Search Results

Search found 35839 results on 1434 pages for 'string utils'.

Page 376/1434 | < Previous Page | 372 373 374 375 376 377 378 379 380 381 382 383  | Next Page >

  • How to include multiple XML files in a single XML file for deserialization by XmlSerializer in .NET

    - by harrydev
    Hi, is it possible to use the XmlSerializer in .NET to load an XML file which includes other XML files? And how? This, in order to share XML state easily in two "parent" XML files, e.g. AB and BC in below. Example: using System; using System.IO; using System.Xml.Serialization; namespace XmlSerializerMultipleFilesTest { [Serializable] public class A { public int Value { get; set; } } [Serializable] public class B { public double Value { get; set; } } [Serializable] public class C { public string Value { get; set; } } [Serializable] public class AB { public A A { get; set; } public B B { get; set; } } [Serializable] public class BC { public B B { get; set; } public C C { get; set; } } class Program { public static void Serialize<T>(T data, string filePath) { using (var writer = new StreamWriter(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); xmlSerializer.Serialize(writer, data); } } public static T Deserialize<T>(string filePath) { using (var reader = new StreamReader(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); return (T)xmlSerializer.Deserialize(reader); } } static void Main(string[] args) { const string fileNameA = @"A.xml"; const string fileNameB = @"B.xml"; const string fileNameC = @"C.xml"; const string fileNameAB = @"AB.xml"; const string fileNameBC = @"BC.xml"; var a = new A(){ Value = 42 }; var b = new B(){ Value = Math.PI }; var c = new C(){ Value = "Something rotten" }; Serialize(a, fileNameA); Serialize(b, fileNameB); Serialize(c, fileNameC); // How can AB and BC be deserialized from single // files which include two of the A, B or C files. // Using ideally something like: var ab = Deserialize<AB>(fileNameAB); var bc = Deserialize<BC>(fileNameBC); // That is, so that A, B, C xml file // contents are shared across these two } } } Thus, the A, B, C files contain the following: A.xml: <?xml version="1.0" encoding="utf-8"?> <A xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>42</Value> </A> B.xml: <?xml version="1.0" encoding="utf-8"?> <B xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>3.1415926535897931</Value> </B> C.xml: <?xml version="1.0" encoding="utf-8"?> <C xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>Something rotten</Value> </C> And then the "parent" XML files would contain a XML include file of some sort (I have not been able to find anything like this), such as: AB.xml: <?xml version="1.0" encoding="utf-8"?> <AB xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <A include="A.xml"/> <B include="B.xml"/> </AB> BC.xml: <?xml version="1.0" encoding="utf-8"?> <BC xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <B include="B.xml"/> <C include="C.xml"/> </BC> Of course, I guess this can be solved by implementing IXmlSerializer for AB and BC, but I was hoping there was an easier solution or a generic solution with which classes themselves only need the [Serializable] attribute and nothing else. That is, the split into multiple files is XML only and handled by XmlSerializer itself or a custom generic serializer on top of this. I know this should be somewhat possible with app.config (as in http://stackoverflow.com/questions/480538/use-xml-includes-or-config-references-in-app-config-to-include-other-config-files), but I would prefer a solution based on XmlSerializer. Thanks.

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • Auto not being recognised by the compiler, what would be the best replacement?

    - by user1719605
    So I have wrote a program that uses auto however the compiler doesn't seem to recognize it, probably it is an earlier compiler. I was wondering for my code, with are suitable variables to fix my code so that I do not need to use the auto keyword? I'm thinking a pointer to a string? or a string iterator, though I am not sure. #include <cstdlib> #include <string> #include <iostream> #include <unistd.h> #include <algorithm> using namespace std; int main(int argc, char* argv[]) { enum MODE { WHOLE, PREFIX, SUFFIX, ANYWHERE, EMBEDDED } mode = WHOLE; bool reverse_match = false; int c; while ((c = getopt(argc, argv, ":wpsaev")) != -1) { switch (c) { case 'w': // pattern matches whole word mode = WHOLE; break; case 'p': // pattern matches prefix mode = PREFIX; break; case 'a': // pattern matches anywhere mode = ANYWHERE; break; case 's': // pattern matches suffix mode = SUFFIX; break; case 'e': // pattern matches anywhere mode = EMBEDDED; break; case 'v': // reverse sense of match reverse_match = true; break; } } argc -= optind; argv += optind; string pattern = argv[0]; string word; int matches = 0; while (cin >> word) { switch (mode) { case WHOLE: if (reverse_match) { if (pattern != word) { matches += 1; cout << word << endl; } } else if (pattern == word) { matches += 1; cout << word << endl; } break; case PREFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.begin(), pattern.end(), word.begin()); if (reverse_match) { if (res.first != word.end()) { matches += 1; cout << word << endl; } } else if (res.first == word.end()) { matches += 1; cout << word << endl; } } break; case ANYWHERE: if (reverse_match) { if (!word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } } else if (word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } break; case SUFFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.rbegin(), pattern.rend(), word.rbegin()); if (reverse_match) { if (res.first != word.rend()) { matches = +1; cout << word << endl; } } else if (res.first == word.rend()) { matches = +1; cout << word << endl; } } break; case EMBEDDED: if (reverse_match) { if (!pattern.find(word) != string::npos) { matches += 1; cout << word << endl;} } else if (pattern.find(word) != string::npos) { matches += 1; cout << word << endl; } break; } } return (matches == 0) ? 1 : 0; } Thanks in advance!

    Read the article

  • Retrieving Json Array

    - by Rahul Varma
    Hi, I am trying to retrieve the values from the following url: http://rentopoly.com/ajax.php?query=Bo. I want to get the values of all the suggestions to be displayed in a list view one by one. This is how i want to do... public class AlertsAdd { public ArrayList<JSONObject> retrieveJSONArray(String urlString) { String result = queryRESTurl(urlString); ArrayList<JSONObject> ALERTS = new ArrayList<JSONObject>(); if (result != null) { try { JSONObject json = new JSONObject(result); JSONArray alertsArray = json.getJSONArray("suggestions"); for (int a = 0; a < alertsArray.length(); a++) { JSONObject alertitem = alertsArray.getJSONObject(a); ALERTS.add(alertitem); } return ALERTS; } catch (JSONException e) { Log.e("JSON", "There was an error parsing the JSON", e); } } JSONObject myObject = new JSONObject(); try { myObject.put("suggestions",myObject.getJSONArray("suggestions")); ALERTS.add(myObject); } catch (JSONException e1) { Log.e("JSON", "There was an error creating the JSONObject", e1); } return ALERTS; } private String queryRESTurl(String url) { // URLConnection connection; HttpClient httpclient = new DefaultHttpClient(); HttpGet httpget = new HttpGet(url); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); if (entity != null) { InputStream instream = entity.getContent(); String result = convertStreamToString(instream); instream.close(); return result; } } catch (ClientProtocolException e) { Log.e("REST", "There was a protocol based error", e); } catch (IOException e) { Log.e("REST", "There was an IO Stream related error", e); } return null; } /** * To convert the InputStream to String we use the * BufferedReader.readLine() method. We iterate until the BufferedReader * return null which means there's no more data to read. Each line will * appended to a StringBuilder and returned as String. */ private String convertStreamToString(InputStream is) { BufferedReader reader = new BufferedReader(new InputStreamReader(is)); StringBuilder sb = new StringBuilder(); String line = null; try { while ((line = reader.readLine()) != null) { sb.append(line + "\n"); } } catch (IOException e) { e.printStackTrace(); } finally { try { is.close(); } catch (IOException e) { e.printStackTrace(); } } return sb.toString(); } } Here's the adapter code... public class AlertsAdapter extends ArrayAdapter<JSONObject> { public AlertsAdapter(Activity activity, List<JSONObject> alerts) { super(activity, 0, alerts); } @Override public View getView(int position, View convertView, ViewGroup parent) { Activity activity = (Activity) getContext(); LayoutInflater inflater = activity.getLayoutInflater(); View rowView = inflater.inflate(R.layout.list_text, null); JSONObject imageAndText = getItem(position); TextView textView = (TextView) rowView.findViewById(R.id.last_build_stat); try { textView.setText((String)imageAndText.get("suggestions")); } catch (JSONException e) { textView.setText("JSON Exception"); } return rowView; } } Here's the logcat... 04-30 13:09:46.656: INFO/ActivityManager(584): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.WorldToyota/.Alerts } 04-30 13:09:50.417: ERROR/JSON(924): There was an error parsing the JSON 04-30 13:09:50.417: ERROR/JSON(924): org.json.JSONException: JSONArray[0] is not a JSONObject. 04-30 13:09:50.417: ERROR/JSON(924): at org.json.JSONArray.getJSONObject(JSONArray.java:268) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:30) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.417: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): There was an error creating the JSONObject 04-30 13:09:50.688: ERROR/JSON(924): org.json.JSONException: JSONObject["suggestions"] not found. 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.get(JSONObject.java:287) 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.getJSONArray(JSONObject.java:362) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:41) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.688: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) Plz help me parsing this script and displaying the values in list format....

    Read the article

  • ASP.NET. MVC2. Entity Framework. Cannot pass primary key value back from view to [HttpPost]

    - by Paul Connolly
    I pass a ViewModel (which contains a "Person" object) from the "EditPerson" controller action into the view. When posted back from the view, the ActionResult receives all of the Person properties except the ID (which it says is zero instead of say its real integer) Can anyone tell me why? The controllers look like this: public ActionResult EditPerson(int personID) { var personToEdit = repository.GetPerson(personID); FormationViewModel vm = new FormationViewModel(); vm.Person = personToEdit; return View(vm); } [HttpPost] public ActionResult EditPerson(FormationViewModel model) <<Passes in all properties except ID { // Persistence code } The View looks like this: <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<Afp.Models.Formation.FormationViewModel>" %> <% using (Html.BeginForm()) {% <%= Html.ValidationSummary(true) % <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Title) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Title) %> <%= Html.ValidationMessageFor(model => model.Person.Title) %> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Forename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Forename)%> <%= Html.ValidationMessageFor(model => model.Person.Forename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Surname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Surname)%> <%= Html.ValidationMessageFor(model => model.Person.Surname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.DOB) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.DOB, String.Format("{0:g}", Model.DOB)) <%= Html.ValidationMessageFor(model => model.DOB) %> </div>--%> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Nationality)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Nationality)%> <%= Html.ValidationMessageFor(model => model.Person.Nationality)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Occupation)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Occupation)%> <%= Html.ValidationMessageFor(model => model.Person.Occupation)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.CountryOfResidence)%> <%= Html.ValidationMessageFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousNameForename)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousSurname)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Email)%> <%= Html.ValidationMessageFor(model => model.Person.Email)%> </div> <p> <input type="submit" value="Save" /> </p> </fieldset> <% } % And the Person class looks like: [MetadataType(typeof(Person_Validation))] public partial class Person { public Person() { } } [Bind(Exclude = "ID")] public class Person_Validation { public int ID { get; private set; } public string Title { get; set; } public string Forename { get; set; } public string Surname { get; set; } public System.DateTime DOB { get; set; } public string Nationality { get; set; } public string Occupation { get; set; } public string CountryOfResidence { get; set; } public string PreviousNameForename { get; set; } public string PreviousSurname { get; set; } public string Email { get; set; } } And ViewModel: public class FormationViewModel { public Company Company { get; set; } public Address RegisteredAddress { get; set; } public Person Person { get; set; } public PersonType PersonType { get; set; } public int CurrentStep { get; set; } } }

    Read the article

  • creating objects from trivial graph format text file. java. dijkstra algorithm.

