Search Results

Search found 17070 results on 683 pages for 'expression studio 3'.

Page 374/683 | < Previous Page | 370 371 372 373 374 375 376 377 378 379 380 381  | Next Page >

  • Advanced Regex: Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URLs to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - start parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you'd like to cover even more links, but I've decided not to because I can't think of a link that would start with some obscure character) 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces were present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}" I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like my links to be replaced with shortenings as well. So when user copies a very long link (for instance if they would copy a link from google maps that usually generates long links) I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. I could as well append ellipsis at the end of at all possible (and make things even more perfect). Does Regex.Replace() method support replacement notations so that I can still use a single call? Something similar as string.Format() method does when you'd like to format values in string format (decimals, dates etc...).

    Read the article

  • Blank source file. How can I decompile the .exe? [closed]

    - by Jiexi
    Right after I finished my project for my Computer Science class, I hit save and the computer froze. When i came back, the cpp file wouldn't open through visual studio, I have the exe and object files. Please tell me I can get my source code back :( EDIT: the .cpp file is blank, and i wasn't prompted for recovery when starting visual studio again. I already checked /documents/visualstudio/backup, nothing is there.

    Read the article

  • SQL Server Express 2008

    - by robblot
    I am going to install Visual Studio 2010 Premium. I have SQL Server 2008 Express already installed on my laptop along with Visual Studio 2008 Professional. Do I have to uninstall SQL Server 2008 Express or will it be configured to operate in the 2010 Environment?

    Read the article

  • Debugging MEF running in ASP.NET

    - by Jeffrey Lott
    I'm trying to do a proof of concept app for my work using ASP.NET WebForms and the Managed Extensibility Framework. I've got things up and running(ish), but I can't seem to figure out how to attach the instance of Visual Studio that has the MEF code in it to the instance of Visual Studio that is running the Web App. How can I attach my MEF code to the running process so that it hits my breakpoints?

    Read the article

  • Where are SSIS Packages Saved?

    - by Chris
    I right clicked on a Database in the object explorer of SQL Server 2008 Management Studio. I went to Tasks Import Data, and imported some data from a flat text file, opting to save the package on the server. Now how the heck do I get to the package to edit or run it again? Where in SQL Server Management Studio do I go? I've expanded everything and I can't find it. It's driving me nuts.

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • ASP.NET LINQ to SQL SubmitChanges() doesn't update the database

    - by Alex
    In my 2nd ASP.NET MVC project I'm facing a very weird problem: when I call the SubmitChanges method of the DataContext class, nothing updates in the database. It's weird because everything works fine with my first project. I'm using a remote database created in Sql Server Management Studio, I tried doing some queries there and in Visual Studio 2010 (where I have the connection to the database), they all work. Where might the problem be hidden?

    Read the article

  • Is arithmetic overflow/underflow generally checked in .Net framework methods?

    - by YWE
    For example, let's use the Add method of the ArrayList class. If I am using the default compiler settings in Visual Studio C# project in which arithmetic overflow is not checked, would ArrayList.Add() throw an OverflowException if I added too many items? Would surrounding the method call with checked or unchecked make any difference? BTW, I would write a test program to determine the answer to this question if I had Visual Studio available to me right now.

    Read the article

  • similar to __asm int 3 in Max OS X/ Xcode?

    - by Mark
    Hi, When using visual studio to develop c++ applications, I used to write _asm int 3; and then build the application. When the application is executed, if the code path that has "_asm int 3" is encountered Visual Studio Debugger used to get lauched and I could debug the problems. Is there any similar approach when developing using Xcode on Mac OS X? Thanks a lot. Mark

    Read the article

  • Can I use cstdio in a C program?

    - by Tommy
    Can I use cstdio in a C program? I get a ton of errors in cstdio when I add the #include <cstdio> to the C program. c:\Program Files\Microsoft Visual Studio .NET 2003\Vc7\include\cstdio(17) : error C2143: syntax error : missing '{' before ':' c:\Program Files\Microsoft Visual Studio .NET 2003\Vc7\include\cstdio(17) : error C2059: syntax error : ':' Thanks EDIT - I would like to use snprintf, which is why I am trying to include this.

    Read the article

  • How can I move my Dynamic Data folder?

    - by ProfK
    I accidentally moved my Dynamic Data' folder into myImagesfolder. The project still compiles, but it's just not right. However, when I try to move it back to the root in Visual Studio, I get an error that the destination folder already exists. If I moveDynamic Data` back to the root outside of Visual Studio, the project no longer compiles because the compiler can't find any dynamic data files. My infancy with git prompted me to ask here before embarking on an unpleasant 2am quest.

    Read the article

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • can I run C# built-in unit test in build machine?

    - by 5YrsLaterDBA
    can I run C# built-in unit test in build machine which doesn't have Visual Studio installed? We are thinking add unit test to our Visual Studio 2008 C# project. Our build machine doesn't have VS installed and we want to integrate the new unit test with our auto-build system. Is MSTest the executable to launch the Team Test unit test?

    Read the article

  • Connecting to a fresh SQL Server installation

    - by ripper234
    I know mysql, and I'd like to learn sqlserver. I'm currently stuck on the basics of basics: How to install and configure sql server How to connect to it I installed Sql Server through Web Platform Installer, and have Visual Studio 2008 installed. Still, I can't understand how to connect to my server: I see that the SQL service itself (SQLEXPRESS) is running in both in services.msc and Sql Server Configuration Manager I try to connect to it via the Management Studio, but I don't understand what to do. Where do I begin?

    Read the article

  • Is there a good, free raw HTML editor with auto-complete, auto-formatting and syntax highlighting?

    - by joshcomley
    I'm used to Visual Studio, so in an ideal world I would like something that meets the following criteria: Lightweight CSS auto-complete HTML auto-complete CSS auto-formatting HTML auto-formatting Syntax highlighting Notepad2 has syntax highlighting, but no auto-complete and no auto-formatting. Any thoughts? Please don't answer with "Visual Studio"! I'm after something very lightweight (if it exists).

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • Good basic tutorial for installing and using SqlServer

    - by ripper234
    I know mysql, and I'd like to learn sqlserver. I'm currently stuck on the basics of basics: How to install and configure sql server How to connect to it I installed Sql Server through Web Platform Installer, and have Visual Studio 2008 installed. Still, I can't understand how to connect to my server: I see that the SQL service itself (SQLEXPRESS) is running in both in services.msc and Sql Server Configuration Manager I try to connect to it via the Management Studio, but I don't understand what to do. Where do I begin?

    Read the article

  • What full featured (free) obfuscator do you all use?

    - by mike79
    I've just spent thousands of dollars on VSTS 2008 and thought that the usual Dotfuscaor Comunity Edition would've been upgraded to the pro version in this version of visual studio. After spending a fortune on Visual Studio Team Suite you would think you would get a full featured obfuscator for free. Now I have to spend another couple K for a PreEmptive Dotobfuscator license. What gives? What full featured (free) obfuscator do you all use?

    Read the article

< Previous Page | 370 371 372 373 374 375 376 377 378 379 380 381  | Next Page >