Search Results

Search found 9567 results on 383 pages for 'hg convert'.

Page 377/383 | < Previous Page | 373 374 375 376 377 378 379 380 381 382 383  | Next Page >

  • Getting problem in accessing web cam.

    - by Chetan
    Hi... I have written code in Java to access web cam,and to save image... I am getting following exceptions : Exception in thread "main" java.lang.NullPointerException at SwingCapture.(SwingCapture.java:40) at SwingCapture.main(SwingCapture.java:66) how to remove this exceptions. here is the code: import javax.swing.*; import javax.swing.event.; import java.io.; import javax.media.; import javax.media.format.; import javax.media.util.; import javax.media.control.; import javax.media.protocol.; import java.util.; import java.awt.; import java.awt.image.; import java.awt.event.; import com.sun.image.codec.jpeg.; public class SwingCapture extends Panel implements ActionListener { public static Player player = null; public CaptureDeviceInfo di = null; public MediaLocator ml = null; public JButton capture = null; public Buffer buf = null; public Image img = null; public VideoFormat vf = null; public BufferToImage btoi = null; public ImagePanel imgpanel = null; public SwingCapture() { setLayout(new BorderLayout()); setSize(320,550); imgpanel = new ImagePanel(); capture = new JButton("Capture"); capture.addActionListener(this); String str1 = "vfw:iNTEX IT-308 WC:0"; String str2 = "vfw:Microsoft WDM Image Capture (Win32):0"; di = CaptureDeviceManager.getDevice(str2); ml = di.getLocator(); try { player = Manager.createRealizedPlayer(ml); player.start(); Component comp; if ((comp = player.getVisualComponent()) != null) { add(comp,BorderLayout.NORTH); } add(capture,BorderLayout.CENTER); add(imgpanel,BorderLayout.SOUTH); } catch (Exception e) { e.printStackTrace(); } } public static void main(String[] args) { Frame f = new Frame("SwingCapture"); SwingCapture cf = new SwingCapture(); f.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { playerclose(); System.exit(0);}}); f.add("Center",cf); f.pack(); f.setSize(new Dimension(320,550)); f.setVisible(true); } public static void playerclose() { player.close(); player.deallocate(); } public void actionPerformed(ActionEvent e) { JComponent c = (JComponent) e.getSource(); if (c == capture) { // Grab a frame FrameGrabbingControl fgc = (FrameGrabbingControl) player.getControl("javax.media.control.FrameGrabbingControl"); buf = fgc.grabFrame(); // Convert it to an image btoi = new BufferToImage((VideoFormat)buf.getFormat()); img = btoi.createImage(buf); // show the image imgpanel.setImage(img); // save image saveJPG(img,"\test.jpg"); } } class ImagePanel extends Panel { public Image myimg = null; public ImagePanel() { setLayout(null); setSize(320,240); } public void setImage(Image img) { this.myimg = img; repaint(); } public void paint(Graphics g) { if (myimg != null) { g.drawImage(myimg, 0, 0, this); } } } public static void saveJPG(Image img, String s) { BufferedImage bi = new BufferedImage(img.getWidth(null), img.getHeight(null), BufferedImage.TYPE_INT_RGB); Graphics2D g2 = bi.createGraphics(); g2.drawImage(img, null, null); FileOutputStream out = null; try { out = new FileOutputStream(s); } catch (java.io.FileNotFoundException io) { System.out.println("File Not Found"); } JPEGImageEncoder encoder = JPEGCodec.createJPEGEncoder(out); JPEGEncodeParam param = encoder.getDefaultJPEGEncodeParam(bi); param.setQuality(0.5f,false); encoder.setJPEGEncodeParam(param); try { encoder.encode(bi); out.close(); } catch (java.io.IOException io) { System.out.println("IOException"); } } }

    Read the article

  • Why is my unsafe code block slower than my safe code?

    - by jomtois
    I am attempting to write some code that will expediently process video frames. I am receiving the frames as a System.Windows.Media.Imaging.WriteableBitmap. For testing purposes, I am just applying a simple threshold filter that will process a BGRA format image and assign each pixel to either be black or white based on the average of the BGR pixels. Here is my "Safe" version: public static void ApplyFilter(WriteableBitmap Bitmap, byte Threshold) { // Let's just make this work for this format if (Bitmap.Format != PixelFormats.Bgr24 && Bitmap.Format != PixelFormats.Bgr32) { return; } // Calculate the number of bytes per pixel (should be 4 for this format). var bytesPerPixel = (Bitmap.Format.BitsPerPixel + 7) / 8; // Stride is bytes per pixel times the number of pixels. // Stride is the byte width of a single rectangle row. var stride = Bitmap.PixelWidth * bytesPerPixel; // Create a byte array for a the entire size of bitmap. var arraySize = stride * Bitmap.PixelHeight; var pixelArray = new byte[arraySize]; // Copy all pixels into the array Bitmap.CopyPixels(pixelArray, stride, 0); // Loop through array and change pixels to black or white based on threshold for (int i = 0; i < pixelArray.Length; i += bytesPerPixel) { // i=B, i+1=G, i+2=R, i+3=A var brightness = (byte)((pixelArray[i] + pixelArray[i + 1] + pixelArray[i + 2]) / 3); var toColor = byte.MinValue; // Black if (brightness >= Threshold) { toColor = byte.MaxValue; // White } pixelArray[i] = toColor; pixelArray[i + 1] = toColor; pixelArray[i + 2] = toColor; } Bitmap.WritePixels(new Int32Rect(0, 0, Bitmap.PixelWidth, Bitmap.PixelHeight), pixelArray, stride, 0); } Here is what I think is a direct translation using an unsafe code block and the WriteableBitmap Back Buffer instead of the forebuffer: public static void ApplyFilterUnsafe(WriteableBitmap Bitmap, byte Threshold) { // Let's just make this work for this format if (Bitmap.Format != PixelFormats.Bgr24 && Bitmap.Format != PixelFormats.Bgr32) { return; } var bytesPerPixel = (Bitmap.Format.BitsPerPixel + 7) / 8; Bitmap.Lock(); unsafe { // Get a pointer to the back buffer. byte* pBackBuffer = (byte*)Bitmap.BackBuffer; for (int i = 0; i < Bitmap.BackBufferStride*Bitmap.PixelHeight; i+= bytesPerPixel) { var pCopy = pBackBuffer; var brightness = (byte)((*pBackBuffer + *pBackBuffer++ + *pBackBuffer++) / 3); pBackBuffer++; var toColor = brightness >= Threshold ? byte.MaxValue : byte.MinValue; *pCopy = toColor; *++pCopy = toColor; *++pCopy = toColor; } } // Bitmap.AddDirtyRect(new Int32Rect(0,0, Bitmap.PixelWidth, Bitmap.PixelHeight)); Bitmap.Unlock(); } This is my first foray into unsafe code blocks and pointers, so maybe the logic is not optimal. I have tested both blocks of code on the same WriteableBitmaps using: var threshold = Convert.ToByte(op.Result); var copy2 = copyFrame.Clone(); Stopwatch stopWatch = new Stopwatch(); stopWatch.Start(); BinaryFilter.ApplyFilterUnsafe(copyFrame, threshold); stopWatch.Stop(); var unsafesecs = stopWatch.ElapsedMilliseconds; stopWatch.Reset(); stopWatch.Start(); BinaryFilter.ApplyFilter(copy2, threshold); stopWatch.Stop(); Debug.WriteLine(string.Format("Unsafe: {1}, Safe: {0}", stopWatch.ElapsedMilliseconds, unsafesecs)); So I am analyzing the same image. A test run of an incoming stream of video frames: Unsafe: 110, Safe: 53 Unsafe: 136, Safe: 42 Unsafe: 106, Safe: 36 Unsafe: 95, Safe: 43 Unsafe: 98, Safe: 41 Unsafe: 88, Safe: 36 Unsafe: 129, Safe: 65 Unsafe: 100, Safe: 47 Unsafe: 112, Safe: 50 Unsafe: 91, Safe: 33 Unsafe: 118, Safe: 42 Unsafe: 103, Safe: 80 Unsafe: 104, Safe: 34 Unsafe: 101, Safe: 36 Unsafe: 154, Safe: 83 Unsafe: 134, Safe: 46 Unsafe: 113, Safe: 76 Unsafe: 117, Safe: 57 Unsafe: 90, Safe: 41 Unsafe: 156, Safe: 35 Why is my unsafe version always slower? Is it due to using the back buffer? Or am I doing something wrong? Thanks