    - by user560084
    i want to create objects, vertex and edge, from trivial graph format txt file. one of programmers here suggested that i use trivial graph format to store data for dijkstra algorithm. the problem is that at the moment all the information, e.g., weight, links, is in the sourcecode. i want to have a separate text file for that and read it into the program. i thought about using a code for scanning through the text file by using scanner. but i am not quite sure how to create different objects from the same file. could i have some help please? the file is v0 Harrisburg v1 Baltimore v2 Washington v3 Philadelphia v4 Binghamton v5 Allentown v6 New York # v0 v1 79.83 v0 v5 81.15 v1 v0 79.75 v1 v2 39.42 v1 v3 103.00 v2 v1 38.65 v3 v1 102.53 v3 v5 61.44 v3 v6 96.79 v4 v5 133.04 v5 v0 81.77 v5 v3 62.05 v5 v4 134.47 v5 v6 91.63 v6 v3 97.24 v6 v5 87.94 and the dijkstra algorithm code is Downloaded from: http://en.literateprograms.org/Special:Downloadcode/Dijkstra%27s_algorithm_%28Java%29 */ import java.util.PriorityQueue; import java.util.List; import java.util.ArrayList; import java.util.Collections; class Vertex implements Comparable<Vertex> { public final String name; public Edge[] adjacencies; public double minDistance = Double.POSITIVE_INFINITY; public Vertex previous; public Vertex(String argName) { name = argName; } public String toString() { return name; } public int compareTo(Vertex other) { return Double.compare(minDistance, other.minDistance); } } class Edge { public final Vertex target; public final double weight; public Edge(Vertex argTarget, double argWeight) { target = argTarget; weight = argWeight; } } public class Dijkstra { public static void computePaths(Vertex source) { source.minDistance = 0.; PriorityQueue<Vertex> vertexQueue = new PriorityQueue<Vertex>(); vertexQueue.add(source); while (!vertexQueue.isEmpty()) { Vertex u = vertexQueue.poll(); // Visit each edge exiting u for (Edge e : u.adjacencies) { Vertex v = e.target; double weight = e.weight; double distanceThroughU = u.minDistance + weight; if (distanceThroughU < v.minDistance) { vertexQueue.remove(v); v.minDistance = distanceThroughU ; v.previous = u; vertexQueue.add(v); } } } } public static List<Vertex> getShortestPathTo(Vertex target) { List<Vertex> path = new ArrayList<Vertex>(); for (Vertex vertex = target; vertex != null; vertex = vertex.previous) path.add(vertex); Collections.reverse(path); return path; } public static void main(String[] args) { Vertex v0 = new Vertex("Nottinghill_Gate"); Vertex v1 = new Vertex("High_Street_kensignton"); Vertex v2 = new Vertex("Glouchester_Road"); Vertex v3 = new Vertex("South_Kensignton"); Vertex v4 = new Vertex("Sloane_Square"); Vertex v5 = new Vertex("Victoria"); Vertex v6 = new Vertex("Westminster"); v0.adjacencies = new Edge[]{new Edge(v1, 79.83), new Edge(v6, 97.24)}; v1.adjacencies = new Edge[]{new Edge(v2, 39.42), new Edge(v0, 79.83)}; v2.adjacencies = new Edge[]{new Edge(v3, 38.65), new Edge(v1, 39.42)}; v3.adjacencies = new Edge[]{new Edge(v4, 102.53), new Edge(v2, 38.65)}; v4.adjacencies = new Edge[]{new Edge(v5, 133.04), new Edge(v3, 102.53)}; v5.adjacencies = new Edge[]{new Edge(v6, 81.77), new Edge(v4, 133.04)}; v6.adjacencies = new Edge[]{new Edge(v0, 97.24), new Edge(v5, 81.77)}; Vertex[] vertices = { v0, v1, v2, v3, v4, v5, v6 }; computePaths(v0); for (Vertex v : vertices) { System.out.println("Distance to " + v + ": " + v.minDistance); List<Vertex> path = getShortestPathTo(v); System.out.println("Path: " + path); } } } and the code for scanning file is import java.util.Scanner; import java.io.File; import java.io.FileNotFoundException; public class DataScanner1 { //private int total = 0; //private int distance = 0; private String vector; private String stations; private double [] Edge = new double []; /*public int getTotal(){ return total; } */ /* public void getMenuInput(){ KeyboardInput in = new KeyboardInput; System.out.println("Enter the destination? "); String val = in.readString(); return val; } */ public void readFile(String fileName) { try { Scanner scanner = new Scanner(new File(fileName)); scanner.useDelimiter (System.getProperty("line.separator")); while (scanner.hasNext()) { parseLine(scanner.next()); } scanner.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } } public void parseLine(String line) { Scanner lineScanner = new Scanner(line); lineScanner.useDelimiter("\\s*,\\s*"); vector = lineScanner.next(); stations = lineScanner.next(); System.out.println("The current station is " + vector + " and the destination to the next station is " + stations + "."); //total += distance; //System.out.println("The total distance is " + total); } public static void main(String[] args) { /* if (args.length != 1) { System.err.println("usage: java TextScanner2" + "file location"); System.exit(0); } */ DataScanner1 scanner = new DataScanner1(); scanner.readFile(args[0]); //int total =+ distance; //System.out.println(""); //System.out.println("The total distance is " + scanner.getTotal()); } }

