Search Results

Search found 9410 results on 377 pages for 'special folders'.

Page 372/377 | < Previous Page | 368 369 370 371 372 373 374 375 376 377  | Next Page >

  • Using AES encryption in .NET - CryptographicException saying the padding is invalid and cannot be removed

    - by Jake Petroules
    I wrote some AES encryption code in C# and I am having trouble getting it to encrypt and decrypt properly. If I enter "test" as the passphrase and "This data must be kept secret from everyone!" I receive the following exception: System.Security.Cryptography.CryptographicException: Padding is invalid and cannot be removed. at System.Security.Cryptography.RijndaelManagedTransform.DecryptData(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount, Byte[]& outputBuffer, Int32 outputOffset, PaddingMode paddingMode, Boolean fLast) at System.Security.Cryptography.RijndaelManagedTransform.TransformFinalBlock(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount) at System.Security.Cryptography.CryptoStream.FlushFinalBlock() at System.Security.Cryptography.CryptoStream.Dispose(Boolean disposing) at System.IO.Stream.Close() at System.IO.Stream.Dispose() ... And if I enter something less than 16 characters I get no output. I believe I need some special handling in the encryption since AES is a block cipher, but I'm not sure exactly what that is, and I wasn't able to find any examples on the web showing how. Here is my code: using System; using System.IO; using System.Security.Cryptography; using System.Text; public static class DatabaseCrypto { public static EncryptedData Encrypt(string password, string data) { return DatabaseCrypto.Transform(true, password, data, null, null) as EncryptedData; } public static string Decrypt(string password, EncryptedData data) { return DatabaseCrypto.Transform(false, password, data.DataString, data.SaltString, data.MACString) as string; } private static object Transform(bool encrypt, string password, string data, string saltString, string macString) { using (AesManaged aes = new AesManaged()) { aes.Mode = CipherMode.CBC; aes.Padding = PaddingMode.PKCS7; int key_len = aes.KeySize / 8; int iv_len = aes.BlockSize / 8; const int salt_size = 8; const int iterations = 8192; byte[] salt = encrypt ? new Rfc2898DeriveBytes(string.Empty, salt_size).Salt : Convert.FromBase64String(saltString); byte[] bc_key = new Rfc2898DeriveBytes("BLK" + password, salt, iterations).GetBytes(key_len); byte[] iv = new Rfc2898DeriveBytes("IV" + password, salt, iterations).GetBytes(iv_len); byte[] mac_key = new Rfc2898DeriveBytes("MAC" + password, salt, iterations).GetBytes(16); aes.Key = bc_key; aes.IV = iv; byte[] rawData = encrypt ? Encoding.UTF8.GetBytes(data) : Convert.FromBase64String(data); using (ICryptoTransform transform = encrypt ? aes.CreateEncryptor() : aes.CreateDecryptor()) using (MemoryStream memoryStream = encrypt ? new MemoryStream() : new MemoryStream(rawData)) using (CryptoStream cryptoStream = new CryptoStream(memoryStream, transform, encrypt ? CryptoStreamMode.Write : CryptoStreamMode.Read)) { if (encrypt) { cryptoStream.Write(rawData, 0, rawData.Length); return new EncryptedData(salt, mac_key, memoryStream.ToArray()); } else { byte[] originalData = new byte[rawData.Length]; int count = cryptoStream.Read(originalData, 0, originalData.Length); return Encoding.UTF8.GetString(originalData, 0, count); } } } } } public class EncryptedData { public EncryptedData() { } public EncryptedData(byte[] salt, byte[] mac, byte[] data) { this.Salt = salt; this.MAC = mac; this.Data = data; } public EncryptedData(string salt, string mac, string data) { this.SaltString = salt; this.MACString = mac; this.DataString = data; } public byte[] Salt { get; set; } public string SaltString { get { return Convert.ToBase64String(this.Salt); } set { this.Salt = Convert.FromBase64String(value); } } public byte[] MAC { get; set; } public string MACString { get { return Convert.ToBase64String(this.MAC); } set { this.MAC = Convert.FromBase64String(value); } } public byte[] Data { get; set; } public string DataString { get { return Convert.ToBase64String(this.Data); } set { this.Data = Convert.FromBase64String(value); } } } static void ReadTest() { Console.WriteLine("Enter password: "); string password = Console.ReadLine(); using (StreamReader reader = new StreamReader("aes.cs.txt")) { EncryptedData enc = new EncryptedData(); enc.SaltString = reader.ReadLine(); enc.MACString = reader.ReadLine(); enc.DataString = reader.ReadLine(); Console.WriteLine("The decrypted data was: " + DatabaseCrypto.Decrypt(password, enc)); } } static void WriteTest() { Console.WriteLine("Enter data: "); string data = Console.ReadLine(); Console.WriteLine("Enter password: "); string password = Console.ReadLine(); EncryptedData enc = DatabaseCrypto.Encrypt(password, data); using (StreamWriter stream = new StreamWriter("aes.cs.txt")) { stream.WriteLine(enc.SaltString); stream.WriteLine(enc.MACString); stream.WriteLine(enc.DataString); Console.WriteLine("The encrypted data was: " + enc.DataString); } }

    Read the article

  • ruby on rails configuration

    - by Themasterhimself
    Im using the following guide for getting started with rails for ubuntu 9.10. http://guides.rails.info/getting_started.html I have installed both ruby and gem. gokul@gokul-laptop:~$ ruby -v ruby 1.8.7 (2009-06-12 patchlevel 174) [i486-linux] gokul@gokul-laptop:~$ gem -v 1.3.6 gokul@gokul-laptop:~$ For rails, gokul@gokul-laptop:~$sudo gem install rails doesnt seem to give any response. so used the synaptic package manager for installing it. And it seems to have installed correctly. gokul@gokul-laptop:~$ rails Usage: /usr/bin/rails /path/to/your/app [options] Options: -r, --ruby=path Path to the Ruby binary of your choice (otherwise scripts use env, dispatchers current path). Default: /usr/bin/ruby1.8 -d, --database=name Preconfigure for selected database (options: mysql/oracle/postgresql/sqlite2/sqlite3/frontbase/ibm_db). Default: sqlite3 -D, --with-dispatchers Add CGI/FastCGI/mod_ruby dispatches code to generated application skeleton Default: false --freeze Freeze Rails in vendor/rails from the gems generating the skeleton Default: false -m, --template=path Use an application template that lives at path (can be a filesystem path or URL). Default: (none) Rails Info: -v, --version Show the Rails version number and quit. -h, --help Show this help message and quit. General Options: -p, --pretend Run but do not make any changes. -f, --force Overwrite files that already exist. -s, --skip Skip files that already exist. -q, --quiet Suppress normal output. -t, --backtrace Debugging: show backtrace on errors. -c, --svn Modify files with subversion. (Note: svn must be in path) -g, --git Modify files with git. (Note: git must be in path) Description: The 'rails' command creates a new Rails application with a default directory structure and configuration at the path you specify. Example: rails ~/Code/Ruby/weblog This generates a skeletal Rails installation in ~/Code/Ruby/weblog. See the README in the newly created application to get going. gokul@gokul-laptop:~$ app folder is created with all the proper folders. The problem starts with the following commands... gokul@gokul-laptop:~$ sudo gem install bundler [sudo] password for gokul: Successfully installed bundler-0.9.24 1 gem installed Installing ri documentation for bundler-0.9.24... Installing RDoc documentation for bundler-0.9.24... gokul@gokul-laptop:~$ bundle install Could not locate Gemfile gokul@gokul-laptop:~$ coming to the database, the default sqlite3 seems to have installed correctly. gokul@gokul-laptop:~$ sqlite3 SQLite version 3.6.16 Enter ".help" for instructions Enter SQL statements terminated with a ";" sqlite The welcome aboard page is not being able to be found at (http://localhost:3000) after executing the following commands... gokul@gokul-laptop:~/Desktop$ rails blog create create app/controllers create app/helpers create app/models create app/views/layouts create config/environments create config/initializers create config/locales create db create doc create lib create lib/tasks create log create public/images create public/javascripts create public/stylesheets create script/performance create test/fixtures create test/functional create test/integration create test/performance create test/unit create vendor create vendor/plugins create tmp/sessions create tmp/sockets create tmp/cache create tmp/pids create Rakefile create README create app/controllers/application_controller.rb create app/helpers/application_helper.rb create config/database.yml create config/routes.rb create config/locales/en.yml create db/seeds.rb create config/initializers/backtrace_silencers.rb create config/initializers/inflections.rb create config/initializers/mime_types.rb create config/initializers/new_rails_defaults.rb create config/initializers/session_store.rb create config/environment.rb create config/boot.rb create config/environments/production.rb create config/environments/development.rb create config/environments/test.rb create script/about create script/console create script/dbconsole create script/destroy create script/generate create script/runner create script/server create script/plugin create script/performance/benchmarker create script/performance/profiler create test/test_helper.rb create test/performance/browsing_test.rb create public/404.html create public/422.html create public/500.html create public/index.html create public/favicon.ico create public/robots.txt create public/images/rails.png create public/javascripts/prototype.js create public/javascripts/effects.js create public/javascripts/dragdrop.js create public/javascripts/controls.js create public/javascripts/application.js create doc/README_FOR_APP create log/server.log create log/production.log create log/development.log create log/test.log gokul@gokul-laptop:~/Desktop$ cd blog gokul@gokul-laptop:~/Desktop/blog$ rake db:create (in /home/gokul/Desktop/blog) gokul@gokul-laptop:~/Desktop/blog$ rails server create create app/controllers create app/helpers create app/models create app/views/layouts create config/environments create config/initializers create config/locales create db create doc create lib create lib/tasks create log create public/images create public/javascripts create public/stylesheets create script/performance create test/fixtures create test/functional create test/integration create test/performance create test/unit create vendor create vendor/plugins create tmp/sessions create tmp/sockets create tmp/cache create tmp/pids create Rakefile create README create app/controllers/application_controller.rb create app/helpers/application_helper.rb create config/database.yml create config/routes.rb create config/locales/en.yml create db/seeds.rb create config/initializers/backtrace_silencers.rb create config/initializers/inflections.rb create config/initializers/mime_types.rb create config/initializers/new_rails_defaults.rb create config/initializers/session_store.rb create config/environment.rb create config/boot.rb create config/environments/production.rb create config/environments/development.rb create config/environments/test.rb create script/about create script/console create script/dbconsole create script/destroy create script/generate create script/runner create script/server create script/plugin create script/performance/benchmarker create script/performance/profiler create test/test_helper.rb create test/performance/browsing_test.rb create public/404.html create public/422.html create public/500.html create public/index.html create public/favicon.ico create public/robots.txt create public/images/rails.png create public/javascripts/prototype.js create public/javascripts/effects.js create public/javascripts/dragdrop.js create public/javascripts/controls.js create public/javascripts/application.js create doc/README_FOR_APP create log/server.log create log/production.log create log/development.log create log/test.log gokul@gokul-laptop:~/Desktop/blog$ hope some one can help me with this...

