamedShopXBStudio.asp.net.automation: A Unit Testing Automation library for asp.netXBStudio.Web: XBStudio Web ApplicationNew Releases3D World Studio Content Pipeline for Windows Phone 7: Initial Release (0.1): This is the first release of the project, with plenty of hackery and kludges to go around, but it mostly works! Let me know if you hit any bugs.Acies: Acies - Alpha Build 0.0.10: Alpha release. Requires Microsoft XNA Framework Redistributable 3.1 (http://www.microsoft.com/downloads/details.aspx?FamilyID=53867a2a-e249-4560-...Advanced Script Editor for 3D Rad: Advanced Script Editor - Version 2.6: Despite various previous releases on the 3D Rad forum, this is the first release on CodePlex.Ajax ASP.Net Forum: First Release: First Release prior to CodePlex Publish (send to admins)So, it doesn't all finish VERSION: 0.1.2 FEATURES Main Home Where all the Forums (called ...Artist Follower for Microsoft Access: Artist Follower 0.5.1: Artists Follower changes: Just one form to manage artists and links!!!Artist Follower for Microsoft Access: Artists Follower 0.5.0: This is the first release of Artist Follower.ASP.NET MVC SiteMap provider - MvcSiteMapProvider: MvcSiteMapProvider 2.0.0 CTP1: This is a community technology preview of MvcSiteMapProvider version 2.0. It is not backwards compatible with older MvcSiteMapProvider versions. ...B&W Port Scanner: Black`n`White Port Scanner 4.0: Version 4 includes: - Improved vulnerability detection tools - Report Creation - Improved Stability - Much better port information database - Nume...BaseCalendar: BaseControls 1.1: BaseControls 1.1 contains the BaseCalendar ASP.NET control. Changes: Rendering TH by default inside THEAD. Added option (ShowMinNumWeeks) to r...BigfootSQL: BigfootSQL Source Code: BigfootSQL C# Version 01Commerce Server 2009 Orders using Pipelines in a Console Application: ConsoleApplication To PLace Orders: ConsoleApplication To PLace Orders with Commerce Server 2009 foundationCommunity Forums NNTP bridge: Community Forums NNTP Bridge V33: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has ad...Community Forums NNTP bridge: Community Forums NNTP Bridge V34: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has ad...ContainerOne - C# application server: V0.1.2.0: New minor release containing: Integration test component for runtime testing Refactored and cleaned solution files First unit testsExtend SmallBasic: Teaching Extensions v.020: Moved Tortoise.approve to ProgramWindow.TakeScreenShot()fleet It: v0.06 Alpha: v0.06 Alpha - Features Caching implemented for fleets Various Bug fixes Implemented Settings. Resolved logical issue with Getting fleets U...Frotz.NET: Frotz.NET B2: In addition to B1 changes: - Added ZTools to enable debugging view of zcode files - Added rudimentary scroll back buffer. B1 Changes: - Got Adapt...FsObserver: FsObserver 2.0: This is basically the same as FsObserver 1.0 but the "-help" documentation has been cleaned up somewhat and the code has been refactored so that it...GPdotNET - Genetic Programming Tool: GPdotNETv1.0: GPdotNET v.1.0 - more details on http.bhrnjica.wordpress.com/gpdotnetHERB.IQ: Alpha 0.1 Source code release 8: Alpha 0.1 Source code release 8imdb movie downloader: myImdb 0.9.3: myImdb 0.9.3imdb movie downloader: myImdb 0.9.4: myImdb 0.9.4jccc .NET smart framework: jccc .NET smart framework version 1.2010.06.07: jccc .NET smart framework version 1.2010.06.07 added oracle databases supportLongBar: LongBar 2.1 Build 313: - Fixed library and updates to work with updated live services - Options: You can disable shadow nowMDownloader: MDownloader-0.15.17.59623: Fixed FileFactory provider. Improvied postpone policies. Added network request limiter.MediaCoder.NET: MediaCoder.NET v1.0 beta 1.1: Installer for MediaCoder.NET v1.0 beta1.1. It can now convert files with spaces in the path or filename. I have also created filter for the SaveFil...MediaCoder.NET: MediaCoder.NET v1.0 beta 1.1 Source Code: Source Code for MediaCoder.NET v1.0 beta 1.1.mesoBoard: mesoBoard - 0.9.1 beta: Fixed file download permissions Released under the New BSD License.MPCLI: Alpha Release (0.1.0.0): This release has core functionality and is considered a potential candidate