    Read the article

  • Font serialization in vb.net

    - by jovany
    Hello all, as the title says , I need to serialize my font. I have tried the following approach unfortunately to no avail. This is what I have and what happens; I have a drawing application and certain variables and properties need to be serialized. (So , Xml.Serialization has been used.) Now this has already been done in a huge portion and I've created some other attributes which needed to be serialized and it works. There is one base class and classes such as drawablestar, drawableeclipse ,etc. all inherit from this class. As does my drawabletextboxclass. The base class is Serializable as can be seen in the sample below. It looks like this... Imports System.Xml.Serialization <Serializable()> _ Public MustInherit Class Drawable ' Drawing characteristics. 'Font characteristics <XmlIgnore()> Public FontFamily As String <XmlIgnore()> Public FontSize As Integer <XmlIgnore()> Public FontType As Integer <XmlIgnore()> Public ForeColor As Color <XmlIgnore()> Public FillColor As Color <XmlAttributeAttribute()> Public LineWidth As Integer = 0 <XmlAttributeAttribute()> Public X1 As Integer <XmlAttributeAttribute()> Public Y1 As Integer <XmlAttributeAttribute()> Public X2 As Integer <XmlAttributeAttribute()> Public Y2 As Integer ' attributes for size textbox <XmlAttributeAttribute()> Public widthLabel As Integer <XmlAttributeAttribute()> Public heightLabel As Integer '<XmlTextAttribute()> Public FontFamily As String '<XmlAttributeAttribute()> Public FontSize As Integer 'this should actually not be here.. <XmlAttributeAttribute()> Public s_InsertLabel As String ' Indicates whether we should draw as selected. <XmlIgnore()> Public IsSelected As Boolean = False ' Constructors. Public Sub New() ForeColor = Color.Black FillColor = Color.White 'FontFamily = "Impact" 'FontSize = 12 End Sub Friend WriteOnly Property _Label() As String Set(ByVal Value As String) s_InsertLabel = Value End Set End Property Public Sub New(ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0) LineWidth = line_width ForeColor = fore_color FillColor = fill_color ' FontFamily = Font_Family ' FontSize = Font_Size End Sub ' Property procedures to serialize and ' deserialize ForeColor and FillColor. <XmlAttributeAttribute("ForeColor")> _ Public Property ForeColorArgb() As Integer Get Return ForeColor.ToArgb() End Get Set(ByVal Value As Integer) ForeColor = Color.FromArgb(Value) End Set End Property <XmlAttributeAttribute("BackColor")> _ Public Property FillColorArgb() As Integer Get Return FillColor.ToArgb() End Get Set(ByVal Value As Integer) FillColor = Color.FromArgb(Value) End Set End Property 'Property procedures to serialize and 'deserialize Font <XmlAttributeAttribute("InsertLabel")> _ Public Property InsertLabel_() As String Get Return s_InsertLabel End Get Set(ByVal value As String) s_InsertLabel = value End Set End Property <XmlAttributeAttribute("FontSize")> _ Public Property FontSizeGet() As Integer Get Return FontSize End Get Set(ByVal value As Integer) FontSize = value End Set End Property <XmlAttributeAttribute("FontFamily")> _ Public Property FontFamilyGet() As String Get Return FontFamily End Get Set(ByVal value As String) FontFamily = value End Set End Property <XmlAttributeAttribute("FontType")> _ Public Property FontType_() As Integer Get Return FontType End Get Set(ByVal value As Integer) FontType = value End Set End Property #Region "Methods to override" Public MustOverride Sub Draw(ByVal gr As Graphics) ' Return the object's bounding rectangle. Public MustOverride Function GetBounds() As Rectangle ...... ........ ..... End Class [/code] My textbox class which looks like this , is the one that needs to save it's font. Imports System.Math Imports System.Xml.Serialization Imports System.Windows.Forms <Serializable()> _ Public Class DrawableTextBox Inherits Drawable Private i_StringLength As Integer Private i_StringWidth As Integer Private drawFont As Font = New Font(FontFamily, 12, FontStyle.Regular) Private brsTextColor As Brush = Brushes.Black Private s_insertLabelTextbox As String = "label" ' Constructors. Public Sub New() End Sub Public Sub New(ByVal objCanvas As PictureBox, ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0, Optional ByVal new_x1 As Integer = 0, Optional ByVal new_y1 As Integer = 0, Optional ByVal new_x2 As Integer = 1, Optional ByVal new_y2 As Integer = 1) MyBase.New(fore_color, fill_color, line_width) Dim objGraphics As Graphics = objCanvas.CreateGraphics() X1 = new_x1 Y1 = new_y1 'Only rectangles ,circles and stars can resize for now b_Movement b_Movement = True Dim frm As New frmTextbox frm.MyFont = drawFont frm.ShowDialog() If frm.DialogResult = DialogResult.OK Then FontFamily = frm.MyFont.FontFamily.Name FontSize = frm.MyFont.Size FontType = frm.MyFont.Style 'drawFont = frm.MyFont drawFont = New Font(FontFamily, FontSize) drawFont = FontAttributes() brsTextColor = New SolidBrush(frm.txtLabel.ForeColor) s_InsertLabel = frm.txtLabel.Text i_StringLength = s_InsertLabel.Length 'gefixtf Dim objSizeF As SizeF = objGraphics.MeasureString(s_InsertLabel, drawFont, New PointF(X2 - X1, Y2 - Y1), New StringFormat(StringFormatFlags.NoClip)) Dim objPoint As Point = objCanvas.PointToClient(New Point(X1 + objSizeF.Width, Y1 + objSizeF.Height)) widthLabel = objSizeF.Width heightLabel = objSizeF.Height X2 = X1 + widthLabel Y2 = Y1 + heightLabel Else Throw New ApplicationException() End If End Sub ' Draw the object on this Graphics surface. Public Overrides Sub Draw(ByVal gr As System.Drawing.Graphics) ' Make a Rectangle representing this rectangle. Dim rectString As Rectangle rectString = New Rectangle(X1, Y1, widthLabel, heightLabel) rectString = GetBounds() ' See if we're selected. If IsSelected Then gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) ' Draw grab handles. DrawGrabHandle(gr, X1, Y1) DrawGrabHandle(gr, X1, Y2) DrawGrabHandle(gr, X2, Y2) DrawGrabHandle(gr, X2, Y1) Else gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) End If End Sub 'get fontattributes Public Function FontAttributes() As Font Return New Font(FontFamily, 12, FontStyle.Regular) End Function ' Return the object's bounding rectangle. Public Overrides Function GetBounds() As System.Drawing.Rectangle Return New Rectangle( _ Min(X1, X1), _ Min(Y1, Y1), _ Abs(widthLabel), _ Abs(heightLabel)) End Function ' Return True if this point is on the object. Public Overrides Function IsAt(ByVal x As Integer, ByVal y As Integer) As Boolean Return (x >= Min(X1, X2)) AndAlso _ (x <= Max(X1, X2)) AndAlso _ (y >= Min(Y1, Y2)) AndAlso _ (y <= Max(Y1, Y2)) End Function ' Move the second point. Public Overrides Sub NewPoint(ByVal x As Integer, ByVal y As Integer) X2 = x Y2 = y End Sub ' Return True if the object is empty (e.g. a zero-length line). Public Overrides Function IsEmpty() As Boolean Return (X1 = X2) AndAlso (Y1 = Y2) End Function End Class The coordinates ( X1 ,X2,Y1, Y2 ) are needed to draw a circle , rectangle etc. ( in the other classes ).This all works. If I load my saved file it shows me the correct location and correct size of drawn objects. If I open my xml file I can see all values are correctly saved ( including my FontFamily ). Also the color which can be adjusted is saved and then properly displayed when I load a previously saved drawing. Of course because the coordinates work, if I insert a textField ,the location where it is being displayed is correct. However here comes the problem , my fontSize and fontfamily don't work. As you can see I created them in the base class, However this does not work. Is my approach completely off? What can I do ? Before saving img14.imageshack.us/i/beforeos.jpg/ After loading the Font jumps back to Sans serif and size 12. I could really use some help here.. Edit: I've been using the sample from this website http://www.vb-helper.com/howto_net_drawing_framework.html

    Read the article

  • In Flex, how to drag a component into a column of DataGrid (not the whole DataGrid)?

    - by Yousui
    Hi guys, I have a custom component: <?xml version="1.0" encoding="utf-8"?> <s:Group xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx"> <fx:Declarations> </fx:Declarations> <fx:Script> <![CDATA[ [Bindable] public var label:String = "don't know"; [Bindable] public var imageName:String = "x.gif"; ]]> </fx:Script> <s:HGroup paddingLeft="8" paddingTop="8" paddingRight="8" paddingBottom="8"> <mx:Image id="img" source="assets/{imageName}" /> <s:Label text="{label}"/> </s:HGroup> </s:Group> and a custom render, which will be used in my DataGrid: <?xml version="1.0" encoding="utf-8"?> <s:MXDataGridItemRenderer xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" focusEnabled="true" xmlns:components="components.*"> <s:VGroup> <components:Person label="{dataGridListData.label}"> </components:Person> </s:VGroup> </s:MXDataGridItemRenderer> This is my application: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600" xmlns:services="services.*"> <s:layout> <s:VerticalLayout/> </s:layout> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.controls.Image; import mx.rpc.events.ResultEvent; import mx.utils.ArrayUtil; ]]> </fx:Script> <fx:Declarations> <fx:XMLList id="employees"> <employee> <name>Christina Coenraets</name> <phone>555-219-2270</phone> <email>[email protected]</email> <active>true</active> <image>assets/001.png</image> </employee> <employee> <name>Joanne Wall</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>true</active> <image>assets/002.png</image> </employee> <employee> <name>Maurice Smith</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>false</active> <image>assets/003.png</image> </employee> <employee> <name>Mary Jones</name> <phone>555-219-2000</phone> <email>[email protected]</email> <active>true</active> <image>assets/004.png</image> </employee> </fx:XMLList> </fx:Declarations> <s:HGroup> <mx:DataGrid dataProvider="{employees}" width="100%" dropEnabled="true"> <mx:columns> <mx:DataGridColumn headerText="Employee Name" dataField="name"/> <mx:DataGridColumn headerText="Email" dataField="email"/> <mx:DataGridColumn headerText="Image" dataField="image" itemRenderer="renderers.render1"/> </mx:columns> </mx:DataGrid> <s:List dragEnabled="true" dragMoveEnabled="false"> <s:dataProvider> <s:ArrayCollection> <fx:String>aaa</fx:String> <fx:String>bbb</fx:String> <fx:String>ccc</fx:String> <fx:String>ddd</fx:String> </s:ArrayCollection> </s:dataProvider> </s:List> </s:HGroup> </s:Application> Now what I want to do is let the user drag an one or more item from the left List component and drop at the third column of the DataGrid, then using the dragged data to create another <components:Person /> object. So in the final result, maybe the first line contains just one <components:Person /> object at the third column, the second line contains two <components:Person /> object at the third column and so on. Can this be implemented in Flex? How? Great thanks.

    Read the article

  • Optimizing sorting container of objects with heap-allocated buffers - how to avoid hard-copying buff

    - by Kache4
    I was making sure I knew how to do the op= and copy constructor correctly in order to sort() properly, so I wrote up a test case. After getting it to work, I realized that the op= was hard-copying all the data_. I figure if I wanted to sort a container with this structure (its elements have heap allocated char buffer arrays), it'd be faster to just swap the pointers around. Is there a way to do that? Would I have to write my own sort/swap function? #include <deque> //#include <string> //#include <utility> //#include <cstdlib> #include <cstring> #include <iostream> //#include <algorithm> // I use sort(), so why does this still compile when commented out? #include <boost/filesystem.hpp> #include <boost/foreach.hpp> using namespace std; namespace fs = boost::filesystem; class Page { public: // constructor Page(const char* path, const char* data, int size) : path_(fs::path(path)), size_(size), data_(new char[size]) { // cout << "Creating Page..." << endl; strncpy(data_, data, size); // cout << "done creating Page..." << endl; } // copy constructor Page(const Page& other) : path_(fs::path(other.path())), size_(other.size()), data_(new char[other.size()]) { // cout << "Copying Page..." << endl; strncpy(data_, other.data(), size_); // cout << "done copying Page..." << endl; } // destructor ~Page() { delete[] data_; } // accessors const fs::path& path() const { return path_; } const char* data() const { return data_; } int size() const { return size_; } // operators Page& operator = (const Page& other) { if (this == &other) return *this; char* newImage = new char[other.size()]; strncpy(newImage, other.data(), other.size()); delete[] data_; data_ = newImage; path_ = fs::path(other.path()); size_ = other.size(); return *this; } bool operator < (const Page& other) const { return path_ < other.path(); } private: fs::path path_; int size_; char* data_; }; class Book { public: Book(const char* path) : path_(fs::path(path)) { cout << "Creating Book..." << endl; cout << "pushing back #1" << endl; pages_.push_back(Page("image1.jpg", "firstImageData", 14)); cout << "pushing back #3" << endl; pages_.push_back(Page("image3.jpg", "thirdImageData", 14)); cout << "pushing back #2" << endl; pages_.push_back(Page("image2.jpg", "secondImageData", 15)); cout << "testing operator <" << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[1]? " < " : " > ") << pages_[1].path().string() << endl; cout << pages_[1].path().string() << (pages_[1] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << "sorting" << endl; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; sort(pages_.begin(), pages_.end()); cout << "done sorting\n"; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; cout << "checking datas" << endl; BOOST_FOREACH (Page p, pages_) { char data[p.size() + 1]; strncpy((char*)&data, p.data(), p.size()); data[p.size()] = '\0'; cout << p.path().string() << " " << data << endl; } cout << "done Creating Book" << endl; } private: deque<Page> pages_; fs::path path_; }; int main() { Book* book = new Book("/some/path/"); }

    Read the article

  • Need help with copy constructor for very basic implementation of singly linked lists