    Read the article

  • BizTalk server problem

    - by WtFudgE
    Hi, we have a biztalk server (a virtual one (1!)...) at our company, and an sql server where the data is being kept. Now we have a lot of data traffic. I'm talking about hundred of thousands. So I'm actually not even sure if one server is pretty safe, but our company is not that easy to convince. Now recently we have a lot of problems. Allow me to situate in detail, so I'm not missing anything: Our server has 5 applications: One with 3 orchestrations, 12 send ports, 16 receive locations. One with 4 orchestrations, 32 send ports, 20 receive locations. One with 4 orchestrations, 24 send ports, 20 receive locations. One with 47 (yes 47) orchestrations, 37 send ports, 6 receive locations. One with common application with a couple of resources. Our problems have occured since we deployed the applications with the 47 orchestrations. A lot of these orchestrations use assign shapes which use c# code to do the mapping. This is because we use HL7 extensions and this is kind of special, so by using c# code & xpath it was a lot easier to do the mapping because a lot of these schema's look alike. The c# reads in XmlNodes received through xpath, and returns XmlNode which are then assigned again to biztalk messages. I'm not sure if this could be the cause, but I thought I'd mention it. The send and receive ports have a lot of different types: File, MQSeries, SQL, MLLP, FTP. Each of these types have a different host instances, to balance out the load. Our orchestrations use the BiztalkApplication host. On this server also a couple of scripts are running, mostly ftp upload scripts & also a zipper script, which zips files every half an hour in a daily zip and deletes the zip files after a month. We use this zipscript on our backup files (we backup a lot, backups are also on our server), we did this because the server had problems with sending files to a location where there were a lot (A LOT) of files, so after the files were reduced to zips it went better. Now the problems we are having recently are mainly two major problems: Our most important problem is the following. We kept a receive location with a lot of messages on a queue for testing. After we start this receive location which uses the 47 orchestrations, the running service instances start to sky rock. Ok, this is pretty normal. Let's say about 10000, and then we stop the receive location to see how biztalk handles these 10000 instances. Normally they would go down pretty fast, and it does sometimes, but after a while it starts to "throttle", meaning they just stop being processed and the service instances stay at the same number, for example in 30 seconds it goes down from 10000 to 4000 and then it stays at 4000 and it lowers very very very slowly, like 30 in 5minutes or something. So this means, that all the other service instances of the other applications are also stuck in here, and they are also not processed. We noticed that after restarting our host instances the instance number went down fast again. So we tried to selectively restart different host instances to locate the problem. We noticed that eventually restarting the file send/receive host instance would do the trick. So we thought file sends would be the problem. Concidering that we make a lot of backups. So we replaced the file type backups with mqseries backups. The same problem occured, and funny thing, restarting the file send/receive host still fixes the problem. No errors can be found in the event viewer either. A second problem we're having is. That sometimes at arround 6 am, all or a part of the host instances are being stopped. In the event viewer we noticed the following errors (these are more than one): The receive location "MdnBericht SQL" with URL "SQL://ZNACDBPEG/mdnd0001/" is shutting down. Details:"The error threshold has been exceeded. The receive location is shutting down.". The Messaging Engine failed to add a receive location "M2m Othello Export Start Bestand" with URL "\m2mservices\Othello_import$\DataFilter Start*.xml" to the adapter "FILE". Reason: "The FILE adapter cannot access the folder \m2mservices\Othello_import$\DataFilter Start. Verify this folder exists. Error: Logon failure: unknown user name or bad password. ". The FILE adapter cannot access the folder \m2mservices\Othello_import$\DataFilter Start. Verify this folder exists. Error: Logon failure: unknown user name or bad password. An attempt to connect to "BizTalkMsgBoxDb" SQL Server database on server "ZNACDBBTS" failed. Error: "Login failed for user ''. The user is not associated with a trusted SQL Server connection." It woould seem that there's a login failure at this time and that because of it other services are also experiencing problems, and eventually they are shut down. The thing is, our user is admin, and it's impossible that it's password is wrong "sometimes". We have concidering that the problem could be due to an infrastructure problem, but that's not really are department. I know it's a long post, but we're not sure anymore what to do. Would adding another server and balancing the load solve our problems? Is there a way to meassure our balance and know where to start splitting? What are normal numbers of load etc? I appreciate any answers because these issues are getting worse and we're also on a deadline. Thanks a lot for replies!

    Read the article

  • LINQ 4 XML - What is the proper way to query deep in the tree structure?

    - by Keith Barrows
    I have an XML structure that is 4 deep: <?xml version="1.0" encoding="utf-8"?> <EmailRuleList xmlns:xsd="EmailRules.xsd"> <TargetPST name="Tech Communities"> <Parse emailAsList="true" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="@aspadvice.com" folder="Lists, ASP" saveAttachments="false" /> <EmailRule address="@sqladvice.com" folder="Lists, SQL" saveAttachments="false" /> <EmailRule address="@xmladvice.com" folder="Lists, XML" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Special Interest Groups|Northern Colorado Architects Group" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|SpamBayes" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Support|GoDaddy" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|No-IP.com" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Discussions|Orchard Project" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@agilejournal.com" folder="Newsletters|Agile Journal" saveAttachments="false"/> <EmailRule address="@axosoft.ccsend.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@axosoft.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@cmcrossroads.com" folder="Newsletters|CM Crossroads" saveAttachments="false" /> <EmailRule address="@urbancode.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@urbancode.ccsend.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@Infragistics.com" folder="Newsletters|Infragistics" saveAttachments="false" /> <EmailRule address="@zdnet.online.com" folder="Newsletters|ZDNet Tech Update Today" saveAttachments="false" /> <EmailRule address="@sqlservercentral.com" folder="Newsletters|SQLServerCentral.com" saveAttachments="false" /> <EmailRule address="@simple-talk.com" folder="Newsletters|Simple-Talk Newsletter" saveAttachments="false" /> </Parse> </TargetPST> <TargetPST name="[Sharpen the Saw]"> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|LinkedIn USMC" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|Cruise Critic" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@moody.edu" folder="Social|5 Love Languages" saveAttachments="false" /> <EmailRule address="@postmaster.twitter.com" folder="Social|Twitter" saveAttachments="false"/> <EmailRule address="@diabetes.org" folder="Physical|American Diabetes Association" saveAttachments="false"/> <EmailRule address="@membership.webshots.com" folder="Social|Webshots" saveAttachments="false"/> </Parse> </TargetPST> </EmailRuleList> Now, I have both an FromAddress and a ToAddress that is parsed from an incoming email. I would like to do a LINQ query against a class set that was deserialized from this XML. For instance: ToAddress = [email protected] FromAddress = [email protected] Query: Get EmailRule.Include(Parse).Include(TargetPST) where address == ToAddress AND Parse.ToAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [ToAddress Domain Only] AND Parse.ToAddress==true AND Parse.useJustDomain==true Get EmailRule.Include(Parse).Include(TargetPST) where address == FromAddress AND Parse.FromAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [FromAddress Domain Only] AND Parse.FromAddress==true AND Parse.useJustDomain==true I am having a hard time figuring this LINQ query out. I can, of course, loop on all the bits in the XML like so (includes deserialization into objects): XmlSerializer s = new XmlSerializer(typeof(EmailRuleList)); TextReader r = new StreamReader(path); _emailRuleList = (EmailRuleList)s.Deserialize(r); TargetPST[] PSTList = _emailRuleList.Items; foreach (TargetPST targetPST in PSTList) { olRoot = GetRootFolder(targetPST.name); if (olRoot != null) { Parse[] ParseList = targetPST.Items; foreach (Parse parseRules in ParseList) { EmailRule[] EmailRuleList = parseRules.Items; foreach (EmailRule targetFolders in EmailRuleList) { } } } } However, this means going through all these loops for each and every address. It makes more sense to me to query against the Objects. Any tips appreciated!