for a feature complete release of this library. However, suggestions fo...N2 CMS: 2.0: N2 is a lightweight CMS framework for ASP.NET. It helps professional developers build great web sites that anyone can update. Major Changes (1.5 -...NHTrace: NHTrace-47571: NHTrace-47571NodeXL: Network Overview, Discovery and Exploration for Excel: NodeXL Class Libraries, version 1.0.1.125: The NodeXL class libraries can be used to display network graphs in .NET applications. To include a NodeXL network graph in a WPF desktop or Windo...NSoup: NSoup 0.2: NSoup 0.2 corresponds to jsoup version 1.1.1. List of changes can be viewed here.Opalis Community Releases: Integration Pack for Data Manipulation: The Integration Pack for Data Manipulation enables you to perform a wider variety of data manipulation tasks as well as aggregate data into common ...Performance Analysis of Logs (PAL) Tool: PAL v2.0 Beta 1: Fixed Counter Sorting: Fixed a minor bug where duplicate counter expression paths were not being removed. Analysis Added: Added LogicalDisk Read/...RoTwee: RoTwee (12.0.0.0): Trial version. 17925 Make it possible to change window sizeSharpotify - Spotify .Net Library: Sharpotify.Library 1.0: Sharpotify Library: Stable release. You can connect with spotify, search, browse (tracks, albums, artists), get a music stream, create and edit you...Silverlight load on demand with MEF: mal.Web.Silverlight.MEF 1.0.0.0: mal.Web.Silverlight.MEF 1.0.0.0sMAPtool: sMAPtool v0.7e (without Maps): + Added: color value expansion bar for hmap (right click to select color scheme) + Added: more complex hmap editing, uses now 4 point bounding rect...SQL Server 2008 Reporting Services RS.EXE Supporting Forms Authentication: Initial release: Enjoy!Stripper: Stripper 0.1.1 (CLi): Stripper Remove Diacritics and other unwanted caracters to fabric a more standardized file naming. Especially French caracter and maybe other lang...Unity3D Untitled MMO: v1: versionUrzaGatherer: UrzaGatherer 2.01a: New version with some minors bugs corrected.VCC: Latest build, v2.1.30608.0: Automatic drop of latest buildVCC: Latest build, v2.1.30608.1: Automatic drop of latest buildWatermarker.NET: 0.1.3811: A newer version with some improvements. I release this as a .zip archive, because settings are added here, so there will be .exe and .config files.Yet Another GPS: Alfa Release: Alfa working releaseMost Popular ProjectsDozer Enterprise Library for .NETEmployee Management SystemWiiMote PhysicsVisualStudio 2010 JavaScript OutliningSpider CompilerConcurrent CacheOil Slick Live FeedsCSUFVGDC Summer JamWinGetSiteMap Utility for DNN Blog ModuleMost Active ProjectsCommunity Forums NNTP bridgepatterns & practices – Enterprise LibraryRhyduino - Arduino and Managed CodejQuery Library for SharePoint Web ServicesRawrNB_Store - Free DotNetNuke Ecommerce Catalog ModuleAndrew's XNA HelpersBlogEngine.NETStyleCopCustomer Portal Accelerator for Microsoft Dynamics CRM

    Read the article

  • September 2012 Release of the Ajax Control Toolkit

    - by Stephen.Walther
    I’m excited to announce the September 2012 release of the Ajax Control Toolkit! This is the first release of the Ajax Control Toolkit which supports the .NET 4.5 framework. We also continue to support ASP.NET 3.5 and ASP.NET 4.0. With this release, we’ve made several important bug fixes. The Superexpert team focused on fixing the highest voted issues associated with the CascadingDropDown control. I’ve created a list of these bug fixes later in this blog post. You can download the latest release of the Ajax Control Toolkit by visiting the following page at CodePlex: http://AjaxControlToolkit.CodePlex.com Alternatively, you can install the latest version of the Ajax Control Toolkit using NuGet by firing off the following command from the Package Manager Console: Install-Package AjaxControlToolkit Using the Ajax Control Toolkit with ASP.NET 4.5 Let me walk through the steps for using the Ajax Control Toolkit with ASP.NET 4.5. First, I’ll create a new ASP.NET 4.5 website with Visual Studio 2012. I’ll create the new website with the ASP.NET Web Forms Application template: When you create a new ASP.NET 4.5 site with the ASP.NET Web Forms Application template, you