    - by Jesus
    Last week, we created a program that manages sets of strings, using classes and vectors. I was able to complete this 100%. This week, we have to replace the vector we used to store strings in our class with simple singly linked lists. The function basically allows users to declare sets of strings that are empty, and sets with only one element. In the main file, there is a vector whose elements are a struct that contain setName and strSet (class). HERE IS MY PROBLEM: It deals with the copy constructor of the class. When I remove/comment out the copy constructor, I can declare as many empty or single sets as I want, and output their values without a problem. But I know I will obviously need the copy constructor for when I implement the rest of the program. When I leave the copy constructor in, I can declare one set, either single or empty, and output its value. But if I declare a 2nd set, and i try to output either of the first two sets, i get a Segmentation Fault. Moreover, if i try to declare more then 2 sets, I get a Segmentation Fault. Any help would be appreciated!! Here is my code for a very basic implementation of everything: Here is the setcalc.cpp: (main file) #include <iostream> #include <cctype> #include <cstring> #include <string> #include "help.h" #include "strset2.h" using namespace std; // Declares of structure to hold all the sets defined struct setsOfStr { string nameOfSet; strSet stringSet; }; // Checks if the set name inputted is unique bool isSetNameUnique( vector<setsOfStr> strSetArr, string setName) { for(unsigned int i = 0; i < strSetArr.size(); i++) { if( strSetArr[i].nameOfSet == setName ) { return false; } } return true; } int main(int argc, char *argv[]) { char commandChoice; // Declares a vector with our declared structure as the type vector<setsOfStr> strSetVec; string setName; string singleEle; // Sets a loop that will constantly ask for a command until 'q' is typed while (1) { // declaring a set to be empty if(commandChoice == 'd') { cin >> setName; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet emptyStrSet; setsOfStr set1; set1.nameOfSet = setName; set1.stringSet = emptyStrSet; strSetVec.push_back(set1); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // declaring a set to be a singleton else if(commandChoice == 's') { cin >> setName; cin >> singleEle; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet singleStrSet(singleEle); setsOfStr set2; set2.nameOfSet = setName; set2.stringSet = singleStrSet; strSetVec.push_back(set2); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // using the output function else if(commandChoice == 'o') { cin >> setName; if(isSetNameUnique(strSetVec, setName) == false) { // loop through until the set name is matched and call output on its strSet for(unsigned int k = 0; k < strSetVec.size(); k++) { if( strSetVec[k].nameOfSet == setName ) { (strSetVec[k].stringSet).output(); } } } else { cerr << "ERROR: No such set '" << setName << "'\n"; } } // quitting else if(commandChoice == 'q') { break; } else { cerr << "ERROR: Ignoring bad command: '" << commandChoice << "'\n"; } } return 0; } Here is the strSet2.h: #ifndef _STRSET_ #define _STRSET_ #include <iostream> #include <vector> #include <string> struct node { std::string s1; node * next; }; class strSet { private: node * first; public: strSet (); // Create empty set strSet (std::string s); // Create singleton set strSet (const strSet &copy); // Copy constructor // will implement destructor later void output() const; strSet& operator = (const strSet& rtSide); // Assignment }; // End of strSet class #endif // _STRSET_ And here is the strSet2.cpp (implementation of class) #include <iostream> #include <vector> #include <string> #include "strset2.h" using namespace std; strSet::strSet() { first = NULL; } strSet::strSet(string s) { node *temp; temp = new node; temp->s1 = s; temp->next = NULL; first = temp; } strSet::strSet(const strSet& copy) { cout << "copy-cst\n"; node *n = copy.first; node *prev = NULL; while (n) { node *newNode = new node; newNode->s1 = n->s1; newNode->next = NULL; if (prev) { prev->next = newNode; } else { first = newNode; } prev = newNode; n = n->next; } } void strSet::output() const { if(first == NULL) { cout << "Empty set\n"; } else { node *temp; temp = first; while(1) { cout << temp->s1 << endl; if(temp->next == NULL) break; temp = temp->next; } } } strSet& strSet::operator = (const strSet& rtSide) { first = rtSide.first; return *this; }

    Read the article

  • Httpsession with Spring 3 MVC

    - by vipul12389
    I want to use httpsession in Spring 3 MVC..i have searched all the web and got this solution..at http://forum.springsource.org/showthread.php?98850-Adding-to-stuff-to-the-session-while-using-ResponseBody Basically, My application auto authenticates user by getting winId and authorizes through LDAP..(Its a intranet site) Here is the flow of the application, 1. User enters Aplication url (http://localhost:8082/eIA_Mock_5) it has a welcome page (index.jsp) Index.jsp gets winId through jQuery and hits login.html (through Ajax) and passes windowsId login.html (Controller) authenticates through LDAP and gives back 'Valid' String as a response javascript, upon getting the correct response, redirects/loads welcome page i.e. goes to localhost:8082/eIA_Mock_5/welcome.html Now, i have filter associated with it..which checks for is session valid for each incoming request..Now the problem is even though i set data on to httpsession, yet the filter or any other controller fails to get the data through session as a result it doesnt proceeds further.. here is the code..and could you suggest what is wrong actually ?? Home_Controller.java @Controller public class Home_Controller { public static Log logger = LogFactory.getLog(Home_Controller.class); @RequestMapping(value={"/welcome"}) public ModelAndView loadWelcomePage(HttpServletRequest request,HttpServletResponse response) { ModelAndView mdv = new ModelAndView(); try{ /*HttpSession session = request.getSession(); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String userName=userBean.getWindowsId(); if(userName==null || userName.equalsIgnoreCase("")) { mdv.setViewName("homePage"); System.out.println("Unable to authenticate user "); logger.debug("Unable to authenticate user "); } else { System.out.println("Welcome User "+userName); logger.debug("Welcome User "+userName); */ mdv.setViewName("homePage"); /*}*/ } catch(Exception e){ logger.debug("inside authenticateUser ",e); e.printStackTrace(); } return mdv; } @RequestMapping(value = "/login", method = RequestMethod.GET) public @ResponseBody String authenticateUser(@RequestParam String userName,HttpSession session) { logger.debug("inside authenticateUser"); String returnResponse=new String(); try{ logger.debug("userName for Authentication "+userName); System.out.println("userName for Authentication "+userName); //HttpSession session = request.getSession(); if(userName==null || userName.trim().equalsIgnoreCase("")) returnResponse="Invalid"; else { System.out.println("uname "+userName); String ldapResponse = LDAPConnectUtil.isValidActiveDirectoryUser(userName, ""); if(ldapResponse.equalsIgnoreCase("true")) { returnResponse="Valid"; System.out.println(userName+" Authenticated"); logger.debug(userName+" Authenticated"); UserMasterBean userBean = new UserMasterBean(); userBean.setWindowsId(userName); //if(session.getAttribute("userBean")==null) session.setAttribute("userBean", userBean); } else { returnResponse="Invalid"; //session.setAttribute("userBean", null); System.out.println("Unable to Authenticate the user through Ldap"); logger.debug("Unable to Authenticate the user through Ldap"); } System.out.println("ldapResponse "+ldapResponse); logger.debug("ldapResponse "+ldapResponse); System.out.println("returnResponse "+returnResponse); } UserMasterBean u = (UserMasterBean)session.getAttribute("userBean"); System.out.println("winId "+u.getWindowsId()); } catch(Exception e){ e.printStackTrace(); logger.debug("Exception in authenticateUser ",e); } return returnResponse; } Filter public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) { System.out.println("in PageFilter"); boolean flag = false; HttpServletRequest objHttpServletRequest = (HttpServletRequest)request; HttpServletResponse objHttpServletResponse = (HttpServletResponse)response; HttpSession session = objHttpServletRequest.getSession(); String contextPath = objHttpServletRequest.getContextPath(); String servletPath = objHttpServletRequest.getSession().getServletContext().getRealPath(objHttpServletRequest.getServletPath()); logger.debug("contextPath :" + contextPath); logger.debug("servletPath :" + servletPath); System.out.println("in PageFilter, contextPath :" + contextPath); System.out.println("in PageFilter, servletPath :" + servletPath); if (servletPath.endsWith("\\") || servletPath.endsWith("/") || servletPath.indexOf("css") > 0 || servletPath.indexOf("jsp") > 0 || servletPath.indexOf("images") > 0 || servletPath.indexOf("js") > 0 || servletPath.endsWith("index.jsp") || servletPath.indexOf("xls") > 0 || servletPath.indexOf("ini") > 0 || servletPath.indexOf("login.html") > 0 || /*servletPath.endsWith("welcome.html") ||*/ servletPath.endsWith("logout.do") ) { System.out.println("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); logger.debug("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); flag = true; } if (flag== false) { System.out.println("flag = false"); if(session.getAttribute("userBean") == null) System.out.println("yes session.userbean is null"); if ((session != null) && (session.getAttribute("userBean") != null)) { System.out.println("session!=null && session.getAttribute(userId)!=null"); logger.debug("IF Part"); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String windowsId = userBean.getWindowsId(); logger.debug("User Id " + windowsId + " allowed access"); System.out.println("User Id " + windowsId + " allowed access"); flag = true; } else { System.out.println("else .....session!=null && session.getAttribute(userId)!=null"); logger.debug("Else Part"); flag = false; } } if (flag == true) { try { System.out.println("before chain.doFilter(request, response)"); chain.doFilter(request, response); } catch (Exception e) { e.printStackTrace(); try { objHttpServletResponse.sendRedirect(contextPath + "/logout.do"); } catch (Exception ex) { ex.printStackTrace(); } } } else { try { System.out.println("before sendRedirect"); objHttpServletResponse.sendRedirect(contextPath + "/jsp/errorPage.jsp"); } catch (Exception ex) { ex.printStackTrace(); } } System.out.println("end of PageFilter"); } Index.jsp <script type="text/javascript"> //alert("inside s13"); var WinNetwork = new ActiveXObject("WScript.Network"); var userName=WinNetwork.UserName; alert(userName); $.ajax({ url : "login.html", data : "userName="+userName, success : function(result) { alert("result == "+result); if(result=="Valid") window.location = "http://10.160.118.200:8082/eIA_Mock_5/welcome.html"; } }); </script> web.xml has a filter entry with URL pattern as * I am using spring 3 mvc