    Read the article

  • [SOLVED] Iphone NSXMLParser NSCFString memory leak

    - by atticusalien
    I am building an app that parses an rss feed. In the app there are two different types of feeds with different names for the elements in the feed, so I have created an NSXMLParser NSObject that takes the name of the elements of each feed before parsing. Here is my code: NewsFeedParser.h #import @interface NewsFeedParser : NSObject { NSInteger NewsSelectedCategory; NSXMLParser *NSXMLNewsParser; NSMutableArray *newsCategories; NSMutableDictionary *NewsItem; NSMutableString *NewsCurrentElement, *NewsCurrentElement1, *NewsCurrentElement2, *NewsCurrentElement3; NSString *NewsItemType, *NewsElement1, *NewsElement2, *NewsElement3; NSInteger NewsNumElements; } - (void) parseXMLFileAtURL:(NSString *)URL; @property(nonatomic, retain) NSString *NewsItemType; @property(nonatomic, retain) NSString *NewsElement1; @property(nonatomic, retain) NSString *NewsElement2; @property(nonatomic, retain) NSString *NewsElement3; @property(nonatomic, retain) NSMutableArray *newsCategories; @property(assign, nonatomic) NSInteger NewsNumElements; @end NewsFeedParser.m #import "NewsFeedParser.h" @implementation NewsFeedParser @synthesize NewsItemType; @synthesize NewsElement1; @synthesize NewsElement2; @synthesize NewsElement3; @synthesize newsCategories; @synthesize NewsNumElements; - (void)parserDidStartDocument:(NSXMLParser *)parser{ } - (void)parseXMLFileAtURL:(NSString *)URL { newsCategories = [[NSMutableArray alloc] init]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@"\n" withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; //you must then convert the path to a proper NSURL or it won't work NSURL *xmlURL = [NSURL URLWithString:URL]; // here, for some reason you have to use NSClassFromString when trying to alloc NSXMLParser, otherwise you will get an object not found error // this may be necessary only for the toolchain [[NSURLCache sharedURLCache] setMemoryCapacity:0]; [[NSURLCache sharedURLCache] setDiskCapacity:0]; NSXMLNewsParser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; // Set self as the delegate of the parser so that it will receive the parser delegate methods callbacks. [NSXMLNewsParser setDelegate:self]; // Depending on the XML document you're parsing, you may want to enable these features of NSXMLParser. [NSXMLNewsParser setShouldProcessNamespaces:NO]; [NSXMLNewsParser setShouldReportNamespacePrefixes:NO]; [NSXMLNewsParser setShouldResolveExternalEntities:NO]; [NSXMLNewsParser parse]; [NSXMLNewsParser release]; } - (void)parser:(NSXMLParser *)parser parseErrorOccurred:(NSError *)parseError { NSString * errorString = [NSString stringWithFormat:@"Unable to download story feed from web site (Error code %i )", [parseError code]]; NSLog(@"error parsing XML: %@", errorString); UIAlertView * errorAlert = [[UIAlertView alloc] initWithTitle:@"Error loading content" message:errorString delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [errorAlert show]; [errorAlert release]; [errorString release]; } - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ NewsCurrentElement = [elementName copy]; if ([elementName isEqualToString:NewsItemType]) { // clear out our story item caches... NewsItem = [[NSMutableDictionary alloc] init]; NewsCurrentElement1 = [[NSMutableString alloc] init]; NewsCurrentElement2 = [[NSMutableString alloc] init]; if(NewsNumElements == 3) { NewsCurrentElement3 = [[NSMutableString alloc] init]; } } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ if ([elementName isEqualToString:NewsItemType]) { // save values to an item, then store that item into the array... [NewsItem setObject:NewsCurrentElement1 forKey:NewsElement1]; [NewsItem setObject:NewsCurrentElement2 forKey:NewsElement2]; if(NewsNumElements == 3) { [NewsItem setObject:NewsCurrentElement3 forKey:NewsElement3]; } [newsCategories addObject:[[NewsItem copy] autorelease]]; [NewsCurrentElement release]; [NewsCurrentElement1 release]; [NewsCurrentElement2 release]; if(NewsNumElements == 3) { [NewsCurrentElement3 release]; } [NewsItem release]; } } - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { //NSLog(@"found characters: %@", string); // save the characters for the current item... if ([NewsCurrentElement isEqualToString:NewsElement1]) { [NewsCurrentElement1 appendString:string]; } else if ([NewsCurrentElement isEqualToString:NewsElement2]) { [NewsCurrentElement2 appendString:string]; } else if (NewsNumElements == 3 && [NewsCurrentElement isEqualToString:NewsElement3]) { [NewsCurrentElement3 appendString:string]; } } - (void)dealloc { [super dealloc]; [newsCategories release]; [NewsItemType release]; [NewsElement1 release]; [NewsElement2 release]; [NewsElement3 release]; } When I create an instance of the class I do like so: NewsFeedParser *categoriesParser = [[NewsFeedParser alloc] init]; if(newsCat == 0) { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"catid"; } else { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"feedUrl"; } [categoriesParser parseXMLFileAtURL:feedUrl]; newsCategories = [[NSMutableArray alloc] initWithArray:categoriesParser.newsCategories copyItems:YES]; [self.tableView reloadData]; [categoriesParser release]; If I run the app with the leaks instrument, the leaks point to the [NSXMLNewsParser parse] call in the NewsFeedParser.m. Here is a screen shot of the Leaks instrument with the NSCFStrings leaking: http://img139.imageshack.us/img139/3997/leaks.png For the life of me I can't figure out where these leaks are coming from. Any help would be greatly appreciated.