    Read the article

  • Unable to use factory girl with Cucumber and rails 3 (bundler problem)

    - by jbpros
    Hi there, I'm trying to run cucumber features with factory girl factories on a fresh Rails 3 application. Here is my Gemfile: source "http://gemcutter.org" gem "rails", "3.0.0.beta" gem "pg" gem "factory_girl", :git => "git://github.com/thoughtbot/factory_girl.git", :branch => "rails3" gem "rspec-rails", ">= 2.0.0.beta.4" gem "capybara" gem "database_cleaner" gem "cucumber-rails", :require => false Then the bundle install commande just runs smoothly: $ bundle install /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/installer.rb:81:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement Updating git://github.com/thoughtbot/factory_girl.git Fetching source index from http://gemcutter.org Resolving dependencies Installing abstract (1.0.0) from system gems Installing actionmailer (3.0.0.beta) from system gems Installing actionpack (3.0.0.beta) from system gems Installing activemodel (3.0.0.beta) from system gems Installing activerecord (3.0.0.beta) from system gems Installing activeresource (3.0.0.beta) from system gems Installing activesupport (3.0.0.beta) from system gems Installing arel (0.2.1) from system gems Installing builder (2.1.2) from system gems Installing bundler (0.9.13) from system gems Installing capybara (0.3.6) from system gems Installing cucumber (0.6.3) from system gems Installing cucumber-rails (0.3.0) from system gems Installing culerity (0.2.9) from system gems Installing database_cleaner (0.5.0) from system gems Installing diff-lcs (1.1.2) from system gems Installing erubis (2.6.5) from system gems Installing factory_girl (1.2.3) from git://github.com/thoughtbot/factory_girl.git (at rails3) Installing ffi (0.6.3) from system gems Installing i18n (0.3.6) from system gems Installing json_pure (1.2.3) from system gems Installing mail (2.1.3) from system gems Installing memcache-client (1.7.8) from system gems Installing mime-types (1.16) from system gems Installing nokogiri (1.4.1) from system gems Installing pg (0.9.0) from system gems Installing polyglot (0.3.0) from system gems Installing rack (1.1.0) from system gems Installing rack-mount (0.4.7) from system gems Installing rack-test (0.5.3) from system gems Installing rails (3.0.0.beta) from system gems Installing railties (3.0.0.beta) from system gems Installing rake (0.8.7) from system gems Installing rspec (2.0.0.beta.4) from system gems Installing rspec-core (2.0.0.beta.4) from system gems Installing rspec-expectations (2.0.0.beta.4) from system gems Installing rspec-mocks (2.0.0.beta.4) from system gems Installing rspec-rails (2.0.0.beta.4) from system gems Installing selenium-webdriver (0.0.17) from system gems Installing term-ansicolor (1.0.5) from system gems Installing text-format (1.0.0) from system gems Installing text-hyphen (1.0.0) from system gems Installing thor (0.13.4) from system gems Installing treetop (1.4.4) from system gems Installing tzinfo (0.3.17) from system gems Installing webrat (0.7.0) from system gems Your bundle is complete! When I run cucumber, here is the error I get: $ rake cucumber (in /home/jbpros/projects/deorbitburn) /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/resolver.rb:97:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement NOTICE: CREATE TABLE will create implicit sequence "posts_id_seq" for serial column "posts.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "posts_pkey" for table "posts" /usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/lib:lib" "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber" --profile default Using the default profile... git://github.com/thoughtbot/factory_girl.git (at rails3) is not checked out. Please run `bundle install` (Bundler::PathError) /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:282:in `load_spec_files' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:190:in `local_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:36:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `each' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:34:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:14:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:13:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:55:in `resolve_locally' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:28:in `specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:65:in `specs_for' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:23:in `requested_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/runtime.rb:18:in `setup' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler.rb:68:in `setup' /home/jbpros/projects/deorbitburn/config/boot.rb:7 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/application.rb:1 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/environment.rb:2 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/features/support/env.rb:8 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/rb_support/rb_language.rb:124:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:85:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:77:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `each' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:48:in `execute!' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:20:in `execute' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber:8 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1....] (See full trace by running task with --trace) Do I have to do something special for bundler to check out factory girl's repository on github?

    Read the article

  • How to manage maintenance/bug-fix branches in Subversion when setup projects need to be built?

    - by Mike Spross
    We have a suite of related products written in VB6, with some C# and VB.NET projects, and all the source is kept in a single Subversion repository. We haven't been using branches in Subversion (although we do tag releases now), and simply do all development in trunk, creating new releases when the trunk is stable enough. This causes no end of grief when we release a new version, issues are found with it, and we have already begun working on new features or major changes to the trunk. In the past, we would address this in one of two ways, depending on the severity of the issues and how stable we thought the trunk was: Hurry to stabilize the trunk, fix the issues, and then release a maintenance update based on the HEAD revision, but this had the side effect of releases that fixed the bugs but introduced new issues because of half-finished features or bugfixes that were in trunk. Make customers wait until the next official release, which is usually a few months. We want to change our policies to better deal with this situation. I was considering creating a "maintenance branch" in Subversion whenever I tag an official release. Then, new development would continue in trunk, and I can periodically merge specific fixes from trunk into the maintenance branch, and create a maintenance release when enough fixes are accumulated, while we continue to work on the next major update in parallel. I know we could also have a more stable trunk and create a branch for new updates instead, but keeping current development in trunk seems simpler to me. The major problem is that while we can easily branch the source code from a release tag and recompile it to get the binaries for that release, I'm not sure how to handle the setup and installer projects. We use QSetup to create all of our setup programs, and right now when we need to modify a setup project, we just edit the project file in-place (all the setup projects and any dependencies that we don't compile ourselves are stored on a separate server, and we make sure to always compile the setup projects on that machine only). However, since we may add or remove files to the setup as our code changes, there is no guarantee that today's setup projects will work with yesterday's source code. I was going to put all the QSetup projects in Subversion to deal with this, but I see some problems with this approach. I want the creation of setup programs to be as automated as possible, and at the very least, I want a separate build machine where I can build the release that I want (grabbing the code from Subversion first), grab the setup project for that release from Subversion, recompile the setup, and then copy the setup to another place on the network for QA testing and eventual release to customers. However, when someone needs to change a setup project (to add a new dependency that trunk now requires or to make other changes), there is a problem. If they treat it like a source file and check it out on their own machine to edit it, they won't be able to add files to the project unless they first copy the files they need to add to the build machine (so they are available to other developers), then copy all the other dependencies from the build machine to their machine, making sure to match the folder structure exactly. The issue here is that QSetup uses absolute paths for any files added to a setup project. However, this means installing a bunch of setup dependencies onto development machines, which seems messy (and which could destabilize the development environment if someone accidentally runs the setup project on their machine). Also, how do we manage third-party dependencies? For example, if the current maintenance branch used MSXML 3.0 and the trunk now requires MSXML 4.0, we can't go back and create a maintenance release if we have already replaced the MSXML library on the build machine with the latest version (assuming both versions have the same filename). The only solution I can think is to either put all the third-party dependencies in Subversion along with the source code, or to make sure we put different library versions in separate folders (i.e. C:\Setup\Dependencies\MSXML\v3.0 and C:\Setup\Dependencies\MSXML\v4.0). Is one way "better" or more common than the other? Are there any best practices for dealing with this situation? Basically, if we release v2.0 of our software, we want to be able to release v2.0.1, v2.0.2, and v.2.0.3 while we work on v2.1, but the whole setup/installation project and setup dependency issue is making this more complicated than the typical "just create a branch in Subversion and recompile as needed" answer.

    Read the article

  • w3schools xsd example won't work with dom4j. How do I use dom4j to validate xml using xsds?

    - by HappyEngineer
    I am trying to use dom4j to validate the xml at http://www.w3schools.com/Schema/schema_example.asp using the xsd from that same page. It fails with the following error: org.xml.sax.SAXParseException: cvc-elt.1: Cannot find the declaration of element 'shiporder'. I'm using the following code: SAXReader reader = new SAXReader(); reader.setValidation(true); reader.setFeature("http://apache.org/xml/features/validation/schema", true); reader.setErrorHandler(new XmlErrorHandler()); reader.read(in); where in is an InputStream and XmlErrorHandler is a simple class that just logs all errors. I'm using the following xml file: <?xml version="1.0" encoding="ISO-8859-1"?> <shiporder orderid="889923" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="test1.xsd"> <orderperson>John Smith</orderperson> <shipto> <name>Ola Nordmann</name> <address>Langgt 23</address> <city>4000 Stavanger</city> <country>Norway</country> </shipto> <item> <title>Empire Burlesque</title> <note>Special Edition</note> <quantity>1</quantity> <price>10.90</price> </item> <item> <title>Hide your heart</title> <quantity>1</quantity> <price>9.90</price> </item> </shiporder> and the corresponding xsd: <?xml version="1.0" encoding="ISO-8859-1" ?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:simpleType name="stringtype"> <xs:restriction base="xs:string"/> </xs:simpleType> <xs:simpleType name="inttype"> <xs:restriction base="xs:positiveInteger"/> </xs:simpleType> <xs:simpleType name="dectype"> <xs:restriction base="xs:decimal"/> </xs:simpleType> <xs:simpleType name="orderidtype"> <xs:restriction base="xs:string"> <xs:pattern value="[0-9]{6}"/> </xs:restriction> </xs:simpleType> <xs:complexType name="shiptotype"> <xs:sequence> <xs:element name="name" type="stringtype"/> <xs:element name="address" type="stringtype"/> <xs:element name="city" type="stringtype"/> <xs:element name="country" type="stringtype"/> </xs:sequence> </xs:complexType> <xs:complexType name="itemtype"> <xs:sequence> <xs:element name="title" type="stringtype"/> <xs:element name="note" type="stringtype" minOccurs="0"/> <xs:element name="quantity" type="inttype"/> <xs:element name="price" type="dectype"/> </xs:sequence> </xs:complexType> <xs:complexType name="shipordertype"> <xs:sequence> <xs:element name="orderperson" type="stringtype"/> <xs:element name="shipto" type="shiptotype"/> <xs:element name="item" maxOccurs="unbounded" type="itemtype"/> </xs:sequence> <xs:attribute name="orderid" type="orderidtype" use="required"/> </xs:complexType> <xs:element name="shiporder" type="shipordertype"/> </xs:schema> The xsd and xml file are in the same directory. What is the problem?