    Read the article

  • Trouble calling a method from an external class

    - by Bradley Hobbs
    Here is my employee database program: import java.util.*; import java.io.*; import java.io.File; import java.io.FileReader; import java.util.ArrayList; public class P { //Instance Variables private static String empName; private static String wage; private static double wages; private static double salary; private static double numHours; private static double increase; // static ArrayList<String> ARempName = new ArrayList<String>(); // static ArrayList<Double> ARwages = new ArrayList<Double>(); // static ArrayList<Double> ARsalary = new ArrayList<Double>(); static ArrayList<Employee> emp = new ArrayList<Employee>(); public static void main(String[] args) throws Exception { clearScreen(); printMenu(); question(); exit(); } public static void printArrayList(ArrayList<Employee> emp) { for (int i = 0; i < emp.size(); i++){ System.out.println(emp.get(i)); } } public static void clearScreen() { System.out.println("\u001b[H\u001b[2J"); } private static void exit() { System.exit(0); } private static void printMenu() { System.out.println("\t------------------------------------"); System.out.println("\t|Commands: n - New employee |"); System.out.println("\t| c - Compute paychecks |"); System.out.println("\t| r - Raise wages |"); System.out.println("\t| p - Print records |"); System.out.println("\t| d - Download data |"); System.out.println("\t| u - Upload data |"); System.out.println("\t| q - Quit |"); System.out.println("\t------------------------------------"); System.out.println(""); } public static void question() { System.out.print("Enter command: "); Scanner q = new Scanner(System.in); String input = q.nextLine(); input.replaceAll("\\s","").toLowerCase(); boolean valid = (input.equals("n") || input.equals("c") || input.equals("r") || input.equals("p") || input.equals("d") || input.equals("u") || input.equals("q")); if (!valid){ System.out.println("Command was not recognized; please try again."); printMenu(); question(); } else if (input.equals("n")){ System.out.print("Enter the name of new employee: "); Scanner stdin = new Scanner(System.in); empName = stdin.nextLine(); System.out.print("Hourly (h) or salaried (s): "); Scanner stdin2 = new Scanner(System.in); wage = stdin2.nextLine(); wage.replaceAll("\\s","").toLowerCase(); if (!(wage.equals("h") || wage.equals("s"))){ System.out.println("Input was not h or s; please try again"); } else if (wage.equals("h")){ System.out.print("Enter hourly wage: "); Scanner stdin4 = new Scanner(System.in); wages = stdin4.nextDouble(); Employee emp1 = new HourlyEmployee(empName, wages); emp.add(emp1); printMenu(); question();} else if (wage.equals("s")){ System.out.print("Enter annual salary: "); Scanner stdin5 = new Scanner(System.in); salary = stdin5.nextDouble(); Employee emp1 = new SalariedEmployee(empName, salary); printMenu(); question();}} else if (input.equals("c")){ for (int i = 0; i < emp.size(); i++){ System.out.println("Enter number of hours worked by " + emp.get(i) + ":"); } Scanner stdin = new Scanner(System.in); numHours = stdin.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); System.out.print("Enter number of hours worked by " + empName); Scanner stdin2 = new Scanner(System.in); numHours = stdin2.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); printMenu(); question();} else if (input.equals("r")){ System.out.print("Enter percentage increase: "); Scanner stdin = new Scanner(System.in); increase = stdin.nextDouble(); System.out.println("\nNew Wages"); System.out.println("---------"); // System.out.println(Employee.toString()); printMenu(); question(); } else if (input.equals("p")){ printArrayList(emp); printMenu(); question(); } else if (input.equals("q")){ exit(); } } } Here is one of the class files: public abstract class Employee { private String name; private double wage; protected Employee(String name, double wage){ this.name = name; this.wage = wage; } public String getName() { return name; } public double getWage() { return wage; } public void setName(String name) { this.name = name; } public void setWage(double wage) { this.wage = wage; } public void percent(double wage, double percent) { wage *= percent; } } And here are the errors: P.java:108: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ P.java:112: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ 2 errors I'm trying to the get paycheck to print out but i'm having trouble with how to call the method. It should take the user inputed numHours and calculate it then print on the paycheck for each employee. Thanks!

    Read the article

  • Mulit-tenant ASP.NET MVC – Controllers

    - by zowens
    Part I – Introduction Part II – Foundation   The time has come to talk about controllers in a multi-tenant ASP.NET MVC architecture. This is actually the most critical design decision you will make when dealing with multi-tenancy with MVC. In my design, I took into account the design goals I mentioned in the introduction about inversion of control and what a tenant is to my design. Be aware that this is only one way to achieve multi-tenant controllers.   The Premise MvcEx (which is a sample written by Rob Ashton) utilizes dynamic controllers. Essentially a controller is “dynamic” in that multiple action results can be placed in different “controllers” with the same name. This approach is a bit too complicated for my design. I wanted to stick with plain old inheritance when dealing with controllers. The basic premise of my controller design is that my main host defines a set of universal controllers. It is the responsibility of the tenant to decide if the tenant would like to utilize these core controllers. This can be done either by straight usage of the controller or inheritance for extension of the functionality defined by the controller. The controller is resolved by a StructureMap container that is attached to the tenant, as discussed in Part II.   Controller Resolution I have been thinking about two different ways to resolve controllers with StructureMap. One way is to use named instances. This is a really easy way to simply pull the controller right out of the container without a lot of fuss. I ultimately chose not to use this approach. The reason for this decision is to ensure that the controllers are named properly. If a controller has a different named instance that the controller type, then the resolution has a significant disconnect and there are no guarantees. The final approach, the one utilized by the sample, is to simply pull all controller types and correlate the type with a controller name. This has a bit of a application start performance disadvantage, but is significantly more approachable for maintainability. For example, if I wanted to go back and add a “ControllerName” attribute, I would just have to change the ControllerFactory to suit my needs.   The Code The container factory that I have built is actually pretty simple. That’s really all we need. The most significant method is the GetControllersFor method. This method makes the model from the Container and determines all the concrete types for IController.  The thing you might notice is that this doesn’t depend on tenants, but rather containers. You could easily use this controller factory for an application that doesn’t utilize multi-tenancy. public class ContainerControllerFactory : IControllerFactory { private readonly ThreadSafeDictionary<IContainer, IDictionary<string, Type>> typeCache; public ContainerControllerFactory(IContainerResolver resolver) { Ensure.Argument.NotNull(resolver, "resolver"); this.ContainerResolver = resolver; this.typeCache = new ThreadSafeDictionary<IContainer, IDictionary<string, Type>>(); } public IContainerResolver ContainerResolver { get; private set; } public virtual IController CreateController(RequestContext requestContext, string controllerName) { var controllerType = this.GetControllerType(requestContext, controllerName); if (controllerType == null) return null; var controller = this.ContainerResolver.Resolve(requestContext).GetInstance(controllerType) as IController; // ensure the action invoker is a ContainerControllerActionInvoker if (controller != null && controller is Controller && !((controller as Controller).ActionInvoker is ContainerControllerActionInvoker)) (controller as Controller).ActionInvoker = new ContainerControllerActionInvoker(this.ContainerResolver); return controller; } public void ReleaseController(IController controller) { if (controller != null && controller is IDisposable) ((IDisposable)controller).Dispose(); } internal static IEnumerable<Type> GetControllersFor(IContainer container) { Ensure.Argument.NotNull(container); return container.Model.InstancesOf<IController>().Select(x => x.ConcreteType).Distinct(); } protected virtual Type GetControllerType(RequestContext requestContext, string controllerName) { Ensure.Argument.NotNull(requestContext, "requestContext"); Ensure.Argument.NotNullOrEmpty(controllerName, "controllerName"); var container = this.ContainerResolver.Resolve(requestContext); var typeDictionary = this.typeCache.GetOrAdd(container, () => GetControllersFor(container).ToDictionary(x => ControllerFriendlyName(x.Name))); Type found = null; if (typeDictionary.TryGetValue(ControllerFriendlyName(controllerName), out found)) return found; return null; } private static string ControllerFriendlyName(string value) { return (value ?? string.Empty).ToLowerInvariant().Without("controller"); } } One thing to note about my implementation is that we do not use namespaces that can be utilized in the default ASP.NET MVC controller factory. This is something that I don’t use and have no desire to implement and test. The reason I am not using namespaces in this situation is because each tenant has its own namespaces and the routing would not make sense in this case.   Because we are using IoC, dependencies are automatically injected into the constructor. For example, a tenant container could implement it’s own IRepository and a controller could be defined in the “main” project. The IRepository from the tenant would be injected into the main project’s controller. This is quite a useful feature.   Again, the source code is on GitHub here.   Up Next Up next is the view resolution. This is a complicated issue, so be prepared. I hope that you have found this series useful. If you have any questions about my implementation so far, send me an email or DM me on Twitter. I have had a lot of great conversations about multi-tenancy so far and I greatly appreciate the feedback!