    Read the article

  • Error with Phoenix placeholder _val in Boost.Spirit.Lex :(

    - by GooRoo
    Hello, everybody. I'm newbie in Boost.Spirit.Lex. Some strange error appears every time I try to use lex::_val in semantics actions in my simple lexer: #ifndef _TOKENS_H_ #define _TOKENS_H_ #include <iostream> #include <string> #include <boost/spirit/include/lex_lexertl.hpp> #include <boost/spirit/include/phoenix_operator.hpp> #include <boost/spirit/include/phoenix_statement.hpp> #include <boost/spirit/include/phoenix_container.hpp> namespace lex = boost::spirit::lex; namespace phx = boost::phoenix; enum tokenids { ID_IDENTIFICATOR = 1, ID_CONSTANT, ID_OPERATION, ID_BRACKET, ID_WHITESPACES }; template <typename Lexer> struct mega_tokens : lex::lexer<Lexer> { mega_tokens() : identifier(L"[a-zA-Z_][a-zA-Z0-9_]*", ID_IDENTIFICATOR) , constant (L"[0-9]+(\\.[0-9]+)?", ID_CONSTANT ) , operation (L"[\\+\\-\\*/]", ID_OPERATION ) , bracket (L"[\\(\\)\\[\\]]", ID_BRACKET ) { using lex::_tokenid; using lex::_val; using phx::val; this->self = operation [ std::wcout << val(L'<') << _tokenid // << val(L':') << lex::_val << val(L'>') ] | identifier [ std::wcout << val(L'<') << _tokenid << val(L':') << _val << val(L'>') ] | constant [ std::wcout << val(L'<') << _tokenid // << val(L':') << _val << val(L'>') ] | bracket [ std::wcout << phx::val(lex::_val) << val(L'<') << _tokenid // << val(L':') << lex::_val << val(L'>') ] ; } lex::token_def<wchar_t, wchar_t> operation; lex::token_def<std::wstring, wchar_t> identifier; lex::token_def<double, wchar_t> constant; lex::token_def<wchar_t, wchar_t> bracket; }; #endif // _TOKENS_H_ and #include <cstdlib> #include <iostream> #include <locale> #include <boost/spirit/include/lex_lexertl.hpp> #include "tokens.h" int main() { setlocale(LC_ALL, "Russian"); namespace lex = boost::spirit::lex; typedef std::wstring::iterator base_iterator; typedef lex::lexertl::token < base_iterator, boost::mpl::vector<wchar_t, std::wstring, double, wchar_t>, boost::mpl::true_ > token_type; typedef lex::lexertl::actor_lexer<token_type> lexer_type; typedef mega_tokens<lexer_type>::iterator_type iterator_type; mega_tokens<lexer_type> mega_lexer; std::wstring str = L"alfa+x1*(2.836-x2[i])"; base_iterator first = str.begin(); bool r = lex::tokenize(first, str.end(), mega_lexer); if (r) { std::wcout << L"Success" << std::endl; } else { std::wstring rest(first, str.end()); std::wcerr << L"Lexical analysis failed\n" << L"stopped at: \"" << rest << L"\"\n"; } return EXIT_SUCCESS; } This code causes an error in Boost header 'boost/spirit/home/lex/argument.hpp' on line 167 while compiling: return: can't convert 'const boost::variant' to 'boost::variant &' When I don't use lex::_val program compiles with no errors. Obviously, I use _val in wrong way, but I do not know how to do this correctly. Help, please! :) P.S. And sorry for my terrible English…

    Read the article

  • Webcam api error when accessed from ASP.NET Server-side code

    - by Eyla
    I'm tring to use webcam api with asp.net and C#. I included all the library and references I needed for that. the original code I'm use was for windows application and I'm trying to convert it to asp.net web application. I have start capturing button when I click it, it should start capturing but it gives me an error. the error at this line: hHwnd = capCreateCaptureWindowA(iDevice.ToString(), (WS_VISIBLE | WS_CHILD), 0, 0, 640, 480, picCapture.Handle.ToInt32(), 0); and the error message is: Error 1 'System.Web.UI.WebControls.Image' does not contain a definition for 'Handle' and no extension method 'Handle' accepting a first argument of type 'System.Web.UI.WebControls.Image' could be found (are you missing a using directive or an assembly reference?) C:\Users\Ali\Documents\Visual Studio 2008\Projects\Conference\Conference\Conference1.aspx.cs 63 117 Conference Please advice!! ................................................ here is the complete code ........................................... using System; using System.Collections; using System.Drawing; using System.ComponentModel; using System.Windows.Forms; using System.Configuration; using System.Data; using System.Linq; using System.Web; using System.Web.Security; using System.Web.UI; using System.Web.UI.HtmlControls; using System.Web.UI.WebControls; using System.Web.UI.WebControls.WebParts; using System.Xml.Linq; using System.Runtime.InteropServices; using System.Drawing.Imaging; using System.Net; using System.Net.Sockets; using System.Threading; using System.IO; namespace Conference { public partial class Conference1 : System.Web.UI.Page { #region WebCam API const short WM_CAP = 1024; const int WM_CAP_DRIVER_CONNECT = WM_CAP + 10; const int WM_CAP_DRIVER_DISCONNECT = WM_CAP + 11; const int WM_CAP_EDIT_COPY = WM_CAP + 30; const int WM_CAP_SET_PREVIEW = WM_CAP + 50; const int WM_CAP_SET_PREVIEWRATE = WM_CAP + 52; const int WM_CAP_SET_SCALE = WM_CAP + 53; const int WS_CHILD = 1073741824; const int WS_VISIBLE = 268435456; const short SWP_NOMOVE = 2; const short SWP_NOSIZE = 1; const short SWP_NOZORDER = 4; const short HWND_BOTTOM = 1; int iDevice = 0; int hHwnd; [System.Runtime.InteropServices.DllImport("user32", EntryPoint = "SendMessageA")] static extern int SendMessage(int hwnd, int wMsg, int wParam, [MarshalAs(UnmanagedType.AsAny)] object lParam); [System.Runtime.InteropServices.DllImport("user32", EntryPoint = "SetWindowPos")] static extern int SetWindowPos(int hwnd, int hWndInsertAfter, int x, int y, int cx, int cy, int wFlags); [System.Runtime.InteropServices.DllImport("user32")] static extern bool DestroyWindow(int hndw); [System.Runtime.InteropServices.DllImport("avicap32.dll")] static extern int capCreateCaptureWindowA(string lpszWindowName, int dwStyle, int x, int y, int nWidth, short nHeight, int hWndParent, int nID); [System.Runtime.InteropServices.DllImport("avicap32.dll")] static extern bool capGetDriverDescriptionA(short wDriver, string lpszName, int cbName, string lpszVer, int cbVer); private void OpenPreviewWindow() { int iHeight = 320; int iWidth = 200; // // Open Preview window in picturebox // hHwnd = capCreateCaptureWindowA(iDevice.ToString(), (WS_VISIBLE | WS_CHILD), 0, 0, 640, 480, picCapture.Handle.ToInt32(), 0); // // Connect to device // if (SendMessage(hHwnd, WM_CAP_DRIVER_CONNECT, iDevice, 0) == 1) { // // Set the preview scale // SendMessage(hHwnd, WM_CAP_SET_SCALE, 1, 0); // // Set the preview rate in milliseconds // SendMessage(hHwnd, WM_CAP_SET_PREVIEWRATE, 66, 0); // // Start previewing the image from the camera // SendMessage(hHwnd, WM_CAP_SET_PREVIEW, 1, 0); // // Resize window to fit in picturebox // SetWindowPos(hHwnd, HWND_BOTTOM, 0, 0, iWidth, iHeight, (SWP_NOMOVE | SWP_NOZORDER)); } else { // // Error connecting to device close window // DestroyWindow(hHwnd); } } private void ClosePreviewWindow() { // // Disconnect from device // SendMessage(hHwnd, WM_CAP_DRIVER_DISCONNECT, iDevice, 0); // // close window // DestroyWindow(hHwnd); } #endregion protected void Page_Load(object sender, EventArgs e) { } protected void btnStart_Click(object sender, EventArgs e) { int iDevice = int.Parse(device_number_textBox.Text); OpenPreviewWindow(); } } }