get a starter website. If you run the site, then you get a page with default content: Let me show you how you can add the Ajax Control Toolkit Calendar control to the homepage of this starter site. The first step is to use NuGet to install the Ajax Control Toolkit. Right-click the References folder in the Solution Explorer window and select the menu option Manage NuGet Packages. In the Manage NuGet Packages dialog, use the search box to search for the Ajax Control Toolkit (enter “AjaxControlToolkit”). After you find it, click the Install button to add the Ajax Control Toolkit to your project. That’s all you have to do to install the Ajax Control Toolkit! Now we are ready to start using the Ajax Control Toolkit controls. Open the default.aspx page so we can modify the contents of the page. Erase everything contained in the Content control with the ID of BodyContent. After erasing the content, declare the following two controls: <asp:TextBox ID="vacationDate" runat="server" /> <ajaxToolkit:CalendarExtender TargetControlID="vacationDate" runat="server" /> The first control is a standard ASP.NET TextBox control and the second control is an Ajax Control Toolkit Calendar control. You should get intellisense as you type out the Ajax Control Toolkit Calendar control. If you don’t, then close and re-open the Default.aspx page. Now, let’s run our app. Hit the F5 button or select Debug, Start Debugging from the Visual Studio menu. You will get the error message “MsAjaxBundle is not a valid script name”. Don’t despair! We need to update the Master Page so it uses the ToolkitScriptManager instead of the default ScriptManager. Open the Site.Master file and find where the ScriptManager is declared. The ScriptManager should look like this: <asp:ScriptManager runat="server"> <Scripts> <%--Framework Scripts--%> <asp:ScriptReference Name="MsAjaxBundle" /> <asp:ScriptReference Name="jquery" /> <asp:ScriptReference Name="jquery.ui.combined" /> <asp:ScriptReference Name="WebForms.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebForms.js" /> <asp:ScriptReference Name="WebUIValidation.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebUIValidation.js" /> <asp:ScriptReference Name="MenuStandards.js" Assembly="System.Web" Path="~/Scripts/WebForms/MenuStandards.js" /> <asp:ScriptReference Name="GridView.js" Assembly="System.Web" Path="~/Scripts/WebForms/GridView.js" /> <asp:ScriptReference Name="DetailsView.js" Assembly="System.Web" Path="~/Scripts/WebForms/DetailsView.js" /> <asp:ScriptReference Name="TreeView.js" Assembly="System.Web" Path="~/Scripts/WebForms/TreeView.js" /> <asp:ScriptReference Name="WebParts.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebParts.js" /> <asp:ScriptReference Name="Focus.js" Assembly="System.Web" Path="~/Scripts/WebForms/Focus.js" /> <asp:ScriptReference Name="WebFormsBundle" /> <%--Site Scripts--%> </Scripts> </asp:ScriptManager> We need to make three changes to the ScriptManager: 1) We need to replace the asp:ScriptManager with the ajaxToolkit:ToolkitScriptManager 2) We need to remove the MsAjaxBundle bundle from the ScriptReferences 3) We need to remove the Assembly=”System.Web” attributes from the ScriptReferences After you make these three changes, the ToolkitScriptManager should looks like this: <ajaxToolkit:ToolkitScriptManager runat="server"> <Scripts> <%--Framework Scripts--%> <asp:ScriptReference Name="jquery" /> <asp:ScriptReference Name="jquery.ui.combined" /> <asp:ScriptReference Name="WebForms.js" Path="~/Scripts/WebForms/WebForms.js" /> <asp:ScriptReference Name="WebUIValidation.js" Path="~/Scripts/WebForms/WebUIValidation.js" /> <asp:ScriptReference Name="MenuStandards.js" Path="~/Scripts/WebForms/MenuStandards.js" /> <asp:ScriptReference Name="GridView.js" Path="~/Scripts/WebForms/GridView.js" /> <asp:ScriptReference Name="DetailsView.js" Path="~/Scripts/WebForms/DetailsView.js" /> <asp:ScriptReference Name="TreeView.js" Path="~/Scripts/WebForms/TreeView.js" /> <asp:ScriptReference Name="WebParts.js" Path="~/Scripts/WebForms/WebParts.js" /> <asp:ScriptReference Name="Focus.js" Path="~/Scripts/WebForms/Focus.js" /> <asp:ScriptReference Name="WebFormsBundle" /> <%--Site