    Read the article

  • AutoMapper MappingFunction from Source Type of NameValueCollection

    - by REA_ANDREW
    I have had a situation arise today where I need to construct a complex type from a source of a NameValueCollection.  A little while back I submitted a patch for the Agatha Project to include REST (JSON and XML) support for the service contract.  I realized today that as useful as it is, it did not actually support true REST conformance, as REST should support GET so that you can use JSONP from JavaScript directly meaning you can query cross domain services.  My original implementation for POX and JSON used the POST method and this immediately rules out JSONP as from reading, JSONP only works with GET Requests. This then raised another issue.  The current operation contract of Agatha and one of its main benefits is that you can supply an array of Request objects in a single request, limiting the about of server requests you need to make.  Now, at the present time I am thinking that this will not be the case for the REST imlementation but will yield the benefits of the fact that : The same Request objects can be used for SOAP and RST (POX, JSON) The construct of the JavaScript functions will be simpler and more readable It will enable the use of JSONP for cross domain REST Services The current contract for the Agatha WcfRequestProcessor is at time of writing the following: [ServiceContract] public interface IWcfRequestProcessor { [OperationContract(Name = "ProcessRequests")] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [TransactionFlow(TransactionFlowOption.Allowed)] Response[] Process(params Request[] requests); [OperationContract(Name = "ProcessOneWayRequests", IsOneWay = true)] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] void ProcessOneWayRequests(params OneWayRequest[] requests); }   My current proposed solution, and at the very early stages of my concept is as follows: [ServiceContract] public interface IWcfRestJsonRequestProcessor { [OperationContract(Name="process")] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [TransactionFlow(TransactionFlowOption.Allowed)] [WebGet(UriTemplate = "process/{name}/{*parameters}", BodyStyle = WebMessageBodyStyle.WrappedResponse, ResponseFormat = WebMessageFormat.Json)] Response[] Process(string name, NameValueCollection parameters); [OperationContract(Name="processoneway",IsOneWay = true)] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [WebGet(UriTemplate = "process-one-way/{name}/{*parameters}", BodyStyle = WebMessageBodyStyle.WrappedResponse, ResponseFormat = WebMessageFormat.Json)] void ProcessOneWayRequests(string name, NameValueCollection parameters); }   Now this part I have not yet implemented, it is the preliminart step which I have developed which will allow me to take the name of the Request Type and the NameValueCollection and construct the complex type which is that of the Request which I can then supply to a nested instance of the original IWcfRequestProcessor  and work as it should normally.  To give an example of some of the urls which you I envisage with this method are: http://www.url.com/service.svc/json/process/getweather/?location=london http://www.url.com/service.svc/json/process/getproductsbycategory/?categoryid=1 http://www.url.om/service.svc/json/process/sayhello/?name=andy Another reason why my direction has gone to a single request for the REST implementation is because of restrictions which are imposed by browsers on the length of the url.  From what I have read this is on average 2000 characters.  I think that this is a very acceptable usage limit in the context of using 1 request, but I do not think this is acceptable for accommodating multiple requests chained together.  I would love to be corrected on that one, I really would but unfortunately from what I have read I have come to the conclusion that this is not the case. The mapping function So, as I say this is just the first pass I have made at this, and I am not overly happy with the try catch for detecting types without default constructors.  I know there is a better way but for the minute, it escapes me.  I would also like to know the correct way for adding mapping functions and not using the anonymous way that I have used.  To achieve this I have used recursion which I am sure is what other mapping function use. As you do have to go as deep as the complex type is. public static object RecurseType(NameValueCollection collection, Type type, string prefix) { try { var returnObject = Activator.CreateInstance(type); foreach (var property in type.GetProperties()) { foreach (var key in collection.AllKeys) { if (String.IsNullOrEmpty(prefix) || key.Length > prefix.Length) { var propertyNameToMatch = String.IsNullOrEmpty(prefix) ? key : key.Substring(property.Name.IndexOf(prefix) + prefix.Length + 1); if (property.Name == propertyNameToMatch) { property.SetValue(returnObject, Convert.ChangeType(collection.Get(key), property.PropertyType), null); } else if(property.GetValue(returnObject,null) == null) { property.SetValue(returnObject, RecurseType(collection, property.PropertyType, String.Concat(prefix, property.PropertyType.Name)), null); } } } } return returnObject; } catch (MissingMethodException) { //Quite a blunt way of dealing with Types without default constructor return null; } }   Another thing is performance, I have not measured this in anyway, it is as I say the first pass, so I hope this can be the start of a more perfected implementation.  I tested this out with a complex type of three levels, there is no intended logical meaning to the properties, they are simply for the purposes of example.  You could call this a spiking session, as from here on in, now I know what I am building I would take a more TDD approach.  OK, purists, why did I not do this from the start, well I didn’t, this was a brain dump and now I know what I am building I can. The console test and how I used with AutoMapper is as follows: static void Main(string[] args) { var collection = new NameValueCollection(); collection.Add("Name", "Andrew Rea"); collection.Add("Number", "1"); collection.Add("AddressLine1", "123 Street"); collection.Add("AddressNumber", "2"); collection.Add("AddressPostCodeCountry", "United Kingdom"); collection.Add("AddressPostCodeNumber", "3"); AutoMapper.Mapper.CreateMap<NameValueCollection, Person>() .ConvertUsing(x => { return(Person) RecurseType(x, typeof(Person), null); }); var person = AutoMapper.Mapper.Map<NameValueCollection, Person>(collection); Console.WriteLine(person.Name); Console.WriteLine(person.Number); Console.WriteLine(person.Address.Line1); Console.WriteLine(person.Address.Number); Console.WriteLine(person.Address.PostCode.Country); Console.WriteLine(person.Address.PostCode.Number); Console.ReadLine(); }   Notice the convention that I am using and that this method requires you do use.  Each property is prefixed with the constructed name of its parents combined.  This is the convention used by AutoMapper and it makes sense. I can also think of other uses for this including using with ASP.NET MVC ModelBinders for creating a complex type from the QueryString which is itself is a NameValueCollection. Hope this is of some help to people and I would welcome any code reviews you could give me. References: Agatha : http://code.google.com/p/agatha-rrsl/ AutoMapper : http://automapper.codeplex.com/   Cheers for now, Andrew   P.S. I will have the proposed solution for a more complete REST implementation for AGATHA very soon. 

    Read the article

  • Building services with the .NET framework Cont’d

    - by Allan Rwakatungu
    In my previous blog I wrote an introductory post on services and how you can build services using the .NET frameworks Windows Communication Foundation (WCF) In this post I will show how to develop a real world application using WCF The problem During the last meeting we realized developers in Uganda are not so cool – they don’t use twitter so may not get the latest news and updates from the technology world. We also noticed they mostly use kabiriti phones (jokes). With their kabiriti phones they are unable to access the twitter web client or alternative twitter mobile clients like tweetdeck , twirl or tweetie. However, the kabiriti phones support SMS (Yeeeeeeei). So what we going to do to make these developers cool and keep them updated is by enabling them to receive tweets via SMS. We shall also enable them to develop their own applications that can extend this functionality Analysis Thanks to services and open API’s solving our problem is going to be easy.  1. To get tweets we can use the twitter service for FREE 2. To send SMS we shall use www.clickatell.com/ as they can send SMS to any country in the world. Besides we could not find any local service that offers API's for sending SMS :(. 3. To enable developers to integrate with our application so that they can extend it and build even cooler applications we use WCF. In addittion , because connectivity might be an issue we decided to use WCF because if has a inbuilt queing features. We also choose WCF because this is a post about .NET and WCF :). The Code Accessing the tweets To consume twitters REST API we shall use the WCF REST starter kit. Like it name indicates , the REST starter kit is a set of .NET framework classes that enable developers to create and access REST style services ( like the twitter service). Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Http; using System.Net; using System.Xml.Linq;   namespace UG.Demo {     public class TwitterService     {         public IList<TwitterStatus> SomeMethodName()         {             //Connect to the twitter service (HttpClient is part of the REST startkit classes)             HttpClient cl = new HttpClient("http://api.twitter.com/1/statuses/friends_timeline.xml");             //Supply your basic authentication credentials             cl.TransportSettings.Credentials = new NetworkCredential("ourusername", "ourpassword");             //issue an http             HttpResponseMessage resp = cl.Get();             //ensure we got reponse 200             resp.EnsureStatusIsSuccessful();             //use XLinq to parse the REST XML             var statuses = from r in resp.Content.ReadAsXElement().Descendants("status")                            select new TwitterStatus                            {                                User = r.Element("user").Element("screen_name").Value,                                Status = r.Element("text").Value                            };             return statuses.ToList();         }     }     public class TwitterStatus     {         public string User { get; set; }         public string Status { get; set; }     } }  Sending SMS Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} public class SMSService     {         public void Send(string phone, string message)         {                         HttpClient cl1 = new HttpClient();              //the clickatell XML format for sending SMS             string xml = String.Format("<clickAPI><sendMsg><api_id>3239621</api_id><user>ourusername</user><password>ourpassword</password><to>{0}</to><text>{1}</text></sendMsg></clickAPI>",phone,message);             //Post form data             HttpUrlEncodedForm form = new HttpUrlEncodedForm();             form.Add("data", xml);             System.Net.ServicePointManager.Expect100Continue = false;             string uri = @"http://api.clickatell.com/xml/xml";             HttpResponseMessage resp = cl1.Post(uri, form.CreateHttpContent());             resp.EnsureStatusIsSuccessful();         }     }