    Read the article

  • plot negative and positive values in same Y-axis in coreplot ios

    - by user3774439
    I have an issue in converting axis labels to int or float values. This is my Y-Axis. It contains temperature values contains -50, 33, 117, 200. CPTXYAxis *y = axisSet.yAxis; y.labelingPolicy = CPTAxisLabelingPolicyNone; y.orthogonalCoordinateDecimal = CPTDecimalFromUnsignedInteger(1); y.majorGridLineStyle = majorGridLineStyle; y.minorGridLineStyle = minorGridLineStyle; y.minorTicksPerInterval = 0.0; y.labelOffset = 0.0; y.title = @""; y.titleOffset = 0.0; NSMutableSet *yLabels = [NSMutableSet setWithCapacity:4]; NSMutableSet *yLocations = [NSMutableSet setWithCapacity:4]; NSArray *yAxisLabels = [NSArray arrayWithObjects:@"-50", @"33", @"117", @"200", nil]; NSNumberFormatter * nFormatter = [[NSNumberFormatter alloc] init]; [nFormatter setNumberStyle:NSNumberFormatterDecimalStyle]; for ( NSUInteger i = 0; i < [yAxisLabels count]; i++ ) { NSLog(@"%@",[yAxisLabels objectAtIndex:i]); CPTAxisLabel *label = [[CPTAxisLabel alloc] initWithText:[NSString stringWithFormat:@"%@",[yAxisLabels objectAtIndex:i]] textStyle:axisTextStyle]; label.tickLocation = CPTDecimalFromUnsignedInteger(i); label.offset = y.majorTickLength; if (label) { [yLabels addObject:label]; [yLocations addObject:[NSDecimalNumber numberWithUnsignedInteger:i]]; } label = nil; } y.axisLabels = yLabels; y.majorTickLocations = yLocations; y.labelFormatter = nFormatter; Now, my issue is.. I am getting data from the BLE device as temperature values as strings like 50, 60.3, etc... Now I want plot these values from BLE device with the Y-axis values. i am unable convert these Y-axis labels to temperature values. Could you please help me guys...I have tried many time still no luck. Please help me UPDATE:: This is the way I am creating scatterplot: -(void)createScatterPlotsWithIdentifier:(NSString *)identifier color:(CPTColor *)color forGraph:(CPTGraph *)graph forXYPlotSpace:(CPTXYPlotSpace *)plotSpace{ CPTScatterPlot *scatterPlot = [[CPTScatterPlot alloc] init]; scatterPlot.dataSource = self; scatterPlot.identifier = identifier; //Plot a graph with in the plotspace [plotSpace scaleToFitPlots:[NSArray arrayWithObjects:scatterPlot, nil]]; plotSpace.xRange = [CPTPlotRange plotRangeWithLocation:CPTDecimalFromUnsignedInteger(0) length:CPTDecimalFromUnsignedInteger(30)]; plotSpace.yRange = [CPTPlotRange plotRangeWithLocation:CPTDecimalFromUnsignedInteger(-50) length:CPTDecimalFromUnsignedInteger(250)]; CPTMutablePlotRange *xRange = [[self getCoreplotSpace].xRange mutableCopy]; [xRange expandRangeByFactor:CPTDecimalFromCGFloat(-1)]; [self getCoreplotSpace].xRange = xRange; CPTMutableLineStyle *scatterLineStyle = [scatterPlot.dataLineStyle mutableCopy]; scatterLineStyle.lineWidth = 1; scatterLineStyle.lineColor = color; scatterPlot.dataLineStyle = scatterLineStyle; CPTMutableLineStyle *scatterSymbolLineStyle = [CPTMutableLineStyle lineStyle]; scatterSymbolLineStyle.lineColor = color; CPTPlotSymbol *scatterSymbol = [CPTPlotSymbol ellipsePlotSymbol]; scatterSymbol.fill = [CPTFill fillWithColor:color]; scatterSymbol.lineStyle = scatterSymbolLineStyle; scatterSymbol.size = CGSizeMake(2.0f, 2.0f); scatterPlot.plotSymbol = scatterSymbol; [graph addPlot:scatterPlot toPlotSpace:plotSpace]; } Configuring the Y-axis like this: NSMutableSet *yLabels = [NSMutableSet setWithCapacity:4]; NSMutableSet *yLocations = [NSMutableSet setWithCapacity:4]; NSArray *yAxisLabels = [NSArray arrayWithObjects:@"-50", @"33", @"117", @"200", nil]; NSArray *customTickLocations = [NSArray arrayWithObjects:[NSDecimalNumber numberWithUnsignedInt:-50], [NSDecimalNumber numberWithInt:33], [NSDecimalNumber numberWithInt:117], [NSDecimalNumber numberWithInt:200],nil]; for ( NSUInteger i = 0; i < [yAxisLabels count]; i++ ) { NSLog(@"%@",[yAxisLabels objectAtIndex:i]); CPTAxisLabel *label = [[CPTAxisLabel alloc] initWithText:[NSString stringWithFormat:@"%@",[yAxisLabels objectAtIndex:i]] textStyle:axisTextStyle]; label.tickLocation = CPTDecimalFromInteger([[customTickLocations objectAtIndex:i] integerValue]); label.offset = y.majorTickLength; if (label) { [yLabels addObject:label]; [yLocations addObject:[NSString stringWithFormat:@"%d",[[customTickLocations objectAtIndex:i] integerValue]]]; } label = nil; } y.axisLabels = yLabels; y.majorTickLocations = [NSSet setWithArray:customTickLocations]; Eric, I set the range as you said in CreateSctterPlot method. But In horizontal line on graph are not coming. Could you please help me what I am wrong. Thanks