    Read the article

  • Ejabberd clustering problem with amazon EC2 server

    - by user353362
    Hello Guys! I have been trying to install ejabberd server on Amazons EC2 instance. I am kinds a stuck at this step right now. I am following this guide: http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes... From the guide I have sucessfully completed the Set up First Node (on ejabberd1) part. But am stuck in part 4 of Set up Second Node (on ejabberd2) So all in all, I created the main node and am able to run the server on that node and access its admin console from then internet. In the second node I have installed ejabberd. But I am stuck at point 4 of setting up the node instruction presented in this blog (http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes...). I execute this command " erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia " on the second server and get a crashing error: root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,52,25}},"Protocol: ~p: register error: ~p~n",["inet_tcp",{{badmatch,{error,duplicate_name}},[{inet_tcp_dist,listen,1},{net_kernel,start_protos,4},{net_kernel,start_protos,3},{net_kernel,init_node,2},{net_kernel,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.21.0},{registered_name,net_kernel},{error_info,{exit,{error,badarg},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{net_kernel,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[#Port<0.52,<0.18.0]},{dictionary,[{longnames,false}]},{trap_exit,true},{status,running},{heap_size,610},{stack_size,23},{reductions,518}],[]]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{'EXIT',nodistribution}},{offender,[{pid,undefined},{name,net_kernel},{mfa,{net_kernel,start_link,[['ejabberd@domU-12-31-39-0F-7D-14',shortnames]]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,52,25}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# any idea what going on? I am not really sure how to solve this problem :S how to let ejabberd only access register from one special server? › Is that the right way of copying .erlang.cookie file? Submitted by privateson on Sat, 2010-05-29 00:11. before this I was getting this error (see below), I solved it by running this command: chmod 400 .erlang.cookie Also to copy the cookie I simply created a file using vi on the second server and copied the secret code from server one to the second server. Is that the right way of copying .erlang.cookie file? ERROR ~~~~~~~~~~ root@domU-12-31-39-0F-7D-14:/etc/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,28,56}},"Cookie file /root/.erlang.cookie must be accessible by owner only",[]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.20.0},{registered_name,auth},{error_info,{exit,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{auth,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[<0.18.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,987},{stack_size,23},{reductions,439}],[]]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{offender,[{pid,undefined},{name,auth},{mfa,{auth,start_link,[]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,28,56}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# cat /var/log/ejabberd/ejabberd.log =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:154) : pubsub init "localhost" [{access_createnode, pubsub_createnode}, {plugins, ["default","pep"]}] =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:210) : ** tree plugin is nodetree_default =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init default plugin =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init pep plugin =ERROR REPORT==== 2010-05-28 23:40:08 === ** Connection attempt from disallowed node 'ejabberdctl1275090008486951000@domU-12-31-39-0F-7D-14' ** =ERROR REPORT==== 2010-05-28 23:41:10 === ** Connection attempt from disallowed node 'ejabberdctl1275090070163253000@domU-12-31-39-0F-7D-14' **

    Read the article

  • How to merge two different Makefiles?

    - by martijnn2008
    I have did some reading on "Merging Makefiles", one suggest I should leave the two Makefiles separate in different folders [1]. For me this look counter intuitive, because I have the following situation: I have 3 source files (main.cpp flexibility.cpp constraints.cpp) one of them (flexibility.cpp) is making use of the COIN-OR Linear Programming library (Clp) When installing this library on my computer it makes sample Makefiles, which I have adjust the Makefile and it currently makes a good working binary. # Copyright (C) 2006 International Business Machines and others. # All Rights Reserved. # This file is distributed under the Eclipse Public License. # $Id: Makefile.in 726 2006-04-17 04:16:00Z andreasw $ ########################################################################## # You can modify this example makefile to fit for your own program. # # Usually, you only need to change the five CHANGEME entries below. # ########################################################################## # To compile other examples, either changed the following line, or # add the argument DRIVER=problem_name to make DRIVER = main # CHANGEME: This should be the name of your executable EXE = clp # CHANGEME: Here is the name of all object files corresponding to the source # code that you wrote in order to define the problem statement OBJS = $(DRIVER).o constraints.o flexibility.o # CHANGEME: Additional libraries ADDLIBS = # CHANGEME: Additional flags for compilation (e.g., include flags) ADDINCFLAGS = # CHANGEME: Directory to the sources for the (example) problem definition # files SRCDIR = . ########################################################################## # Usually, you don't have to change anything below. Note that if you # # change certain compiler options, you might have to recompile the # # COIN package. # ########################################################################## COIN_HAS_PKGCONFIG = TRUE COIN_CXX_IS_CL = #TRUE COIN_HAS_SAMPLE = TRUE COIN_HAS_NETLIB = #TRUE # C++ Compiler command CXX = g++ # C++ Compiler options CXXFLAGS = -O3 -pipe -DNDEBUG -pedantic-errors -Wparentheses -Wreturn-type -Wcast-qual -Wall -Wpointer-arith -Wwrite-strings -Wconversion -Wno-unknown-pragmas -Wno-long-long -DCLP_BUILD # additional C++ Compiler options for linking CXXLINKFLAGS = -Wl,--rpath -Wl,/home/martijn/Downloads/COIN/coin-Clp/lib # C Compiler command CC = gcc # C Compiler options CFLAGS = -O3 -pipe -DNDEBUG -pedantic-errors -Wimplicit -Wparentheses -Wsequence-point -Wreturn-type -Wcast-qual -Wall -Wno-unknown-pragmas -Wno-long-long -DCLP_BUILD # Sample data directory ifeq ($(COIN_HAS_SAMPLE), TRUE) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) CXXFLAGS += -DSAMPLEDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatasample`\" CFLAGS += -DSAMPLEDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatasample`\" else CXXFLAGS += -DSAMPLEDIR=\"\" CFLAGS += -DSAMPLEDIR=\"\" endif endif # Netlib data directory ifeq ($(COIN_HAS_NETLIB), TRUE) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) CXXFLAGS += -DNETLIBDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatanetlib`\" CFLAGS += -DNETLIBDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatanetlib`\" else CXXFLAGS += -DNETLIBDIR=\"\" CFLAGS += -DNETLIBDIR=\"\" endif endif # Include directories (we use the CYGPATH_W variables to allow compilation with Windows compilers) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) INCL = `PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --cflags clp` else INCL = endif INCL += $(ADDINCFLAGS) # Linker flags ifeq ($(COIN_HAS_PKGCONFIG), TRUE) LIBS = `PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --libs clp` else ifeq ($(COIN_CXX_IS_CL), TRUE) LIBS = -link -libpath:`$(CYGPATH_W) /home/martijn/Downloads/COIN/coin-Clp/lib` libClp.lib else LIBS = -L/home/martijn/Downloads/COIN/coin-Clp/lib -lClp endif endif # The following is necessary under cygwin, if native compilers are used CYGPATH_W = echo # Here we list all possible generated objects or executables to delete them CLEANFILES = clp \ main.o \ flexibility.o \ constraints.o \ all: $(EXE) .SUFFIXES: .cpp .c .o .obj $(EXE): $(OBJS) bla=;\ for file in $(OBJS); do bla="$$bla `$(CYGPATH_W) $$file`"; done; \ $(CXX) $(CXXLINKFLAGS) $(CXXFLAGS) -o $@ $$bla $(LIBS) $(ADDLIBS) clean: rm -rf $(CLEANFILES) .cpp.o: $(CXX) $(CXXFLAGS) $(INCL) -c -o $@ `test -f '$<' || echo '$(SRCDIR)/'`$< .cpp.obj: $(CXX) $(CXXFLAGS) $(INCL) -c -o $@ `if test -f '$<'; then $(CYGPATH_W) '$<'; else $(CYGPATH_W) '$(SRCDIR)/$<'; fi` .c.o: $(CC) $(CFLAGS) $(INCL) -c -o $@ `test -f '$<' || echo '$(SRCDIR)/'`$< .c.obj: $(CC) $(CFLAGS) $(INCL) -c -o $@ `if test -f '$<'; then $(CYGPATH_W) '$<'; else $(CYGPATH_W) '$(SRCDIR)/$<'; fi` The other Makefile compiles a lot of code and makes use of bison and flex. This one is also made by someone else. I am able to alter this Makefile when I want to add some code. This Makefile also makes a binary. CFLAGS=-Wall LDLIBS=-LC:/GnuWin32/lib -lfl -lm LSOURCES=lex.l YSOURCES=grammar.ypp CSOURCES=debug.cpp esta_plus.cpp heap.cpp main.cpp stjn.cpp timing.cpp tmsp.cpp token.cpp chaining.cpp flexibility.cpp exceptions.cpp HSOURCES=$(CSOURCES:.cpp=.h) includes.h OBJECTS=$(LSOURCES:.l=.o) $(YSOURCES:.ypp=.tab.o) $(CSOURCES:.cpp=.o) all: solver solver: CFLAGS+=-g -O0 -DDEBUG solver: $(OBJECTS) main.o debug.o g++ $(CFLAGS) -o $@ $^ $(LDLIBS) solver.release: CFLAGS+=-O5 solver.release: $(OBJECTS) main.o g++ $(CFLAGS) -o $@ $^ $(LDLIBS) %.o: %.cpp g++ -c $(CFLAGS) -o $@ $< lex.cpp: lex.l grammar.tab.cpp grammar.tab.hpp flex -o$@ $< %.tab.cpp %.tab.hpp: %.ypp bison --verbose -d $< ifneq ($(LSOURCES),) $(LSOURCES:.l=.cpp): $(YSOURCES:.y=.tab.h) endif -include $(OBJECTS:.o=.d) clean: rm -f $(OBJECTS) $(OBJECTS:.o=.d) $(YSOURCES:.ypp=.tab.cpp) $(YSOURCES:.ypp=.tab.hpp) $(YSOURCES:.ypp=.output) $(LSOURCES:.l=.cpp) solver solver.release 2>/dev/null .PHONY: all clean debug release Both of these Makefiles are, for me, hard to understand. I don't know what they exactly do. What I want is to merge the two of them so I get only one binary. The code compiled in the second Makefile should be the result. I want to add flexibility.cpp and constraints.cpp to the second Makefile, but when I do. I get the problem following problem: flexibility.h:4:26: fatal error: ClpSimplex.hpp: No such file or directory #include "ClpSimplex.hpp" So the compiler can't find the Clp library. I also tried to copy-paste more code from the first Makefile into the second, but it still gives me that same error. Q: Can you please help me with merging the two makefiles or pointing out a more elegant way? Q: In this case is it indeed better to merge the two Makefiles? I also tried to use cmake, but I gave upon that one quickly, because I don't know much about flex and bison.