    Read the article

  • ASP.NET Controls – CommunityServer Captcha ControlAdapter, a practical case

    - by nmgomes
    The ControlAdapter is available since .NET framework version 2.0 and his main goal is to adapt and customize a control render in order to achieve a specific behavior or layout. This customization is done without changing the base control. A ControlAdapter is commonly used to custom render for specific platforms like Mobile. In this particular case the ControlAdapter was used to add a specific behavior to a Control. In this  post I will use one adapter to add a Captcha to all WeblogPostCommentForm controls within pontonetpt.com CommunityServer instance. The Challenge The ControlAdapter complexity is usually associated with the complexity/structure of is base control. This case is precisely one of those since base control dynamically load his content (controls) thru several ITemplate. Those of you who already played with ITemplate knows that while it is an excellent option for control composition it also brings to the table a big issue: “Controls defined within a template are not available for manipulation until they are instantiated inside another control.” While analyzing the WeblogPostCommentForm control I found that he uses the ITemplate technique to compose it’s layout and unfortunately I also found that the template content vary from theme to theme. This could have been a problem but luckily WeblogPostCommentForm control template content always contains a submit button with a well known ID (at least I can assume that there are a well known set of IDs). Using this submit button as anchor it’s possible to add the Captcha controls in the correct place. Another important finding was that WeblogPostCommentForm control inherits from the WrappedFormBase control which is the base control for all CommunityServer input forms. Knowing this inheritance link the main goal has changed to became the creation of a base ControlAdapter that  could be extended and customized to allow adding Captcha to: post comments form contact form user creation form. And, with this mind set, I decided to used the following ControlAdapter base class signature :public abstract class WrappedFormBaseCaptchaAdapter<T> : ControlAdapter where T : WrappedFormBase { }Great, but there are still many to do … Captcha The Captcha will be assembled with: A dynamically generated image with a set of random numbers A TextBox control where the image number will be inserted A Validator control to validate whether TextBox numbers match the image numbers This is a common Captcha implementation, is not rocket science and don’t bring any additional problem. The main problem, as told before, is to find the correct anchor control to ensure a correct Captcha control injection. The anchor control can vary by: target control  theme Implementation To support this dynamic scenario I choose to use the following implementation:private List<string> _validAnchorIds = null; protected virtual List<string> ValidAnchorIds { get { if (this._validAnchorIds == null) { this._validAnchorIds = new List<string>(); this._validAnchorIds.Add("btnSubmit"); } return this._validAnchorIds; } } private Control GetAnchorControl(T wrapper) { if (this.ValidAnchorIds == null || this.ValidAnchorIds.Count == 0) { throw new ArgumentException("Cannot be null or empty", "validAnchorNames"); } var q = from anchorId in this.ValidAnchorIds let anchorControl = CSControlUtility.Instance().FindControl(wrapper, anchorId) where anchorControl != null select anchorControl; return q.FirstOrDefault(); } I can now, using the ValidAnchorIds property, configure a set of valid anchor control  Ids. The GetAnchorControl method searches for a valid anchor control within the set of valid control Ids. Here, some of you may question why to use a LINQ To Objects expression, but the important here is to notice the usage of CSControlUtility.Instance().FindControl CommunityServer method. I want to build on top of CommunityServer not to reinvent the wheel. Assuming that an anchor control was found, it’s now possible to inject the Captcha at the correct place. This not something new, we do this all the time when creating server controls or adding dynamic controls:protected sealed override void CreateChildControls() { base.CreateChildControls(); if (this.IsCaptchaRequired) { T wrapper = base.Control as T; if (wrapper != null) { Control anchorControl = GetAnchorControl(wrapper); if (anchorControl != null) { Panel phCaptcha = new Panel {CssClass = "CommonFormField", ID = "Captcha"}; int index = anchorControl.Parent.Controls.IndexOf(anchorControl); anchorControl.Parent.Controls.AddAt(index, phCaptcha); CaptchaConfiguration.DefaultProvider.AddCaptchaControls( phCaptcha, GetValidationGroup(wrapper, anchorControl)); } } } } Here you can see a new entity in action: a provider. This is a CaptchaProvider class instance and is only goal is to create the Captcha itself and do everything else is needed to ensure is correct operation.public abstract class CaptchaProvider : ProviderBase { public abstract void AddCaptchaControls(Panel captchaPanel, string validationGroup); } You can create your own specific CaptchaProvider class to use different Captcha strategies including the use of existing Captcha services  like ReCaptcha. Once the generic ControlAdapter was created became extremely easy to created a specific one. Here is the specific ControlAdapter for the WeblogPostCommentForm control:public class WeblogPostCommentFormCaptchaAdapter : WrappedFormBaseCaptchaAdapter<WrappedFormBase> { #region Overriden Methods protected override List<string> ValidAnchorIds { get { List<string> validAnchorNames = base.ValidAnchorIds; validAnchorNames.Add("CommentSubmit"); return validAnchorNames; } } protected override string DefaultValidationGroup { get { return "CreateCommentForm"; } } #endregion Overriden Methods } Configuration This is the magic step. Without changing the original pages and keeping the application original assemblies untouched we are going to add a new behavior to the CommunityServer application. To glue everything together you must follow this steps: Add the following configuration to default.browser file:<?xml version='1.0' encoding='utf-8'?> <browsers> <browser refID="Default"> <controlAdapters> <!-- Adapter for the WeblogPostCommentForm control in order to add the Captcha and prevent SPAM comments --> <adapter controlType="CommunityServer.Blogs.Controls.WeblogPostCommentForm" adapterType="NunoGomes.CommunityServer.Components.WeblogPostCommentFormCaptchaAdapter, NunoGomes.CommunityServer" /> </controlAdapters> </browser> </browsers> Add the following configuration to web.config file:<configuration> <configSections> <!-- New section for Captcha providers configuration --> <section name="communityServer.Captcha" type="NunoGomes.CommunityServer.Captcha.Configuration.CaptchaSection" /> </configSections> <!-- Configuring a simple Captcha provider --> <communityServer.Captcha defaultProvider="simpleCaptcha"> <providers> <add name="simpleCaptcha" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProvider, NunoGomes.CommunityServer" imageUrl="~/captcha.ashx" enabled="true" passPhrase="_YourPassPhrase_" saltValue="_YourSaltValue_" hashAlgorithm="SHA1" passwordIterations="3" keySize="256" initVector="_YourInitVectorWithExactly_16_Bytes_" /> </providers> </communityServer.Captcha> <system.web> <httpHandlers> <!-- The Captcha Image handler used by the simple Captcha provider --> <add verb="GET" path="captcha.ashx" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProviderImageHandler, NunoGomes.CommunityServer" /> </httpHandlers> </system.web> <system.webServer> <handlers accessPolicy="Read, Write, Script, Execute"> <!-- The Captcha Image handler used by the simple Captcha provider --> <add verb="GET" name="captcha" path="captcha.ashx" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProviderImageHandler, NunoGomes.CommunityServer" /> </handlers> </system.webServer> </configuration> Conclusion Building a ControlAdapter can be complex but the reward is his ability to allows us, thru configuration changes, to modify an application render and/or behavior. You can see this ControlAdapter in action here and here (anonymous required). A complete solution is available in “CommunityServer Extensions” Codeplex project.

    Read the article

  • Adding Volcanos and Options - Earthquake Locator, part 2

    - by Bobby Diaz
    Since volcanos are often associated with earthquakes, and vice versa, I decided to show recent volcanic activity on the Earthquake Locator map.  I am pulling the data from a website created for a joint project between the Smithsonian's Global Volcanism Program and the US Geological Survey's Volcano Hazards Program, found here.  They provide a Weekly Volcanic Activity Report as an RSS feed.   I started implementing this new functionality by creating a new Volcano entity in the domain model and adding the following to the EarthquakeService class (I also factored out the common reading/parsing helper methods to a separate FeedReader class that can be used by multiple domain service classes):           private static readonly string VolcanoFeedUrl =             ConfigurationManager.AppSettings["VolcanoFeedUrl"];           /// <summary>         /// Gets the volcano data for the previous week.         /// </summary>         /// <returns>A queryable collection of <see cref="Volcano"/> objects.</returns>         public IQueryable<Volcano> GetVolcanos()         {             var feed = FeedReader.Load(VolcanoFeedUrl);             var list = new List<Volcano>();               if ( feed != null )             {                 foreach ( var item in feed.Items )                 {                     var quake = CreateVolcano(item);                     if ( quake != null )                     {                         list.Add(quake);                     }                 }             }               return list.AsQueryable();         }           /// <summary>         /// Creates a <see cref="Volcano"/> object for each item in the RSS feed.         /// </summary>         /// <param name="item">The RSS item.</param>         /// <returns></returns>         private Volcano CreateVolcano(SyndicationItem item)         {             Volcano volcano = null;             string title = item.Title.Text;             string desc = item.Summary.Text;             double? latitude = null;             double? longitude = null;               FeedReader.GetGeoRssPoint(item, out latitude, out longitude);               if ( !String.IsNullOrEmpty(title) )             {                 title = title.Substring(0, title.IndexOf('-'));             }             if ( !String.IsNullOrEmpty(desc) )             {                 desc = String.Join("\n\n", desc                         .Replace("<p>", "")                         .Split(                             new string[] { "</p>" },                             StringSplitOptions.RemoveEmptyEntries)                         .Select(s => s.Trim())                         .ToArray())                         .Trim();             }               if ( latitude != null && longitude != null )             {                 volcano = new Volcano()                 {                     Id = item.Id,                     Title = title,                     Description = desc,                     Url = item.Links.Select(l => l.Uri.OriginalString).FirstOrDefault(),                     Latitude = latitude.GetValueOrDefault(),                     Longitude = longitude.GetValueOrDefault()                 };             }               return volcano;         } I then added the corresponding LoadVolcanos() method and Volcanos collection to the EarthquakeViewModel class in much the same way I did with the Earthquakes in my previous article in this series. Now that I am starting to add more information to the map, I wanted to give the user some options as to what is displayed and allowing them to choose what gets turned off.  I have updated the MainPage.xaml to look like this:   <UserControl x:Class="EarthquakeLocator.MainPage"     xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"     xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"     xmlns:d="http://schemas.microsoft.com/expression/blend/2008"     xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"     xmlns:basic="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls"     xmlns:bing="clr-namespace:Microsoft.Maps.MapControl;assembly=Microsoft.Maps.MapControl"     xmlns:vm="clr-namespace:EarthquakeLocator.ViewModel"     mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480" >     <UserControl.Resources>         <DataTemplate x:Key="EarthquakeTemplate">             <Ellipse Fill="Red" Stroke="Black" StrokeThickness="1"                      Width="{Binding Size}" Height="{Binding Size}"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="{Binding UtcTime}" />                         <TextBlock Text="{Binding LocalTime}" />                         <TextBlock Text="{Binding DepthDesc}" />                     </StackPanel>                 </ToolTipService.ToolTip>             </Ellipse>         </DataTemplate>           <DataTemplate x:Key="VolcanoTemplate">             <Polygon Fill="Gold" Stroke="Black" StrokeThickness="1" Points="0,10 5,0 10,10"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center"                      MouseLeftButtonUp="Volcano_MouseLeftButtonUp">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="Click icon for more information..." />                     </StackPanel>                 </ToolTipService.ToolTip>             </Polygon>         </DataTemplate>     </UserControl.Resources>       <UserControl.DataContext>         <vm:EarthquakeViewModel AutoLoadData="True" />     </UserControl.DataContext>       <Grid x:Name="LayoutRoot">           <bing:Map x:Name="map" CredentialsProvider="--Your-Bing-Maps-Key--"                   Center="{Binding MapCenter, Mode=TwoWay}"                   ZoomLevel="{Binding ZoomLevel, Mode=TwoWay}">               <bing:MapItemsControl ItemsSource="{Binding Earthquakes}"                                   ItemTemplate="{StaticResource EarthquakeTemplate}" />               <bing:MapItemsControl ItemsSource="{Binding Volcanos}"                                   ItemTemplate="{StaticResource VolcanoTemplate}" />         </bing:Map>           <basic:TabControl x:Name="tabs" VerticalAlignment="Bottom" MaxHeight="25" Opacity="0.7">             <basic:TabItem Margin="90,0,-90,0" MouseLeftButtonUp="TabItem_MouseLeftButtonUp">                 <basic:TabItem.Header>                     <TextBlock x:Name="txtHeader" Text="Options"                                FontSize="13" FontWeight="Bold" />                 </basic:TabItem.Header>                   <StackPanel Orientation="Horizontal">                     <TextBlock Text="Earthquakes:" FontWeight="Bold" Margin="3" />                     <StackPanel Margin="3">                         <CheckBox Content=" &lt; 4.0"                                   IsChecked="{Binding ShowLt4, Mode=TwoWay}" />                         <CheckBox Content="4.0 - 4.9"                                   IsChecked="{Binding Show4s, Mode=TwoWay}" />                         <CheckBox Content="5.0 - 5.9"                                   IsChecked="{Binding Show5s, Mode=TwoWay}" />                     </StackPanel>                       <StackPanel Margin="10,3,3,3">                         <CheckBox Content="6.0 - 6.9"                                   IsChecked="{Binding Show6s, Mode=TwoWay}" />                         <CheckBox Content="7.0 - 7.9"                                   IsChecked="{Binding Show7s, Mode=TwoWay}" />                         <CheckBox Content="8.0 +"                                   IsChecked="{Binding ShowGe8, Mode=TwoWay}" />                     </StackPanel>                       <TextBlock Text="Other:" FontWeight="Bold" Margin="50,3,3,3" />                     <StackPanel Margin="3">                         <CheckBox Content="Volcanos"                                   IsChecked="{Binding ShowVolcanos, Mode=TwoWay}" />                     </StackPanel>                 </StackPanel>               </basic:TabItem>         </basic:TabControl>       </Grid> </UserControl> Notice that I added a VolcanoTemplate that uses a triangle-shaped Polygon to represent the Volcano locations, and I also added a second <bing:MapItemsControl /> tag to the map to bind to the Volcanos collection.  The TabControl found below the map houses the options panel that will present the user with several checkboxes so they can filter the different points based on type and other properties (i.e. Magnitude).  Initially, the TabItem is collapsed to reduce it's footprint, but the screen shot below shows the options panel expanded to reveal the available settings:     I have updated the Source Code and Live Demo to include these new features.   Happy Mapping!