    Read the article

  • Parsing "true" and "false" using Boost.Spirit.Lex and Boost.Spirit.Qi

    - by Andrew Ross
    As the first stage of a larger grammar using Boost.Spirit I'm trying to parse "true" and "false" to produce the corresponding bool values, true and false. I'm using Spirit.Lex to tokenize the input and have a working implementation for integer and floating point literals (including those expressed in a relaxed scientific notation), exposing int and float attributes. Token definitions #include <boost/spirit/include/lex_lexertl.hpp> namespace lex = boost::spirit::lex; typedef boost::mpl::vector<int, float, bool> token_value_type; template <typename Lexer> struct basic_literal_tokens : lex::lexer<Lexer> { basic_literal_tokens() { this->self.add_pattern("INT", "[-+]?[0-9]+"); int_literal = "{INT}"; // To be lexed as a float a numeric literal must have a decimal point // or include an exponent, otherwise it will be considered an integer. float_literal = "{INT}(((\\.[0-9]+)([eE]{INT})?)|([eE]{INT}))"; literal_true = "true"; literal_false = "false"; this->self = literal_true | literal_false | float_literal | int_literal; } lex::token_def<int> int_literal; lex::token_def<float> float_literal; lex::token_def<bool> literal_true, literal_false; }; Testing parsing of float literals My real implementation uses Boost.Test, but this is a self-contained example. #include <string> #include <iostream> #include <cmath> #include <cstdlib> #include <limits> bool parse_and_check_float(std::string const & input, float expected) { typedef std::string::const_iterator base_iterator_type; typedef lex::lexertl::token<base_iterator_type, token_value_type > token_type; typedef lex::lexertl::lexer<token_type> lexer_type; basic_literal_tokens<lexer_type> basic_literal_lexer; base_iterator_type input_iter(input.begin()); float actual; bool result = lex::tokenize_and_parse(input_iter, input.end(), basic_literal_lexer, basic_literal_lexer.float_literal, actual); return result && std::abs(expected - actual) < std::numeric_limits<float>::epsilon(); } int main(int argc, char *argv[]) { if (parse_and_check_float("+31.4e-1", 3.14)) { return EXIT_SUCCESS; } else { return EXIT_FAILURE; } } Parsing "true" and "false" My problem is when trying to parse "true" and "false". This is the test code I'm using (after removing the Boost.Test parts): bool parse_and_check_bool(std::string const & input, bool expected) { typedef std::string::const_iterator base_iterator_type; typedef lex::lexertl::token<base_iterator_type, token_value_type > token_type; typedef lex::lexertl::lexer<token_type> lexer_type; basic_literal_tokens<lexer_type> basic_literal_lexer; base_iterator_type input_iter(input.begin()); bool actual; lex::token_def<bool> parser = expected ? basic_literal_lexer.literal_true : basic_literal_lexer.literal_false; bool result = lex::tokenize_and_parse(input_iter, input.end(), basic_literal_lexer, parser, actual); return result && actual == expected; } but compilation fails with: boost/spirit/home/qi/detail/assign_to.hpp: In function ‘void boost::spirit::traits::assign_to(const Iterator&, const Iterator&, Attribute&) [with Iterator = __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >, Attribute = bool]’: boost/spirit/home/lex/lexer/lexertl/token.hpp:434: instantiated from ‘static void boost::spirit::traits::assign_to_attribute_from_value<Attribute, boost::spirit::lex::lexertl::token<Iterator, AttributeTypes, HasState>, void>::call(const boost::spirit::lex::lexertl::token<Iterator, AttributeTypes, HasState>&, Attribute&) [with Attribute = bool, Iterator = __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >, AttributeTypes = boost::mpl::vector<int, float, bool, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na, mpl_::na>, HasState = mpl_::bool_<true>]’ ... backtrace of instantiation points .... boost/spirit/home/qi/detail/assign_to.hpp:79: error: no matching function for call to ‘boost::spirit::traits::assign_to_attribute_from_iterators<bool, __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >, void>::call(const __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >&, const __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >&, bool&)’ boost/spirit/home/qi/detail/construct.hpp:64: note: candidates are: static void boost::spirit::traits::assign_to_attribute_from_iterators<bool, Iterator, void>::call(const Iterator&, const Iterator&, char&) [with Iterator = __gnu_cxx::__normal_iterator<const char*, std::basic_string<char, std::char_traits<char>, std::allocator<char> > >] My interpretation of this is that Spirit.Qi doesn't know how to convert a string to a bool - surely that's not the case? Has anyone else done this before? If so, how?

    Read the article

  • HTML/CSS - Website Help.

    - by gabeaudick
    I'm trying to build my first website from scratch. I mocked up the design in Photoshop, and have been trying to convert into code for a few hours. But I haven't got far. In fact, I'm stuck on the header's navigation bar. It looks right, but it doesn't work. I'm using an unordered-inline list, and trying to link different rectangles in the header. I can't click on anything in the header, though. The code for the html and css files, and a mockup of the header, are below. Any advice on why the header bar isn't working would be much appreciated. Here's a link to the image: http://rookery9.aviary.com.s3.amazonaws.com/3961000/3961027_eb89_625x625.jpg *Ideally, you would be able to click on either "". home.html: <!DOCTYPE HTML PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <!-- Title --> <title>I am Gabe Audick.</title> <!-- Meta --> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="Author" content="Gabe Audick" /> <meta name="Copyright" content="Gabe Audick" /> <!-- Stylesheets --> <link href="style.css" media="screen" rel="stylesheet" type="text/css" /> <!-- RSS --> <link rel="alternate" type="application/rss+xml" title="gabeaudick RSS" href="http://feeds.feedburner.com/gabeaudick" /> </head> <body> <!-- Navigation Bar --> <div id="wrap"> <div id="header"> <ul> <li><a href="#">Previous</a></li> <li><a href="#">Home</a></li> <li><a href="#">Next</a></li> </ul> </div> </div> <!-- END --> <!-- Google Analytics --> <script type="text/javascript"> var _gaq = _gaq || []; _gaq.push(['_setAccount', 'UA-5899101-4']); _gaq.push(['_trackPageview']); (function() { var ga = document.createElement('script'); ga.type = 'text/javascript'; ga.async = true; ga.src = ('https:' == document.location.protocol ? 'https://ssl' : 'http://www') + '.google-analytics.com/ga.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(ga, s); })(); </script> <!-- End of Google Analytics --> </body> </html> style.css: * { margin: 0; padding: 0; } body { background-color: #fff; color: #000; font-size: 14px; font-family: 'Century Gothic', Helvetica, sans-serif; position: relative; } #wrap { background-color: #000; color: #fbead; height: 26px; width: 100%; } #header { background: url(./images/home.gif) center no-repeat #000; height: 26px; } #header ul li{ float:left; list-style-type:none; margin-right:12px; text-indent:-9999px; } #header li a:link, #header li a:visited{ outline:none; display:block; height:26px; text-indent:-9999px; }