    Read the article

  • How to refresh DataGrid and DropDown on main page after hiding modal popup

    - by James
    Hi, I am adding records to a database from a modal popup. After hiding the modal popup, the page has not been refreshed even though I have Rebound the controls. I have reviewed a few postings on the web about this but the solution still evades me. I have attached my code after removing some of the extra detail... It seems I need to cause a postback but I don't know what needs to be changed. Some posts have talked about the extender being misplaced. Anyway, thank you James <asp:Content ID="Content1" ContentPlaceHolderID="Head" Runat="Server"> <div class="divBorder"> <asp:DataGrid id="dgrSessionFolders" runat="server" BorderWidth="2px" BorderStyle="Solid" BorderColor="#C0C0FF" Font-Names="Arial" Font-Bold="True" Font-Size="8pt" GridLines="Horizontal" AutoGenerateColumns="False" PageSize="9999" AllowPaging="False" OnItemCommand="dgrSessionFolders_Command" OnItemDataBound="CheckSessionFolderStatus" HorizontalAlign="Left" ForeColor="Blue" ShowFooter="True" CellPadding="2" OnSortCommand="dgrSessionFolders_Sort" AllowSorting="True"> </asp:DataGrid> </div> &nbsp;&nbsp;&nbsp; <asp:Label ID="Errormsg" runat="server" ForeColor="#CC0000"></asp:Label> <asp:UpdatePanel ID="UpdatePanel1" runat="server" RenderMode="Inline" ChildrenAsTriggers="false" UpdateMode="Conditional"> <Triggers> <asp:AsyncPostBackTrigger ControlID="btnEditTopic" /> <asp:AsyncPostBackTrigger ControlID="btnAdd" /> <asp:AsyncPostBackTrigger ControlID="btnUpdate" /> <asp:AsyncPostBackTrigger ControlID="btnDelete" /> <asp:AsyncPostBackTrigger ControlID="btnClear" /> <asp:AsyncPostBackTrigger ControlID="btnAddTopic" /> <asp:AsyncPostBackTrigger ControlID="btnUpdateTopic" /> <asp:AsyncPostBackTrigger ControlID="btnDeleteTopic" /> </Triggers> <ContentTemplate> <asp:panel id="pnl" runat="server" HorizontalAlign="Center" Height="48px" Width="100%" > &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <asp:ImageButton ID="btnEditTopic" runat="server" AlternateText="Edit Topic" ImageUrl="~/App_Themes/Common/images/BtnEditTopic.jpg" Height="28px"> </asp:ImageButton> <cc1:ModalPopupExtender ID="btnEditTopic_ModalPopupExtender" runat="server" BackgroundCssClass="modalBackground" DropShadow="true" Enabled="true" PopupControlID="pnlEditTopic" TargetControlID="btnEditTopicHidden" CancelControlID="btnEditTopicClose"> </cc1:ModalPopupExtender> <asp:ImageButton ID="btnAdd" runat="server" AlternateText="Add Folder" ImageUrl="~/App_Themes/Common/images/BtnAddFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnUpdate" runat="server" AlternateText="Update Folder" ImageUrl="~/App_Themes/Common/images/BtnUpdateFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnDelete" runat="server" AlternateText="Delete Folder" ImageUrl="~/App_Themes/Common/images/BtnDeleteFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="BtnClear" runat="server" AlternateText="Clear Screen Input Fields" ImageUrl="~/App_Themes/Common/images/BtnAddMode.jpg" Height="28px"> </asp:ImageButton> <asp:Button ID="btnEditTopicHidden" runat="server" Enabled="false" Text="" Style="visibility: hidden" /> </asp:panel> <asp:Panel ID="pnlEditTopic" runat="server" CssClass="modalPopupEditTopic" Style="display: none;" > <table cellspacing="0" class="borderTable0" width="100%" style=""> <tr> <td colspan="10" class="Subhdr" align="center" style="width:100%"> <asp:label id="lblTopicScreenHdr" Cssclass="ScreenHdr" runat="server">Topic Maintenance</asp:label> </td> </tr> <tr> <td colspan="6"> <asp:Label ID="TopicPopErrorMsg" runat="server" ForeColor="#CC0000">&nbsp;</asp:Label> </td> </tr> <tr style="height:4px"> <td colspan="6" align="center"> <asp:ImageButton ID="btnAddTopic" runat="server" AlternateText="Add Topic" ImageUrl="~/App_Themes/Common/images/BtnApply.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnUpdateTopic" runat="server" AlternateText="Update Topic" ImageUrl="~/App_Themes/Common/images/BtnApply.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnDeleteTopic" runat="server" AlternateText="Delete Topic" ImageUrl="~/App_Themes/Common/images/BtnDelete.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnEditTopicClose" runat="server" AlternateText="Close Edit Topic Popup" ImageUrl="~/App_Themes/Common/images/BtnCancel.jpg" Height="28px"> </asp:ImageButton> </td> </tr> </table> </asp:Panel> </ContentTemplate> </asp:UpdatePanel> Private Sub btnAddTopic_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnAddTopic.Click 'Add the Topic table entry AddTopic() 'Display an informational message Errormsg.Text = "The Topic has been successfully added, thank you! " Errormsg.ForeColor = Drawing.Color.Blue 'Rebind the Topic Drop Down and set to added Topic ddlSessionTopic.DataBind() ddlSessionTopic.SelectedValue = drTopic("TOPC_ID") 'Rebind the Session Folders grid RebindGrid() 'Hide the Topic Popup btnEditTopic_ModalPopupExtender.Hide() End Sub Private Sub RebindGrid() cnnSQL = New SqlConnection(strConnection) cmdSQL = New SqlCommand("GetSessionFoldersForGrid", cnnSQL) cmdSQL.CommandType = CommandType.StoredProcedure cmdSQL.Parameters.Clear() cnnSQL.Open() dadSQL = New SqlDataAdapter(cmdSQL) dadSQL.SelectCommand = cmdSQL dadSQL.Fill(dtSessionFolderGrid) cnnSQL.Close() dvSessionFolderGrid = dtSessionFolderGrid.DefaultView dvSessionFolderGrid.Sort = String.Format("{0} {1}{2}", so.Sortfield, so.SortDirection, so.SortSuffix) dgrSessionFolders.DataSource = dvSessionFolderGrid dgrSessionFolders.DataBind() End Sub