Scripts--%> </Scripts> </ajaxToolkit:ToolkitScriptManager> After we make these changes, the app should run successfully. You’ll get a page which contains a text field. When you click inside the text field, a popup calendar is displayed. Ajax Control Toolkit and jQuery You might have noticed that the ScriptManager includes a reference to jQuery by default. We did not remove that reference when we converted the ScriptManager to a ToolkitScriptManager. You can use the Ajax Control Toolkit and jQuery side-by-side. Here’s how you can modify the Default.aspx page so that it contains two popup calendars. The first popup calendar is created with the Ajax Control Toolkit and the second popup calendar is created with jQuery: <asp:TextBox ID="vacationDate" runat="server" /> <ajaxToolkit:CalendarExtender TargetControlID="vacationDate" runat="server" /> <input id="birthDate" /> <script> $("#birthDate").datepicker(); </script> Before you can start using jQuery UI plugins, you need to complete one more step. You need to add the jQuery UI themes bundle to the HEAD of the Site.Master page like this: <head runat="server"> <meta charset="utf-8" /> <title><%: Page.Title %> - My ASP.NET Application</title> <asp:PlaceHolder runat="server"> <%: Scripts.Render("~/bundles/modernizr") %> </asp:PlaceHolder> <webopt:BundleReference runat="server" Path="~/Content/css" /> <webopt:BundleReference runat="server" Path="~/Content/themes/base/css" /> <link href="~/favicon.ico" rel="shortcut icon" type="image/x-icon" /> <meta name="viewport" content="width=device-width" /> <asp:ContentPlaceHolder runat="server" ID="HeadContent" /> </head> The markup above includes a reference to the jQuery UI themes bundle: <webopt:BundleReference runat="server" Path="~/Content/themes/base/css" /> Now that we have made these changes, we can use the Ajax Control Toolkit and jQuery at the same time. When you run your app, you get two popup calendars. When you click in the first text field, the Ajax Control Toolkit calendar appears. When you click in the second text field, the jQuery UI popup calendar appears: Bug Fixes in this Release We made several important bug fixes with this release of the Ajax Control Toolkit and integrated several Pull Requests contributed by the community. Our primary focus during this sprint was fixing issues with the CascadingDropDown control. We fixed the following issues associated with the CascadingDropDown: · 9490 – Don’t disable dropdowns in CascadingDropDown · 14223 – CascadingDropDown Reset or Setting SelectedValue from WebMethod · 12189 – CascadingDropDown not obeying disabled state of DropDownList · 22942 – CascadingDropDown infinite loop (with solution) · 8671 – CascadingDropdown options is null or undefined · 14407 – CascadingDropDown: populated client event happens too often · 17148 – CascadingDropDown – Add “UseHttpGet” property · 10221 – No NotNull check in CascadingDropDown · 12228 – Provide property for case-insensitive DefaultValue lookup in CascadingDropdown We also fixed the following two issues which are not directly related to the CascadingDropDown control: · 27108 – CalendarExtender: Bug when selecting December shifts to January. · 27041 – Input controls with HTML5 types do not post back in Firefox, Chrome, Safari Finally, we integrated several Pull Requests submitted by the community (Thank you community!): · Added French localized resources for the AjaxFileUpload · Resolved an issue which prevented the AjaxFileUpload control from working with pages that require query string variables. · Extended the AjaxFileUploadEventArgs class to include the current file index in the queue and the total number of files in the queue. · Fixed an issue with TabContainer and TabPanel which caused the OnActiveTabChanged event to fire too often. Summary I’m happy to see the Ajax Control Toolkit move forward into the brave new world of ASP.NET 4.5! In this latest release, we focused on ensuring that the Ajax Control Toolkit works smoothly with ASP.NET 4.5 applications. We also fixed the highest voted bugs associated with the CascadingDropDown control and integrated several Pull Request submitted by the community. Once again, I want to thank the Superexpert team for their hard work on this release!