    Read the article

  • How to find vector for the quaternion from X Y Z rotations

    - by can poyrazoglu
    I am creating a very simple project on OpenGL and I'm stuck with rotations. I am trying to rotate an object indepentdently in all 3 axes: X, Y, and Z. I've had sleepless nights due to the "gimbal lock" problem after rotating about one axis. I've then learned that quaternions would solve my problem. I've researched about quaternions and implementd it, but I havent't been able to convert my rotations to quaternions. For example, if I want to rotate around Z axis 90 degrees, I just create the {0,0,1} vector for my quaternion and rotate it around that axis 90 degrees using the code here: http://iphonedevelopment.blogspot.com/2009/06/opengl-es-from-ground-up-part-7_04.html (the most complicated matrix towards the bottom) That's ok for one vector, but, say, I first want to rotate 90 degrees around Z, then 90 degrees around X (just as an example). What vector do I need to pass in? How do I calculate that vector. I am not good with matrices and trigonometry (I know the basics and the general rules, but I'm just not a whiz) but I need to get this done. There are LOTS of tutorials about quaternions, but I seem to understand none (or they don't answer my question). I just need to learn to construct the vector for rotations around more than one axis combined. UPDATE: I've found this nice page about quaternions and decided to implement them this way: http://www.cprogramming.com/tutorial/3d/quaternions.html Here is my code for quaternion multiplication: void cube::quatmul(float* q1, float* q2, float* resultRef){ float w = q1[0]*q2[0] - q1[1]*q2[1] - q1[2]*q2[2] - q1[3]*q2[3]; float x = q1[0]*q2[1] + q1[1]*q2[0] + q1[2]*q2[3] - q1[3]*q2[2]; float y = q1[0]*q2[2] - q1[1]*q2[3] + q1[2]*q2[0] + q1[3]*q2[1]; float z = q1[0]*q2[3] + q1[1]*q2[2] - q1[2]*q2[1] + q1[3]*q2[0]; resultRef[0] = w; resultRef[1] = x; resultRef[2] = y; resultRef[3] = z; } Here is my code for applying a quaternion to my modelview matrix (I have a tmodelview variable that is my target modelview matrix): void cube::applyquat(){ float& x = quaternion[1]; float& y = quaternion[2]; float& z = quaternion[3]; float& w = quaternion[0]; float magnitude = sqrtf(w * w + x * x + y * y + z * z); if(magnitude == 0){ x = 1; w = y = z = 0; }else if(magnitude != 1){ x /= magnitude; y /= magnitude; z /= magnitude; w /= magnitude; } tmodelview[0] = 1 - (2 * y * y) - (2 * z * z); tmodelview[1] = 2 * x * y + 2 * w * z; tmodelview[2] = 2 * x * z - 2 * w * y; tmodelview[3] = 0; tmodelview[4] = 2 * x * y - 2 * w * z; tmodelview[5] = 1 - (2 * x * x) - (2 * z * z); tmodelview[6] = 2 * y * z - 2 * w * x; tmodelview[7] = 0; tmodelview[8] = 2 * x * z + 2 * w * y; tmodelview[9] = 2 * y * z + 2 * w * x; tmodelview[10] = 1 - (2 * x * x) - (2 * y * y); tmodelview[11] = 0; glMatrixMode(GL_MODELVIEW); glPushMatrix(); glLoadMatrixf(tmodelview); glMultMatrixf(modelview); glGetFloatv(GL_MODELVIEW_MATRIX, tmodelview); glPopMatrix(); } And my code for rotation (that I call externally), where quaternion is a class variable of the cube: void cube::rotatex(int angle){ float quat[4]; float ang = angle * PI / 180.0; quat[0] = cosf(ang / 2); quat[1] = sinf(ang/2); quat[2] = 0; quat[3] = 0; quatmul(quat, quaternion, quaternion); applyquat(); } void cube::rotatey(int angle){ float quat[4]; float ang = angle * PI / 180.0; quat[0] = cosf(ang / 2); quat[1] = 0; quat[2] = sinf(ang/2); quat[3] = 0; quatmul(quat, quaternion, quaternion); applyquat(); } void cube::rotatez(int angle){ float quat[4]; float ang = angle * PI / 180.0; quat[0] = cosf(ang / 2); quat[1] = 0; quat[2] = 0; quat[3] = sinf(ang/2); quatmul(quat, quaternion, quaternion); applyquat(); } I call, say rotatex, for 10-11 times for rotating only 1 degree, but my cube gets rotated almost 90 degrees after 10-11 times of 1 degree, which doesn't make sense. Also, after calling rotation functions in different axes, My cube gets skewed, gets 2 dimensional, and disappears (a column in modelview matrix becomes all zeros) irreversibly, which obviously shouldn't be happening with a correct implementation of the quaternions.

    Read the article

  • Drupal Adding Span inside A tags in Nice Menus

    - by Chris
    I am trying to add drop down menus to a drupal theme which uses text sliding door CSS rounding. The current version uses a primary links injection of the span into the a tags, which works fine. But doesn't support drop down menus. Working code: <?php print theme('links', $primary_links, array('class' => 'links primary-links')) ?> In the template with a template.php file addition: <?php // function for injecting spans inside anchors which we need for the theme's rounded corner background images function strands_guybrush_links($links, $attributes = array('class' => 'links')) { $output = ''; if (count($links) > 0) { $output = '<ul'. drupal_attributes($attributes) .'>'; $num_links = count($links); $i = 1; foreach ($links as $key => $link) { $class = $key; // Add first, last and active classes to the list of links to help out themers. if ($i == 1) { $class .= ' first'; } if ($i == $num_links) { $class .= ' last'; } if (isset($link['href']) && ($link['href'] == $_GET['q'] || ($link['href'] == '<front>' && drupal_is_front_page()))) { $class .= ' active'; } $output .= '<li'. drupal_attributes(array('class' => $class)) .'>'; if (isset($link['href'])) { $link['title'] = '<span class="link">' . check_plain($link['title']) . '</span>'; $link['html'] = TRUE; // Pass in $link as $options, they share the same keys. $output .= l($link['title'], $link['href'], $link); } else if (!empty($link['title'])) { // Some links are actually not links, but we wrap these in <span> for adding title and class attributes if (empty($link['html'])) { $link['title'] = check_plain($link['title']); } $span_attributes = ''; if (isset($link['attributes'])) { $span_attributes = drupal_attributes($link['attributes']); } $output .= '<span'. $span_attributes .'>'. $link['title'] .'</span>'; } $i++; $output .= "</li>\n"; } $output .= '</ul>'; } return $output; } ?> So I have added the [Nice Menu module][1] which works well and allows the drop down menu functions for my navigation which is now addressed from the template using: <?php print theme_nice_menu_primary_links() ?> The issue is that the a tags need to have spans inside to allow for the selected state markup. I have tried every angle I could find to edit the drupal function menu_item_link which is used by nice menus to build the links. E.g. I looked at the drupal forum for two days and no joy. The lines in the module that build the links are: function theme_nice_menu_build($menu) { $output = ''; // Find the active trail and pull out the menus ids. menu_set_active_menu_name('primary-links'); $trail = menu_get_active_trail('primary-links'); foreach ($trail as $item) { $trail_ids[] = $item['mlid']; } foreach ($menu as $menu_item) { $mlid = $menu_item['link']['mlid']; // Check to see if it is a visible menu item. if ($menu_item['link']['hidden'] == 0) { // Build class name based on menu path // e.g. to give each menu item individual style. // Strip funny symbols. $clean_path = str_replace(array('http://', '<', '>', '&', '=', '?', ':'), '', $menu_item['link']['href']); // Convert slashes to dashes. $clean_path = str_replace('/', '-', $clean_path); $class = 'menu-path-'. $clean_path; $class .= in_array($mlid, $trail_ids) ? ' active' : ''; // If it has children build a nice little tree under it. if ((!empty($menu_item['link']['has_children'])) && (!empty($menu_item['below']))) { // Keep passing children into the function 'til we get them all. $children = theme('nice_menu_build', $menu_item['below']); // Set the class to parent only of children are displayed. $class .= $children ? ' menuparent ' : ''; // Add an expanded class for items in the menu trail. $output .= '<li id="menu-'. $mlid .'" class="'. $class .'">'. theme('menu_item_link', $menu_item['link']); // Build the child UL only if children are displayed for the user. if ($children) { $output .= '<ul>'; $output .= $children; $output .= "</ul>\n"; } $output .= "</li>\n"; } else { $output .= '<li id="menu-'. $mlid .'" class="'. $class .'">'. theme('menu_item_link', $menu_item['link']) .'</li>'."\n"; } } } return $output; } As you can see the $output uses menu_item_link to parse the array into links and to added the class of active to the selected navigation link. The question is how do I add a span inside the a tags OR how do I wrap the a tags with a span that has the active class to style the sliding door links? drupal.org/project/nice_menus drupal.org/node/53233

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • Matlab Image watermarking question , using both SVD and DWT