    Read the article

  • C#: Inheritance, Overriding, and Hiding

    - by Rosarch
    I'm having difficulty with an architectural decision for my C# XNA game. The basic entity in the world, such as a tree, zombie, or the player, is represented as a GameObject. Each GameObject is composed of at least a GameObjectController, GameObjectModel, and GameObjectView. These three are enough for simple entities, like inanimate trees or rocks. However, as I try to keep the functionality as factored out as possible, the inheritance begins to feel unwieldy. Syntactically, I'm not even sure how best to accomplish my goals. Here is the GameObjectController: public class GameObjectController { protected GameObjectModel model; protected GameObjectView view; public GameObjectController(GameObjectManager gameObjectManager) { this.gameObjectManager = gameObjectManager; model = new GameObjectModel(this); view = new GameObjectView(this); } public GameObjectManager GameObjectManager { get { return gameObjectManager; } } public virtual GameObjectView View { get { return view; } } public virtual GameObjectModel Model { get { return model; } } public virtual void Update(long tick) { } } I want to specify that each subclass of GameObjectController will have accessible at least a GameObjectView and GameObjectModel. If subclasses are fine using those classes, but perhaps are overriding for a more sophisticated Update() method, I don't want them to have to duplicate the code to produce those dependencies. So, the GameObjectController constructor sets those objects up. However, some objects do want to override the model and view. This is where the trouble comes in. Some objects need to fight, so they are CombatantGameObjects: public class CombatantGameObject : GameObjectController { protected new readonly CombatantGameModel model; public new virtual CombatantGameModel Model { get { return model; } } protected readonly CombatEngine combatEngine; public CombatantGameObject(GameObjectManager gameObjectManager, CombatEngine combatEngine) : base(gameObjectManager) { model = new CombatantGameModel(this); this.combatEngine = combatEngine; } public override void Update(long tick) { if (model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); } base.Update(tick); } } Still pretty simple. Is my use of new to hide instance variables correct? Note that I'm assigning CombatantObjectController.model here, even though GameObjectController.Model was already set. And, combatants don't need any special view functionality, so they leave GameObjectController.View alone. Then I get down to the PlayerController, at which a bug is found. public class PlayerController : CombatantGameObject { private readonly IInputReader inputReader; private new readonly PlayerModel model; public new PlayerModel Model { get { return model; } } private float lastInventoryIndexAt; private float lastThrowAt; public PlayerController(GameObjectManager gameObjectManager, IInputReader inputReader, CombatEngine combatEngine) : base(gameObjectManager, combatEngine) { this.inputReader = inputReader; model = new PlayerModel(this); Model.Health = Constants.PLAYER_HEALTH; } public override void Update(long tick) { if (Model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); for (int i = 0; i < 10; i++) { Debug.WriteLine("YOU DEAD SON!!!"); } return; } UpdateFromInput(tick); // .... } } The first time that this line is executed, I get a null reference exception: model.Body.ApplyImpulse(movementImpulse, model.Position); model.Position looks at model.Body, which is null. This is a function that initializes GameObjects before they are deployed into the world: public void Initialize(GameObjectController controller, IDictionary<string, string> data, WorldState worldState) { controller.View.read(data); controller.View.createSpriteAnimations(data, _assets); controller.Model.read(data); SetUpPhysics(controller, worldState, controller.Model.BoundingCircleRadius, Single.Parse(data["x"]), Single.Parse(data["y"]), bool.Parse(data["isBullet"])); } Every object is passed as a GameObjectController. Does that mean that if the object is really a PlayerController, controller.Model will refer to the base's GameObjectModel and not the PlayerController's overriden PlayerObjectModel? In response to rh: This means that now for a PlayerModel p, p.Model is not equivalent to ((CombatantGameObject)p).Model, and also not equivalent to ((GameObjectController)p).Model. That is exactly what I do not want. I want: PlayerController p; p.Model == ((CombatantGameObject)p).Model p.Model == ((GameObjectController)p).Model How can I do this? override?

    Read the article

  • Ignoring focusLost(), SWT.Verify, or other SWT listeners in Java code.

    - by Zoot
    Outside of the actual SWT listener, is there any way to ignore a listener via code? For example, I have a java program that implements SWT Text Widgets, and the widgets have: SWT.Verify listeners to filter out unwanted text input. ModifyListeners to wait for the correct number of valid input characters and automatically set focus (using setFocus())to the next valid field, skipping the other text widgets in the tab order. focusLost(FocusEvent) FocusListeners that wait for the loss of focus from the text widget to perform additional input verification and execute an SQL query based on the user input. The issue I run into is clearing the text widgets. One of the widgets has the format "####-##" (Four Numbers, a hyphen, then two numbers) and I have implemented this listener, which is a modified version of SWT Snippet Snippet179. The initial text for this text widget is " - " to provide visual feedback to the user as to the expected format. Only numbers are acceptable input, and the program automatically skips past the hyphen at the appropriate point. /* * This listener was adapted from the "verify input in a template (YYYY/MM/DD)" SWT Code * Snippet (also known as Snippet179), from the Snippets page of the SWT Project. * SWT Code Snippets can be found at: * http://www.eclipse.org/swt/snippets/ */ textBox.addListener(SWT.Verify, new Listener() { boolean ignore; public void handleEvent(Event e) { if (ignore) return; e.doit = false; StringBuffer buffer = new StringBuffer(e.text); char[] chars = new char[buffer.length()]; buffer.getChars(0, chars.length, chars, 0); if (e.character == '\b') { for (int i = e.start; i < e.end; i++) { switch (i) { case 0: /* [x]xxx-xx */ case 1: /* x[x]xx-xx */ case 2: /* xx[x]x-xx */ case 3: /* xxx[x]-xx */ case 5: /* xxxx-[x]x */ case 6: /* xxxx-x[x] */ { buffer.append(' '); break; } case 4: /* xxxx[-]xx */ { buffer.append('-'); break; } default: return; } } textBox.setSelection(e.start, e.start + buffer.length()); ignore = true; textBox.insert(buffer.toString()); ignore = false; textBox.setSelection(e.start, e.start); return; } int start = e.start; if (start > 6) return; int index = 0; for (int i = 0; i < chars.length; i++) { if (start + index == 4) { if (chars[i] == '-') { index++; continue; } buffer.insert(index++, '-'); } if (chars[i] < '0' || '9' < chars[i]) return; index++; } String newText = buffer.toString(); int length = newText.length(); textBox.setSelection(e.start, e.start + length); ignore = true; textBox.insert(newText); ignore = false; /* * After a valid key press, verifying if the input is completed * and passing the cursor to the next text box. */ if (7 == textBox.getCaretPosition()) { /* * Attempting to change the text after receiving a known valid input that has no results (0000-00). */ if ("0000-00".equals(textBox.getText())) { // "0000-00" is the special "Erase Me" code for these text boxes. ignore = true; textBox.setText(" - "); ignore = false; } // Changing focus to a different textBox by using "setFocus()" method. differentTextBox.setFocus(); } } } ); As you can see, the only method I've figured out to clear this text widget from a different point in the code is by assigning "0000-00" textBox.setText("000000") and checking for that input in the listener. When that input is received, the listener changes the text back to " - " (four spaces, a hyphen, then two spaces). There is also a focusLost Listener that parses this text widget for spaces, then in order to avoid unnecessary SQL queries, it clears/resets all fields if the input is invalid (i.e contains spaces). // Adding focus listener to textBox to wait for loss of focus to perform SQL statement. textBox.addFocusListener(new FocusAdapter() { @Override public void focusLost(FocusEvent evt) { // Get the contents of otherTextBox and textBox. (otherTextBox must be <= textBox) String boxFour = otherTextBox.getText(); String boxFive = textBox.getText(); // If either text box has spaces in it, don't perform the search. if (boxFour.contains(" ") || boxFive.contains(" ")) { // Don't perform SQL statements. Debug statement. System.out.println("Tray Position input contains spaces. Ignoring."); //Make all previous results invisible, if any. labels.setVisible(false); differentTextBox.setText(""); labelResults.setVisible(false); } else { //... Perform SQL statement ... } } } ); OK. Often, I use SWT MessageBox widgets in this code to communicate to the user, or wish to change the text widgets back to an empty state after verifying the input. The problem is that messageboxes seem to create a focusLost event, and using the .setText(string) method is subject to SWT.Verify listeners that are present on the text widget. Any suggestions as to selectively ignoring these listeners in code, but keeping them present for all other user input? Thank you in advance for your assistance.

    Read the article

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • Making swap faster, easier to use and exception-safe

    - by FredOverflow
    I could not sleep last night and started thinking about std::swap. Here is the familiar C++98 version: template <typename T> void swap(T& a, T& b) { T c(a); a = b; b = c; } If a user-defined class Foo uses external ressources, this is inefficient. The common idiom is to provide a method void Foo::swap(Foo& other) and a specialization of std::swap<Foo>. Note that this does not work with class templates since you cannot partially specialize a function template, and overloading names in the std namespace is illegal. The solution is to write a template function in one's own namespace and rely on argument dependent lookup to find it. This depends critically on the client to follow the "using std::swap idiom" instead of calling std::swap directly. Very brittle. In C++0x, if Foo has a user-defined move constructor and a move assignment operator, providing a custom swap method and a std::swap<Foo> specialization has little to no performance benefit, because the C++0x version of std::swap uses efficient moves instead of copies: #include <utility> template <typename T> void swap(T& a, T& b) { T c(std::move(a)); a = std::move(b); b = std::move(c); } Not having to fiddle with swap anymore already takes a lot of burden away from the programmer. Current compilers do not generate move constructors and move assignment operators automatically yet, but as far as I know, this will change. The only problem left then is exception-safety, because in general, move operations are allowed to throw, and this opens up a whole can of worms. The question "What exactly is the state of a moved-from object?" complicates things further. Then I was thinking, what exactly are the semantics of std::swap in C++0x if everything goes fine? What is the state of the objects before and after the swap? Typically, swapping via move operations does not touch external resources, only the "flat" object representations themselves. So why not simply write a swap template that does exactly that: swap the object representations? #include <cstring> template <typename T> void swap(T& a, T& b) { unsigned char c[sizeof(T)]; memcpy( c, &a, sizeof(T)); memcpy(&a, &b, sizeof(T)); memcpy(&b, c, sizeof(T)); } This is as efficient as it gets: it simply blasts through raw memory. It does not require any intervention from the user: no special swap methods or move operations have to be defined. This means that it even works in C++98 (which does not have rvalue references, mind you). But even more importantly, we can now forget about the exception-safety issues, because memcpy never throws. I can see two potential problems with this approach: First, not all objects are meant to be swapped. If a class designer hides the copy constructor or the copy assignment operator, trying to swap objects of the class should fail at compile-time. We can simply introduce some dead code that checks whether copying and assignment are legal on the type: template <typename T> void swap(T& a, T& b) { if (false) // dead code, never executed { T c(a); // copy-constructible? a = b; // assignable? } unsigned char c[sizeof(T)]; std::memcpy( c, &a, sizeof(T)); std::memcpy(&a, &b, sizeof(T)); std::memcpy(&b, c, sizeof(T)); } Any decent compiler can trivially get rid of the dead code. (There are probably better ways to check the "swap conformance", but that is not the point. What matters is that it's possible). Second, some types might perform "unusual" actions in the copy constructor and copy assignment operator. For example, they might notify observers of their change. I deem this a minor issue, because such kinds of objects probably should not have provided copy operations in the first place. Please let me know what you think of this approach to swapping. Would it work in practice? Would you use it? Can you identify library types where this would break? Do you see additional problems? Discuss!