    Read the article

  • CodePlex Daily Summary for Tuesday, May 04, 2010

    CodePlex Daily Summary for Tuesday, May 04, 2010New ProjectsAlbum photo de club - Club's Photos Album: Un album photos permettant d'afficher les photos et le détails des membres d'un club - Photo album allowing to view photos and details of the membersBlog.Net Blogging Components: Blog.Net server-side blogging components to add a blog to your current ASP.NET website.FilePirate - Really Advanced LAN File Sharing: Really Advanced, yet super easy, LAN Party File Sharing written using the .Net Framework and C#. Ditch DirectConnect or Windows File Sharing at y...Fisiogest: Programa de gestión de una clínica de fisioterapiaIdeaNMR: An online repository of NMR experiment automated setups with wiki type documentation library and client program providing automated experiment setu...Introducción a Unity: Código de ejemplo del uso de Unity en diferentes situaciones. - Registro de clases, instancias e interfaces. - Resolución de clases, instancias e...Iowa City .NET Developers: This is the project site for the Iowa City .NET Developers.isanywhere: A command line utility to see if one or more files (given a filemask) are to be found anywhere inside a specific directory, or elsewhere inside one...LczCode: lczLog4net udp logs viewer: UdpLogViewer is a .NET 4 WinForm application that receives udp messages from log4net and shows them in a grid. It is possible to filter them or sh...New Silverlight XPS Viewer (In Sl4): New Silverlight XPS viewer Novuz: Novuz is a usenet indexer and reporter. It's developed both in Visual Studio 2010 and MonoDevelop, one of the key features of Novuz is that it sho...PodSnatch: PodSnatch is a podcast client that makes it easy to download rss-enclosures. Multiple simultaneous downloads enabled by threading. GUI is built wi...Robot Shootans: A simple top down shooter game where the player has to kill robots running at them. Written in C++ using SDL with various extentionsSharePoint Rsync List: This program will syncronize files and directories from and unc/local/sharepoint to a SharePoint 2007 or 2010 server. Supports of to 2GB files and ...SignInAndStorageLib: SignInAndStorageLib makes properly handling both sign in and storage issues in Xbox 360 XBLIG XNA games simple. Written in C#, SignInAndStorageLib...SilverBBS: ANSI-style bbs experience delivered via Silverlight. Silverlight flip-down counter: A Silverlight widget that enables you to count down towards a preconfigured event on a configured date.SmartieFly: Smartie Fly is a quiz software program written in C# using Silverlight. It uses SQL Server as a backend database. VS2010 Framework Driven Testing: CodedUITests generate a lot of code, and they break on every change to the object under test. Goals: - write new tests manually, but with as litt...WMediaCatalog: Advanced multimedia cataloguer. Allows users to keep their musical collections well organized and provides flexible methods of filtering, serarching WPathFinder: A simple path management application for windows. Functionality includes: - Add/remove/change path entries easily. - Search for all instances of a...Yasminoku: Yasminoku is an open source "Sudoku" alike game totally written in DHTML (JavaScript, CSS and HTML) that uses mouse. Includes sudoku solver. This c...New ReleasesAlbum photo de club - Club's Photos Album: App - version 0.4: version 0.4 - Critère d'affichage des membres : nom, année, ville - Navigation entre les images d'un membres - Navigation entre les membres - Affi...Album photo de club - Club's Photos Album: Code - Version 0.4: Code source de la version 0.4BigDecimal: Concept Evaluation Release 2 (BigDecimals): This in the second updates release of BigDecimals. It has the four simple arithmetic rules Addition, Subtract, Multiple and Division.CBM-Command: 2010-05-03: New features in this build Keyboard Shortcuts Panel Swapping Panel Toggling On/Off Toggling 40/80 Columns Confirming Quit Confirming GO64...Directory Linker: Directory Linker 2: This release introduces Undo Support and Symbolic File Link support. More details can be found here http://www.humblecoder.co.uk/?p=141DotNetNuke