    - by Georgek
    Hello all . here is a code that i got over the net ,and it is supposed to embed a watermark of size(50*20) called _copyright.bmp in the Code below . the size of the cover object is (512*512), it is called _lena_std_bw.bmp.What we did here is we did DWT2 2 times for the image , when we reached our second dwt2 cA2 size is 128*128. You should notice that the blocksize and it equals 4, it is used to determine the max msg size based on cA2 according to the following code:max_message=RcA2*CcA2/(blocksize^2). in our current case max_message would equal 128*128/(4^2)=1024. i want to embed a bigger watermark in the 2nd dwt2 and lets say the size of that watermark is 400*10(i can change the dimension using MS PAINT), what i have to do is change the size of the blocksize to 2. so max_message=4096.Matlab gives me 3 errors and they are : ??? Error using == plus Matrix dimensions must agree. Error in == idwt2 at 93 x = upsconv2(a,{Lo_R,Lo_R},sx,dwtEXTM,shift)+ ... % Approximation. Error in == two_dwt_svd_low_low at 88 CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); The origional Code is (the origional code where blocksize =4): %This algorithm makes DWT for the whole image and after that make DWT for %cH1 and make SVD for cH2 and embed the watermark in every level after SVD %(1) -------------- Embed Watermark ------------------------------------ %Add the watermar W to original image I and give the watermarked image in J %-------------------------------------------------------------------------- % set the gain factor for embeding and threshold for evaluation clc; clear all; close all; % save start time start_time=cputime; % set the value of threshold and alpha thresh=.5; alpha =0.01; % read in the cover object file_name='_lena_std_bw.bmp'; cover_object=double(imread(file_name)); % determine size of watermarked image Mc=size(cover_object,1); %Height Nc=size(cover_object,2); %Width % read in the message image and reshape it into a vector file_name='_copyright.bmp'; message=double(imread(file_name)); T=message; Mm=size(message,1); %Height Nm=size(message,2); %Width % perform 1-level DWT for the whole cover image [cA1,cH1,cV1,cD1] = dwt2(cover_object,'haar'); % determine the size of cA1 [RcA1 CcA1]=size(cA1) % perform 2-level DWT for cA1 [cA2,cH2,cV2,cD2] = dwt2(cA1,'haar'); % determine the size of cA2 [RcA2 CcA2]=size(cA2) % set the value of blocksize blocksize=4 % reshape the watermark to a vector message_vector=round(reshape(message,Mm*Nm,1)./256); W=message_vector; % determine maximum message size based on cA2, and blocksize max_message=RcA2*CcA2/(blocksize^2) % check that the message isn't too large for cover if (length(message) max_message) error('Message too large to fit in Cover Object') end %----------------------- process the image in blocks ---------------------- x=1; y=1; for (kk = 1:length(message_vector)) [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); % if message bit contains zero, modify S of the original image if (message_vector(kk) == 0) cA2s = cA2s*(1 + alpha); % otherwise mask is filled with zeros else cA2s=cA2s; end cA22(y:y+blocksize-1,x:x+blocksize-1)=cA2u*cA2s*cA2v; % move to next block of mask along x; If at end of row, move to next row if (x+blocksize) >= CcA2 x=1; y=y+blocksize; else x=x+blocksize; end end % perform IDWT CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); watermarked_image= idwt2(CAA1,cH1,cV1,cD1,'haar',[Mc,Nc]); % convert back to uint8 watermarked_image_uint8=uint8(watermarked_image); % write watermarked Image to file imwrite(watermarked_image_uint8,'dwt_watermarked.bmp','bmp'); % display watermarked image figure(1) imshow(watermarked_image_uint8,[]) title('Watermarked Image') %(2) ---------------------------------------------------------------------- %---------- Extract Watermark from attacked watermarked image ------------- %-------------------------------------------------------------------------- % read in the watermarked object file_name='dwt_watermarked.bmp'; watermarked_image=double(imread(file_name)); % determine size of watermarked image Mw=size(watermarked_image,1); %Height Nw=size(watermarked_image,2); %Width % perform 1-level DWT for the whole watermarked image [ca1,ch1,cv1,cd1] = dwt2(watermarked_image,'haar'); % determine the size of ca1 [Rca1 Cca1]=size(ca1); % perform 2-level DWT for ca1 [ca2,ch2,cv2,cd2] = dwt2(ca1,'haar'); % determine the size of ca2 [Rca2 Cca2]=size(ca2); % process the image in blocks % for each block get a bit for message x=1; y=1; for (kk = 1:length(message_vector)) % sets correlation to 1 when patterns are identical to avoid /0 errors % otherwise calcluate difference between the cover image and the % watermarked image [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); [ca2u1 ca2s1 ca2v1]=svd(ca2(y:y+blocksize-1,x:x+blocksize-1)); correlation(kk)=diag(ca2s1-cA2s)'*diag(ca2s1-cA2s)/(alpha*alpha)/(diag(cA2s)*diag(cA2s)); % move on to next block. At and of row move to next row if (x+blocksize) >= Cca2 x=1; y=y+blocksize; else x=x+blocksize; end end % if correlation exceeds average correlation correlation(kk)=correlation(kk)+mean(correlation(1:Mm*Nm)); for kk = 1:length(correlation) if (correlation(kk) > thresh*alpha);%thresh*mean(correlation(1:Mo*No))) message_vector(kk)=0; end end % reshape the message vector and display recovered watermark. figure(2) message=reshape(message_vector(1:Mm*Nm),Mm,Nm); imshow(message,[]) title('Recovered Watermark') % display processing time elapsed_time=cputime-start_time, please do help,its my graduation project and i have been trying this code for along time but failed miserable. Thanks in advance

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • asp.net - csharp - jquery - looking for a better and usage solution

    - by LostLord
    hi my dear friends i have a little problem about using jquery...(i reeally do not know jquery but i forced to use it) i am using vs 2008 - asp.net web app with c# also i am using telerik controls in my pages also i am using sqldatasources (Connecting to storedprocedures) in my pages my pages base on master and content pages and in content pages i have mutiviews ================================================================================= in one of the views(inside one of those multiviews)i had made two radcombo boxes for country and city requirement like cascading dropdowns as parent and child combo boxes. i used old way for doing that , i mean i used update panel and in the SelectedIndexChange Event of Parent RadComboBox(Country) i Wrote this code : protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } my child radcombo box can fill by upper code , let me tell you how : the child sqldatasource have a sp that has a parameter and i fill that parameter by this line - hfSelectedCo_ID.Value = RadcbCoNameInInsert.SelectedValue; RadcbCoNameInInsert.SelectedValue means country ID. after doing that SelectedIndexChange Event of Parent RadComboBox(Country) could not be fire therefore i forced to set the autopostback property to true. afetr doing that every thing was ok until some one told me can u control focus and keydown of your radcombo boxes (when u press enter key on the parent combobox[country] , so child combobox gets focus -- and when u press upperkey on child radcombobox [city], so parent combobox[country] gets focus) (For Users That Do Not Want To Use Mouse for Input Info And Choose items) i told him this is web app , not win form and we can not do that. i googled it and i found jquery the only way for doing that ... so i started using jquery . i wrote this code with jquery for both of them : <script src="../JQuery/jquery-1.4.1.js" language="javascript" type="text/javascript"></script> <script type="text/javascript"> $(function() { $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); $('input[id$=RadcomboboxCountry_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 13) { -----------> Enter Key $('input[id$=RadcomboboxCity_Input]').focus(); $('input[id$=RadcomboboxCity_Input]').select(); } }); $('input[id$=RadcomboboxCity_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 38) { -----------> Upper Key $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); } }); }); </script> this jquery code worked BBBBBBUUUUUUUTTTTTT autopostback=true of the Parent RadComboBox Became A Problem , Because when SelectedIndex Change Of ParentRadComboBox is fired after that Telerik Skins runs and after that i lost parent ComboBox Focus and we should use mouse but we don't want it.... for fix this problem i decided to set autopostback of perentCB to false and convert protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } to a public non static method without parameters and call it with jquey like this : (i used onclientchanged property of parentcombo box like onclientchanged = "MyMethodForParentCB_InJquery();" insread of selectedindexchange event) public void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } for doing that i read the blow manual and do that step by step : ======================================================================= http://www.ajaxprojects.com/ajax/tutorialdetails.php?itemid=732 ======================================================================= but this manual is about static methods and this is my new problem ... when i am using static method like : public static void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } so i recieved some errors and this method could not recognize my controls and hidden field... one of those errors like this : Error 2 An object reference is required for the non-static field, method, or property 'Darman.SuperAdmin.Users.hfSelectedCo_ID' C:\Javad\Copy of Darman 6\Darman\SuperAdmin\Users.aspx.cs 231 13 Darman any idea or is there any way to call non static methods with jquery (i know we can not do that but is there another way to solve my problem)???????????????