    Read the article

  • When building a web Application project, TFS 2008 Builds two spearate projects in the _PublishedFold

    - by Steve Johnson
    Hi all, I am trying to a perform build automation on one of web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I just want the TFS 2008 to generate only the Deploy Folder and Not the Web Folder. Here is my TFSBuild.proj File <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But i dont want the generated Web Project as it conatains App_Web_xxxx.dll assemblies instead of a single compiled assembly. Please help. Thanks

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

  • Why wont this entire word doc file generate from my php script?

    - by CheeseConQueso
    Here's the php script I'm using on a linux environment: <?php include("../_inc/odbcw.php"); //connect string $cat = $_GET["cat"]; if($_GET["st"]){$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and spec_top = 'Y' and prog='UNDG' order by crs_no";} else {$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and prog='UNDG' order by crs_no";} $crs_result = @mysql_query($crs_query); header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; echo '<table border=0 width = 700>'; if($_GET["st"]){echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'<br>SPECIAL TOPICS</center></font></td></tr>';} else {echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'</center></font></td></tr>';} echo '</table>'; echo '<hr width=700>'; while($row = mysql_fetch_array($crs_result)) { $crs_no = $row['crs_no']; $title = $row['title']; $credits = $row['credits']; $abstr = $row['abstr']; $prereq = $row['prereq']; $coreq = $row['coreq']; $lab_fee = $row['lab_fee']; $rowspan = 2; if($prereq) {$rowspan++;} if($coreq) {$rowspan++;} if($lab_fee=="Y") {$rowspan++;} echo "<table border=0 width = 700>"; echo "<tr>"; echo "<td rowspan=".$rowspan." valign=top width=100><font face=arial size=2>".$crs_no."</font></td>"; echo "<td valign=top><font face=arial size=2><u>".$title."</u></font></td> <td valign=top align=right><font face=arial size=2>".$credits."</font></td>"; echo "</tr>"; echo "<tr>"; echo "<td colspan=2 valign=top align=justify><font face=arial size=2>".$abstr."</font></td>"; echo "</tr>"; if($prereq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Prerequisite: ".$prereq."</font></td>"; echo "</tr>"; } if($coreq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Coerequisite: ".$coreq."</font></td>"; echo "</tr>"; } if($lab_fee=="Y") { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Lab Fee Required</font></td>"; echo "</tr>"; } echo "</table>"; echo "<br>"; } echo "</body>"; echo "</html>"; ?> Everything works fine before the inclusion of: header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; These lines successfully bring up the dialogue box to open or save cat.doc, but after I open it, the only lines printed are: CATALOGUE COURSE DESCRIPTIONS - and the <HR> beneath this echoed text. It seems to go on lunch break for the while loop echoing section. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • When building a web application project, TFS 2008 builds two separate projects in _PublishedFolder.

    - by Steve Johnson
    I am trying to perform build automation on one of my web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I want TFS 2008 to generate only the deploy folder and not the web folder. Here is my TFSBuild.proj file: <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But I don't want the generated web project as it contains App_Web_xxxx.dll assemblies instead of a single compiled assembly. How can I do this?

    Read the article

  • Java style FOR loop in a clojure interpeter ?

    - by Kevin
    I have a basic interpreter in clojure. Now i need to implement for (initialisation; finish-test; loop-update) { statements } inside my interpreter. I will attach my interpreter code I got so far. Any help is appreciated. Interpreter (declare interpret make-env) ;; (def do-trace false) ;; ;; simple utilities (def third ; return third item in a list (fn [a-list] (second (rest a-list)))) (def fourth ; return fourth item in a list (fn [a-list] (third (rest a-list)))) (def run ; make it easy to test the interpreter (fn [e] (println "Processing: " e) (println "=> " (interpret e (make-env))))) ;; for the environment (def make-env (fn [] '())) (def add-var (fn [env var val] (cons (list var val) env))) (def lookup-var (fn [env var] (cond (empty? env) 'error (= (first (first env)) var) (second (first env)) :else (lookup-var (rest env) var)))) ;; -- define numbers (def is-number? (fn [expn] (number? expn))) (def interpret-number (fn [expn env] expn)) ;; -- define symbols (def is-symbol? (fn [expn] (symbol? expn))) (def interpret-symbol (fn [expn env] (lookup-var env expn))) ;; -- define boolean (def is-boolean? (fn [expn] (or (= expn 'true) (= expn 'false)))) (def interpret-boolean (fn [expn env] expn)) ;; -- define functions (def is-function? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'lambda (first expn))))) (def interpret-function (fn [expn env] expn)) ;; -- define addition (def is-plus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '+ (first expn))))) (def interpret-plus (fn [expn env] (+ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define subtraction (def is-minus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '- (first expn))))) (def interpret-minus (fn [expn env] (- (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define multiplication (def is-times? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '* (first expn))))) (def interpret-times (fn [expn env] (* (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define division (def is-divides? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '/ (first expn))))) (def interpret-divides (fn [expn env] (/ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define equals test (def is-equals? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '= (first expn))))) (def interpret-equals (fn [expn env] (= (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define greater-than test (def is-greater-than? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '> (first expn))))) (def interpret-greater-than (fn [expn env] (> (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define not (def is-not? (fn [expn] (and (list? expn) (= 2 (count expn)) (= 'not (first expn))))) (def interpret-not (fn [expn env] (not (interpret (second expn) env)))) ;; -- define or (def is-or? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'or (first expn))))) (def interpret-or (fn [expn env] (or (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define and (def is-and? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'and (first expn))))) (def interpret-and (fn [expn env] (and (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define with (def is-with? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'with (first expn))))) (def interpret-with (fn [expn env] (interpret (third expn) (add-var env (first (second expn)) (interpret (second (second expn)) env))))) ;; -- define if (def is-if? (fn [expn] (and (list? expn) (= 4 (count expn)) (= 'if (first expn))))) (def interpret-if (fn [expn env] (cond (interpret (second expn) env) (interpret (third expn) env) :else (interpret (fourth expn) env)))) ;; -- define function-application (def is-function-application? (fn [expn env] (and (list? expn) (= 2 (count expn)) (is-function? (interpret (first expn) env))))) (def interpret-function-application (fn [expn env] (let [function (interpret (first expn) env)] (interpret (third function) (add-var env (first (second function)) (interpret (second expn) env)))))) ;; the interpreter itself (def interpret (fn [expn env] (cond do-trace (println "Interpret is processing: " expn)) (cond ; basic values (is-number? expn) (interpret-number expn env) (is-symbol? expn) (interpret-symbol expn env) (is-boolean? expn) (interpret-boolean expn env) (is-function? expn) (interpret-function expn env) ; built-in functions (is-plus? expn) (interpret-plus expn env) (is-minus? expn) (interpret-minus expn env) (is-times? expn) (interpret-times expn env) (is-divides? expn) (interpret-divides expn env) (is-equals? expn) (interpret-equals expn env) (is-greater-than? expn) (interpret-greater-than expn env) (is-not? expn) (interpret-not expn env) (is-or? expn) (interpret-or expn env) (is-and? expn) (interpret-and expn env) ; special syntax (is-with? expn) (interpret-with expn env) (is-if? expn) (interpret-if expn env) ; functions (is-function-application? expn env) (interpret-function-application expn env) :else 'error)))

    Read the article

  • I asked this yesterday, after the input given I'm still having trouble implementing..

    - by Josh
    I'm not sure how to fix this or what I did wrong, but whenever I enter in a value it just closes out the run prompt. So, seems I do have a problem somewhere in my coding. Whenever I run the program and input a variable, it always returns the same answer.."The content at location 76 is 0." On that note, someone told me that "I don't know, but I suspect that Program A incorrectly has a fixed address being branched to on instructions 10 and 11." - mctylr but I'm not sure how to fix that.. I'm trying to figure out how to incorporate this idea from R Samuel Klatchko.. I'm still not sure what I'm missing but I can't get it to work.. const int OP_LOAD = 3; const int OP_STORE = 4; const int OP_ADD = 5; ... const int OP_LOCATION_MULTIPLIER = 100; mem[0] = OP_LOAD * OP_LOCATION_MULTIPLIER + ...; mem[1] = OP_ADD * OP_LOCATION_MULTIPLIER + ...; operand = memory[ j ] % OP_LOCATION_MULTIPLIER; operation = memory[ j ] / OP_LOCATION_MULTIPLIER; I'm new to programming, I'm not the best, so I'm going for simplicity. Also this is an SML program. Anyway, this IS a homework assignment and I'm wanting a good grade on this. So I was looking for input and making sure this program will do what I'm hoping they are looking for. Anyway, here are the instructions: Write SML (Simpletron Machine language) programs to accomplish each of the following task: A) Use a sentinel-controlled loop to read positive number s and compute and print their sum. Terminate input when a neg number is entered. B) Use a counter-controlled loop to read seven numbers, some positive and some negative, and compute + print the avg. C) Read a series of numbers, and determine and print the largest number. The first number read indicates how many numbers should be processed. Without further a due, here is my program. All together. int main() { const int READ = 10; const int WRITE = 11; const int LOAD = 20; const int STORE = 21; const int ADD = 30; const int SUBTRACT = 31; const int DIVIDE = 32; const int MULTIPLY = 33; const int BRANCH = 40; const int BRANCHNEG = 41; const int BRANCHZERO = 41; const int HALT = 43; int mem[100] = {0}; //Making it 100, since simpletron contains a 100 word mem. int operation; //taking the rest of these variables straight out of the book seeing as how they were italisized. int operand; int accum = 0; // the special register is starting at 0 int j; // This is for part a, it will take in positive variables in a sent-controlled loop and compute + print their sum. Variables from example in text. memory [0] = 1010; memory [01] = 2009; memory [02] = 3008; memory [03] = 2109; memory [04] = 1109; memory [05] = 4300; memory [06] = 1009; j = 0; //Makes the variable j start at 0. while ( true ) { operand = memory[ j ]%100; // Finds the op codes from the limit on the memory (100) operation = memory[ j ]/100; //using a switch loop to set up the loops for the cases switch ( operation ){ case 10: //reads a variable into a word from loc. Enter in -1 to exit cout <<"\n Input a positive variable: "; cin >> memory[ operand ]; break; case 11: // takes a word from location cout << "\n\nThe content at location " << operand << "is " << memory[operand]; break; case 20:// loads accum = memory[ operand ]; break; case 21: //stores memory[ operand ] = accum; break; case 30: //adds accum += mem[operand]; break; case 31: // subtracts accum-= memory[ operand ]; break; case 32: //divides accum /=(memory[ operand ]); break; case 33: // multiplies accum*= memory [ operand ]; break; case 40: // Branches to location j = -1; break; case 41: //branches if acc. is < 0 if (accum < 0) j = 5; break; case 42: //branches if acc = 0 if (accum == 0) j = 5; break; case 43: // Program ends exit(0); break; } j++; } return 0; }