Skins Pack: DotNetNuke 80 Skins Pack: This released is the first for DNN 4 & 5 with Skin Token Design (legacy skin support on DNN 4 & 5)DTLoggedExec: 1.0.0.0: -FIRST NON-BETA RELEASE! :) -Code cleaned up -Added SetPackageInfo method to ILogProvider interface to make easier future improvements -Deprecated...GenerateTypedBamApi: Version 2.1: Changes in this release: NEW: Support for Office Data Connectivity Components 2010 NEW: Include both x86 and x64 EXE's due to lack of support in ...HobbyBrew Mobile: Beta 1 Refresh: Risolto bug circa il salvataggio di ricette (veniva impostato scorrettamente che si trattava di Mash Design "infusione" se ri-aperte con hobbyBrew)...Home Access Plus+: v4.2: Version 4.2 Added Overrides into the Booking System Some slight CSS changes to the Help Desk Updated the config tool to work anywhere on the LA...Hubble.Net - Open source full-text search database: V0.8.3.0: V0.8.3.0 Show server version in about dialog. Fix a bug of deleting querycache files. V0.8.2.9 Change sql client to support userid and password Ch...IdeaNMR: IdeaNMR Client: This is a client program with an example package.kdar: KDAR 0.0.21: KDAR - Kernel Debugger Anti Rootkit - signature's bases updated - usability increased - NDIS6 MINIPORT_BLOCK checks addedLightWeight Application Server: 0.4.1: One step further to beta - yet another release for c# developers audience only. Changes: 1. API - added a LWAS.Infrastructure.Storage service to d...Log4net udp logs viewer: UdpLogViewer 1.0: First release of UdpLogViewer, version 1.0.MDownloader: MDownloader-0.15.11.58370: Fixed minor bugs.Metabolite Enterprise Libraries for EPiServer CMS using Page Type Builder: Metabolite Enterprise Libraries 1.2 Beta 2: This is the beta release of the Metabolite Enterprise Libraries 1.2 Beta 2 for use with EPiServer 6 and Page Type Builder 1.2 Beta 2.Microsoft Silverlight Analytics Framework: Version 1.4.3 Installer: Pre-release Installer for Visual Studio 2010 and Expression Blend 4 RCSupports both Silverlight 3 and Silverlight 4 Release NotesFixed null referen...MultipointTUIO: Multipoint SDK v1.5 Release: Rebuilt against v1.5 of the Microsoft Multipoint SDK, this mean Windows 7 support (and 64bit I think!)My Notepad: My Notepad: This is the status of My Notepad until now. This is many built in features but has to undergo a lot of modifications. The release does not include ...New Silverlight XPS Viewer (In Sl4): Silverlight XPS Viewer: Background: During my development last week I was working on a Silverlight based XPS viewer. During this viewer we came to a situation in which the...NSIS Autorun: NSIS Autorun 0.1.6: This release includes source code, executable binary, files and example materials.Open Diagram: Open Diagram 5.0 Beta May 2010: This is the first beta release of Open Diagram 5.0. Select Crainiate.Diagramming.Examples.Forms as the startup project to view the current Class D...Pocket Wiki: PC Wiki (zip) 1.0.1: PC Version of Pocket Wiki. Unzip and run. Requires .NET Framework 2.0Pocket Wiki: Pocket Wiki 1.0.1 (cab): Pocket Wiki cab installation - requires DotNet 2.0 or greater. Default wiki language is "slash" - a syntax I created that is easy to type on keyboa...Pocket Wiki: Pocket Wiki.sbp: Pocket Wiki Source Code (version .72) - Basic4PPCPublish to Photo Frame: 1.0.2.0: This version adds: add borders to portrait images, for photo frames that crop them incorrectly.Reflection Studio: Reflection Studio 0.1: First download release, it contains a lot of things but allways in beta version. Hope you will like the preview.SharePoint 2010 PowerShell Scripts & Utilities: PSSP2010 Utils 0.1: This is the initial release with SPInstallUtils.psm1 module. This module includes Get-SPPrerequisites and New-SPInstallPackage cmdlets. Refer to th...Silverlight 4.0 Popup Menu: Context Menu for Silverlight 4.0 v1.1 Beta: Multilevel menus are now supported. Added design time support for the PopupMenuItem elements. The project is now under Subversion.Silverlight flip-down counter: FlipDownCounter v1.0: The final release of the Silverlight flip-down counter. Please refer to the included readme file for