    Read the article

  • Using delegates in C# (Part 2)

    - by rajbk
    Part 1 of this post can be read here. We are now about to see the different syntaxes for invoking a delegate and some c# syntactic sugar which allows you to code faster. We have the following console application. 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: Operation op1 = new Operation(Division); 9: double result = op1.Invoke(10, 5); 10: 11: Console.WriteLine(result); 12: Console.ReadLine(); 13: } 14: 15: static double Division(double x, double y) { 16: return x / y; 17: } 18: } Line 1 defines a delegate type called Operation with input parameters (double x, double y) and a return type of double. On Line 8, we create an instance of this delegate and set the target to be a static method called Division (Line 15) On Line 9, we invoke the delegate (one entry in the invocation list). The program outputs 5 when run. The language provides shortcuts for creating a delegate and invoking it (see line 9 and 11). Line 9 is a syntactical shortcut for creating an instance of the Delegate. The C# compiler will infer on its own what the delegate type is and produces intermediate language that creates a new instance of that delegate. Line 11 uses a a syntactical shortcut for invoking the delegate by removing the Invoke method. The compiler sees the line and generates intermediate language which invokes the delegate. When this code is compiled, the generated IL will look exactly like the IL of the compiled code above. 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: //shortcut constructor syntax 9: Operation op1 = Division; 10: //shortcut invoke syntax 11: double result = op1(10, 2); 12: 13: Console.WriteLine(result); 14: Console.ReadLine(); 15: } 16: 17: static double Division(double x, double y) { 18: return x / y; 19: } 20: } C# 2.0 introduced Anonymous Methods. Anonymous methods avoid the need to create a separate method that contains the same signature as the delegate type. Instead you write the method body in-line. There is an interesting fact about Anonymous methods and closures which won’t be covered here. Use your favorite search engine ;-)We rewrite our code to use anonymous methods (see line 9): 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: //Anonymous method 9: Operation op1 = delegate(double x, double y) { 10: return x / y; 11: }; 12: double result = op1(10, 2); 13: 14: Console.WriteLine(result); 15: Console.ReadLine(); 16: } 17: 18: static double Division(double x, double y) { 19: return x / y; 20: } 21: } We could rewrite our delegate to be of a generic type like so (see line 2 and line 9). You will see why soon. 1: //Generic delegate 2: public delegate T Operation<T>(T x, T y); 3:  4: public class Program 5: { 6: [STAThread] 7: static void Main(string[] args) 8: { 9: Operation<double> op1 = delegate(double x, double y) { 10: return x / y; 11: }; 12: double result = op1(10, 2); 13: 14: Console.WriteLine(result); 15: Console.ReadLine(); 16: } 17: 18: static double Division(double x, double y) { 19: return x / y; 20: } 21: } The .NET 3.5 framework introduced a whole set of predefined delegates for us including public delegate TResult Func<T1, T2, TResult>(T1 arg1, T2 arg2); Our code can be modified to use this delegate instead of the one we declared. Our delegate declaration has been removed and line 7 has been changed to use the Func delegate type. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //Func is a delegate defined in the .NET 3.5 framework 7: Func<double, double, double> op1 = delegate (double x, double y) { 8: return x / y; 9: }; 10: double result = op1(10, 2); 11: 12: Console.WriteLine(result); 13: Console.ReadLine(); 14: } 15: 16: static double Division(double x, double y) { 17: return x / y; 18: } 19: } .NET 3.5 also introduced lambda expressions. A lambda expression is an anonymous function that can contain expressions and statements, and can be used to create delegates or expression tree types. We change our code to use lambda expressions. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //lambda expression 7: Func<double, double, double> op1 = (x, y) => x / y; 8: double result = op1(10, 2); 9: 10: Console.WriteLine(result); 11: Console.ReadLine(); 12: } 13: 14: static double Division(double x, double y) { 15: return x / y; 16: } 17: } C# 3.0 introduced the keyword var (implicitly typed local variable) where the type of the variable is inferred based on the type of the associated initializer expression. We can rewrite our code to use var as shown below (line 7).  The implicitly typed local variable op1 is inferred to be a delegate of type Func<double, double, double> at compile time. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //implicitly typed local variable 7: var op1 = (x, y) => x / y; 8: double result = op1(10, 2); 9: 10: Console.WriteLine(result); 11: Console.ReadLine(); 12: } 13: 14: static double Division(double x, double y) { 15: return x / y; 16: } 17: } You have seen how we can write code in fewer lines by using a combination of the Func delegate type, implicitly typed local variables and lambda expressions.

    Read the article

  • Android Client : Web service - what's the correct SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I should

    - by Hubert
    if I want to use the following Web service (help.be is just an example, let's say it does exist): http://www.help.be/webservice/webservice_help.php (it's written in PHP=client's choice, not .NET) with the following WSDL : <?xml version="1.0" encoding="UTF-8"?> <definitions xmlns="http://schemas.xmlsoap.org/wsdl/" name="webservice_help" targetNamespace="http://www.help.be/webservice/webservice_help.php" xmlns:tns="http://www.help.be/webservice/webservice_help.php" xmlns:impl="http://www.help.be/webservice/webservice_help.php" xmlns:xsd1="http://www.help.be/webservice/webservice_help.php" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"> <portType name="webservice_helpPortType"> <operation name="webservice_help"> <input message="tns:Webservice_helpRequest"/> </operation> <operation name="getLocation" parameterOrder="input"> <input message="tns:GetLocationRequest"/> <output message="tns:GetLocationResponse"/> </operation> <operation name="getStationDetail" parameterOrder="input"> <input message="tns:GetStationDetailRequest"/> <output message="tns:GetStationDetailResponse"/> </operation> <operation name="getStationList" parameterOrder="input"> <input message="tns:GetStationListRequest"/> <output message="tns:GetStationListResponse"/> </operation> </portType> <binding name="webservice_helpBinding" type="tns:webservice_helpPortType"> <soap:binding style="rpc" transport="http://schemas.xmlsoap.org/soap/http"/> <operation name="webservice_help"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#webservice_help"/> <input> <soap:body use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> </operation> <operation name="getLocation"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getLocation"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> <operation name="getStationDetail"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getStationDetail"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> <operation name="getStationList"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getStationList"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> </binding> <message name="Webservice_helpRequest"/> <message name="GetLocationRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetLocationResponse"> <part name="return" type="xsd:array"/> </message> <message name="GetStationDetailRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetStationDetailResponse"> <part name="return" type="xsd:string"/> </message> <message name="GetStationListRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetStationListResponse"> <part name="return" type="xsd:string"/> </message> <service name="webservice_helpService"> <port name="webservice_helpPort" binding="tns:webservice_helpBinding"> <soap:address location="http://www.help.be/webservice/webservice_help.php"/> </port> </service> </definitions> What is the correct SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I should use below ? I've tried with this : public class Main extends Activity { /** Called when the activity is first created. */ private static final String SOAP_ACTION_GETLOCATION = "getLocation"; private static final String METHOD_NAME_GETLOCATION = "getLocation"; private static final String NAMESPACE = "http://www.help.be/webservice/"; private static final String URL = "http://www.help.be/webservice/webservice_help.php"; TextView tv; @SuppressWarnings("unchecked") @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); tv = (TextView)findViewById(R.id.TextView01); // -------------------------------------------------------------------------------------- SoapObject request_location = new SoapObject(NAMESPACE, METHOD_NAME_GETLOCATION); request_location.addProperty("login", "login"); // -> string required request_location.addProperty("password", "password"); // -> string required request_location.addProperty("serial", "serial"); // -> string required request_location.addProperty("language", "fr"); // -> string required (available « fr,nl,uk,de ») request_location.addProperty("keyword", "Braine"); // -> string required // -------------------------------------------------------------------------------------- SoapSerializationEnvelope soapEnvelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); //soapEnvelope.dotNet = true; // don't forget it for .NET WebServices ! soapEnvelope.setOutputSoapObject(request_location); AndroidHttpTransport aht = new AndroidHttpTransport(URL); try { aht.call(SOAP_ACTION_GETLOCATION, soapEnvelope); // Get the SAOP Envelope back and then extract the body SoapObject resultsRequestSOAP = (SoapObject) soapEnvelope.bodyIn; Vector XXXX = (Vector) resultsRequestSOAP.getProperty("GetLocationResponse"); int vector_size = XXXX.size(); Log.i("Hub", "testat="+vector_size); tv.setText("OK"); } catch(Exception E) { tv.setText("ERROR:" + E.getClass().getName() + ": " + E.getMessage()); Log.i("Hub", "Exception E"); Log.i("Hub", "E.getClass().getName()="+E.getClass().getName()); Log.i("Hub", "E.getMessage()="+E.getMessage()); } // -------------------------------------------------------------------------------------- } } I'm not sure of the SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I have to use? because soapAction is pointing to a URN instead of a traditional URL and it's PHP and not .NET ... also, I'm not sure if I have to use request_location.addProperty("login", "login"); of request_location.addAttribute("login", "login"); ? = <message name="GetLocationRequest"> <part name="input" type="xsd:array"/> What would you say ? Txs for your help. H. EDIT : Here is some code working in PHP - I simply want to have the same but in Android/JAVA : <?php ini_set("soap.wsdl_cache_enabled", "0"); // disabling WSDL cache $request['login'] = 'login'; $request['password'] = 'password'; $request['serial'] = 'serial'; $request['language'] = 'fr'; $client= new SoapClient("http://www.test.be/webservice/webservice_test.wsdl"); print_r( $client->__getFunctions()); ?><hr><h1>getLocation</h1> <h2>Input:</h2> <? $request['keyword'] = 'Bruxelles'; print_r($request); ?><h2>Result</h2><? $result = $client->getLocation($request); print_r($result); ?>

    Read the article

< Previous Page | 372 373 374 375 376 377 378 379 380 381 382 383  | Next Page >