    Read the article

  • clicking a button via javascript does not cause a post

    - by Andreas Niedermair
    hi there! <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jqueryui/1.8.2/jquery-ui.js"></script> </head> <body> <form id="fooForm"> <script type="text/javascript"> function FooMethod() { alert('hello'); } var fooButton; var fooForm; $(document).ready(function() { InitializeVariables(); InitiliazeDialog(); InitiliazeForm(); }); function InitializeVariables() { fooButton = $('#fooButton'); fooForm = $('#fooForm'); } function InitiliazeDialog() { var dialog = $('<div/>'); dialog.css('display', 'none'); var content = $('<p/>'); var icon = $('<span/>'); icon.addClass('ui-icon ui-icon-alert'); icon.css('float', 'left'); icon.css('margin', '0px 7px 20px 0px'); content.text('do you really want to hurt me?'); icon.prependTo(content); content.appendTo(dialog); var dialogOpenMethod = function () { dialog.dialog('open'); return false; }; var dialogOpenHandlerMethod = function (event, ui) { var widget = dialog.dialog('widget'); widget.appendTo(fooForm); var overlay = widget.prev(); overlay.css('z-index', 999); overlay.appendTo(fooForm); widget.css('position', 'fixed'); widget.css('top', '50%'); widget.css('margin-top', widget.height() / 2 * -1); widget.css('left', '50%'); widget.css('margin-left', widget.width() / 2 * -1); }; var submitMethod = function () { dialog.dialog('option', 'closeOnEscape', false); var widget = dialog.dialog('widget'); var yesButton = $(':button:eq(0)', widget); var noButton = $(':button:eq(1)', widget); var closeButton = $('a.ui-dialog-titlebar-close', widget); noButton.remove(); closeButton.remove(); fooButton.unbind('click', dialogOpenMethod); fooButton.click(); }; dialog.dialog({ autoOpen: false, modal: true, buttons: { 'Ja': submitMethod, 'Nein': function () { dialog.dialog('close'); } }, open: dialogOpenHandlerMethod }); fooButton.bind('click', dialogOpenMethod); } function InitiliazeForm() { fooButton.button(); fooForm.submit(function () { alert('doing a submit'); }); } </script> <input type="submit" id="fooButton" value="submit it!" onclick="FooMethod();"></input> </form> </body> </html> what am i doing? i want a modal-confirmation: user clicks on button, confirmation "do you really want to...?", user clicks "yes", this click unbinds the original click-handler and clicks the button again (which should cause a submit). what/why is not working? indeed you need a special case. this demo won't work, unless you set modal: false. interesting to mention: the original handler (onclick="FooMethod();") is called in modal and non-modal dialog. can anybody help me out? thanks in advance! i also opened a ticket on jqueryUI for this

    Read the article

  • 'Step Into' is suddenly not working in Visual Studio

    - by Nick LaMarca
    All of a sudden, I have run into an issue where I cannot step into any code through debugging in Visual Studio. The step over works fine, but it refuses to step into (F11) any of my code. This was working before, now all of a sudden it does not. I've tried some things below, but I still had no success: Delete all bin files in every project in my solution, clean solution, re-build solution. Build projects in solution indivdualy Restart machine It an ASP.NET C# application consuming a WCF sevice locally. It is in debug mode. I have a breakpoint set on the page consuming the service. The breakpoint hits, but it will not step into the service code. The ASP.NET site and the service code is all in the same solution. This all of a sudden does not work, it did work before. How can I fix this problem? Adding a breakpoint to the service project I get a warning: Breakpoint will not currently be hit. No symbols have been loaded for this document. I deleted all the bin folders for all the projects and re-built them one by one. They all succeeded, but still I am getting the symbols won't load on any breakpoint I put into any project in the solution other than the ASP.NET project where the breakpoint works. I was able to debug step into all the projects before, this is an all of a sudden thing. Information from the output window.. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\SMDiagnostics\v4.0_4.0.0.0__b77a5c561934e089\SMDiagnostics.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Runtime.DurableInstancing\v4.0_4.0.0.0__31bf3856ad364e35\System.Runtime.DurableInstancing.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Xaml.Hosting\v4.0_4.0.0.0__31bf3856ad364e35\System.Xaml.Hosting.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.NET\Framework\v4.0.30319\Temporary ASP.NET Files\root\2d49cf50\14eee2cf\App_Web_jmow15fw.dll', Symbols loaded. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Runtime.Serialization\v4.0_4.0.0.0__b77a5c561934e089\System.Runtime.Serialization.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.WorkflowServices\v4.0_4.0.0.0__31bf3856ad364e35\System.WorkflowServices.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Web\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Discovery\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Discovery.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Activities\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Activities.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Routing\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Routing.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Channels\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Channels.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.IdentityModel\v4.0_4.0.0.0__b77a5c561934e089\System.IdentityModel.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled.

    Read the article

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • How to manage maintenance/bug-fix branches in Subversion when third-party installers are involved?

    - by Mike Spross
    We have a suite of related products written in VB6, with some C# and VB.NET projects, and all the source is kept in a single Subversion repository. We haven't been using branches in Subversion (although we do tag releases now), and simply do all development in trunk, creating new releases when the trunk is stable enough. This causes no end of grief when we release a new version, issues are found with it, and we have already begun working on new features or major changes to the trunk. In the past, we would address this in one of two ways, depending on the severity of the issues and how stable we thought the trunk was: Hurry to stabilize the trunk, fix the issues, and then release a maintenance update based on the HEAD revision, but this had the side effect of releases that fixed the bugs but introduced new issues because of half-finished features or bugfixes that were in trunk. Make customers wait until the next official release, which is usually a few months. We want to change our policies to better deal with this situation. I was considering creating a "maintenance branch" in Subversion whenever I tag an official release. Then, new development would continue in trunk, and I can periodically merge specific fixes from trunk into the maintenance branch, and create a maintenance release when enough fixes are accumulated, while we continue to work on the next major update in parallel. I know we could also have a more stable trunk and create a branch for new updates instead, but keeping current development in trunk seems simpler to me. The major problem is that while we can easily branch the source code from a release tag and recompile it to get the binaries for that release, I'm not sure how to handle the setup and installer projects. We use QSetup to create all of our setup programs, and right now when we need to modify a setup project, we just edit the project file in-place (all the setup projects and any dependencies that we don't compile ourselves are stored on a separate server, and we make sure to always compile the setup projects on that machine only). However, since we may add or remove files to the setup as our code changes, there is no guarantee that today's setup projects will work with yesterday's source code. I was going to put all the QSetup projects in Subversion to deal with this, but I see some problems with this approach. I want the creation of setup programs to be as automated as possible, and at the very least, I want a separate build machine where I can build the release that I want (grabbing the code from Subversion first), grab the setup project for that release from Subversion, recompile the setup, and then copy the setup to another place on the network for QA testing and eventual release to customers. However, when someone needs to change a setup project (to add a new dependency that trunk now requires or to make other changes), there is a problem. If they treat it like a source file and check it out on their own machine to edit it, they won't be able to add files to the project unless they first copy the files they need to add to the build machine (so they are available to other developers), then copy all the other dependencies from the build machine to their machine, making sure to match the folder structure exactly. The issue here is that QSetup uses absolute paths for any files added to a setup project. However, this means installing a bunch of setup dependencies onto development machines, which seems messy (and which could destabilize the development environment if someone accidentally runs the setup project on their machine). Also, how do we manage third-party dependencies? For example, if the current maintenance branch used MSXML 3.0 and the trunk now requires MSXML 4.0, we can't go back and create a maintenance release if we have already replaced the MSXML library on the build machine with the latest version (assuming both versions have the same filename). The only solution I can think is to either put all the third-party dependencies in Subversion along with the source code, or to make sure we put different library versions in separate folders (i.e. C:\Setup\Dependencies\MSXML\v3.0 and C:\Setup\Dependencies\MSXML\v4.0). Is one way "better" or more common than the other? Are there any best practices for dealing with this situation? Basically, if we release v2.0 of our software, we want to be able to release v2.0.1, v2.0.2, and v.2.0.3 while we work on v2.1, but the whole setup/installation project and setup dependency issue is making this more complicated than the the typical "just create a branch in Subversion and recompile as needed" answer.

    Read the article

< Previous Page | 368 369 370 371 372 373 374 375 376 377  | Next Page >