information on how to use the counter.Stratosphere: Stratosphere 1.0.0.1: Moved scalable block file system implementation to Stratosphere.FileSystemSystem.AddIn Pipeline Builder: Pipeline Builder 1.2: Lots of improvements from the CTP, version 1.0: - Added dialogue for possible overwrite if the file has changed: possibility of ignoring changes (p...ThoughtWorks Cruise Notification Interceptor: 1.0.1: Fixed an issue with the regex that parses the incoming notification. This issue would send failure messages when the build was "fixed".ThreadSafeControls: ThreadSafeControls v0.1: This is the first binary release of the ThreadSafeControls library. I'll call it a pre-alpha release.TracerX Logger/Viewer for .NET: 4.0: View this CodeProject article for documentation on how to use the latest version of the Logger. About the DownloadsVersion: 4.0.1005.1163 Changese...VCC: Latest build, v2.1.30503.0: Automatic drop of latest buildVisual Studio DSite: Lottery Game (Visual C++ 2008): An advanced lottery game made in visual c 2008.VivoSocial: VivoSocial 7.1.3: Version 7.1.3 of VivoSocial has been released. If you experienced any issues with the previous version, please update your modules to the 7.1.3 rel...Xrns2XMod: Xrns2XMod 1.0: Features added Conversion of all possible convertible features between Renoise and MOD / XM. FlacBox lib updated (thanks to Yuri) NAudio lib in...Most Popular ProjectsRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: Databasepatterns & practices – Enterprise LibrarySilverlight ToolkitiTuner - The iTunes CompanionWindows Presentation Foundation (WPF)ASP.NETDotNetNuke® Community EditionMost Active ProjectsIonics Isapi Rewrite Filterpatterns & practices – Enterprise LibraryRawrHydroServer - CUAHSI Hydrologic Information System ServerAJAX Control Frameworkpatterns & practices: Azure Security GuidanceNB_Store - Free DotNetNuke Ecommerce Catalog ModuleBlogEngine.NETTinyProjectDambach Linear Algebra Framework

    Read the article

  • Test Driven Development (TDD) in Visual Studio 2010- Microsoft Mondays

    - by Hosam Kamel
    November 14th , I will be presenting at Microsoft Mondays a session about Test Driven Development (TDD) in Visual Studio 2010 . Microsoft Mondays is program consisting of a series of Webcasts showcasing various Microsoft products and technologies. Each Monday we discuss a particular topic pertaining to development, infrastructure, Office tools, ERP, client/server operating systems etc. The webcast will be broadcast via Lync and can viewed from a web client. The idea behind the “Microsoft Mondays” program is to help you become more proficient in the products and technologies that you use and help you utilize their full potential.   Test Driven Development in Visual Studio 2010 Level – 300 (  Intermediate – Advanced ) Test Driven Development (TDD), also frequently referred to as Test Driven Design, is a development methodology where developers create software by first writing a unit test, then writing the actual system code to make the unit test pass.  The unit test can be viewed as a small specification around how the system should behave; writing it first helps the developer to focus on only writing enough code to make the test pass, thereby helping ensure a tight, lightweight system which is specifically focused meeting on the documented requirements. TDD follows a cadence of “Red, Green, Refactor.” Red refers to the visual display of a failing test – the test you write first will not pass because you have not yet written any code for it. Green refers to the step of writing just enough code in your system to make your unit test pass – your test runner’s UI will now show that test passing with a green icon. Refactor refers to the step of refactoring your code so it is tighter, cleaner, and more flexible. This cycle is repeated constantly throughout a TDD developer’s workday. Date:   November 14, 2011 Time:  10:00 a.m. – 11:00 a.m. (GMT+3)  http://www.eventbrite.com/event/2437620990/efbnen?ebtv=F   See you there! Hosam Kamel Originally posted at

    Read the article

< Previous Page | 365 366 367 368 369 370 371 372 373 374 375 376  | Next Page >