    Read the article

  • Hibernate Lazy initialization exception problem with Gilead in GWT 2.0 integration

    - by sylsau
    Hello, I use GWT 2.0 as UI layer on my project. On server side, I use Hibernate. For example, this is 2 domains entities that I have : public class User { private Collection<Role> roles; @ManyToMany(cascade = CascadeType.ALL, fetch = FetchType.LAZY, mappedBy = "users", targetEntity = Role.class) public Collection<Role> getRoles() { return roles; } ... } public class Role { private Collection<User> users; @ManyToMany(cascade = CascadeType.ALL, fetch = FetchType.LAZY, targetEntity = User.class) public Collection<User> getUsers() { return users; } ... } On my DAO layer, I use UserDAO that extends HibernateDAOSupport from Spring. UserDAO has getAll method to return all of Users. And on my DAO service, I use UserService that uses userDAO to getAll of Users. So, when I get all of Users from UsersService, Users entities returned are detached from Hibernate session. For that reason, I don't want to use getRoles() method on Users instance that I get from my service. What I want is just to transfer my list of Users thanks to a RPC Service to be able to use others informations of Users in client side with GWT. Thus, my main problem is to be able to convert PersistentBag in Users.roles in simple List to be able to transfer via RPC the Users. To do that, I have seen that Gilead Framework could be a solution. In order to use Gilead, I have changed my domains entities. Now, they extend net.sf.gilead.pojo.gwt.LightEntity and they respect JavaBean specification. On server, I expose my services via RPC thanks to GwtRpcSpring framework (http://code.google.com/p/gwtrpc-spring/). This framework has an advice that makes easier Gilead integration. My applicationContext contains the following configuration for Gilead : <bean id="gileadAdapterAdvisor" class="org.gwtrpcspring.gilead.GileadAdapterAdvice" /> <aop:config> <aop:aspect id="gileadAdapterAspect" ref="gileadAdapterAdvisor"> <aop:pointcut id="gileadPointcut" expression="execution(public * com.google.gwt.user.client.rpc.RemoteService.*(..))" /> <aop:around method="doBasicProfiling" pointcut-ref="gileadPointcut" /> </aop:aspect> </aop:config> <bean id="proxySerializer" class="net.sf.gilead.core.serialization.GwtProxySerialization" /> <bean id="proxyStore" class="net.sf.gilead.core.store.stateless.StatelessProxyStore"> <property name="proxySerializer" ref="proxySerializer" /> </bean> <bean id="persistenceUtil" class="net.sf.gilead.core.hibernate.HibernateUtil"> <property name="sessionFactory" ref="sessionFactory" /> </bean> <bean class="net.sf.gilead.core.PersistentBeanManager"> <property name="proxyStore" ref="proxyStore" /> <property name="persistenceUtil" ref="persistenceUtil" /> </bean> The code of the the method doBasicProfiling is the following : @Around("within(com.google.gwt.user.client.rpc.RemoteService..*)") public Object doBasicProfiling(ProceedingJoinPoint pjp) throws Throwable { if (log.isDebugEnabled()) { String className = pjp.getSignature().getDeclaringTypeName(); String methodName = className .substring(className.lastIndexOf(".") + 1) + "." + pjp.getSignature().getName(); log.debug("Wrapping call to " + methodName + " for PersistentBeanManager"); } GileadHelper.parseInputParameters(pjp.getArgs(), beanManager, RemoteServiceUtil.getThreadLocalSession()); Object retVal = pjp.proceed(); retVal = GileadHelper.parseReturnValue(retVal, beanManager); return retVal; } With that configuration, when I run my application and I use my RPC Service that gets all of Users, I obtain a lazy initialization exception from Hibernate from Users.roles. I am disappointed because I thought that Gilead would let me to serialize my domain entities even if these entities contained PersistentBag. It's not one of the goals of Gilead ? So, someone would know how to configure Gilead (with GwtRpcSpring or other solution) to be able to transfer domain entities without Lazy exception ? Thanks by advance for your help. Sylvain

    Read the article

  • Mutating the expression tree of a predicate to target another type

    - by Jon
    Intro In the application I 'm currently working on, there are two kinds of each business object: the "ActiveRecord" type, and the "DataContract" type. So for example, we have: namespace ActiveRecord { class Widget { public int Id { get; set; } } } namespace DataContracts { class Widget { public int Id { get; set; } } } The database access layer takes care of "translating" between hierarchies: you can tell it to update a DataContracts.Widget, and it will magically create an ActiveRecord.Widget with the same property values and save that. The problem I have surfaced when attempting to refactor this database access layer. The Problem I want to add methods like the following to the database access layer: // Widget is DataContract.Widget interface DbAccessLayer { IEnumerable<Widget> GetMany(Expression<Func<Widget, bool>> predicate); } The above is a simple general-use "get" method with custom predicate. The only point of interest is that I 'm not passing in an anonymous function but rather an expression tree. This is done because inside DbAccessLayer we have to query ActiveRecord.Widget efficiently (LINQ to SQL) and not have the database return all ActiveRecord.Widget instances and then filter the enumerable collection. We need to pass in an expression tree, so we ask for one as the parameter for GetMany. The snag: the parameter we have needs to be magically transformed from an Expression<Func<DataContract.Widget, bool>> to an Expression<Func<ActiveRecord.Widget, bool>>. This is where I haven't managed to pull it off... Attempted Solution What we 'd like to do inside GetMany is: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( predicate.Body, predicate.Parameters); // use lambda to query ActiveRecord.Widget and return some value } This won't work because in a typical scenario, for example if: predicate == w => w.Id == 0; ...the expression tree contains a MemberAccessExpression instance which has a MemberInfo property (named Member) that point to members of DataContract.Widget. There are also ParameterExpression instances both in the expression tree and in its parameter expression collection (predicate.Parameters); After searching a bit, I found System.Linq.Expressions.ExpressionVisitor (its source can be found here in the context of a how-to, very helpful) which is a convenient way to modify an expression tree. Armed with this, I implemented a visitor. This simple visitor only takes care of changing the types in member access and parameter expressions. It may not be complete, but it's fine for the expression w => w.Id == 0. internal class Visitor : ExpressionVisitor { private readonly Func<Type, Type> dataContractToActiveRecordTypeConverter; public Visitor(Func<Type, Type> dataContractToActiveRecordTypeConverter) { this.dataContractToActiveRecordTypeConverter = dataContractToActiveRecordTypeConverter; } protected override Expression VisitMember(MemberExpression node) { var dataContractType = node.Member.ReflectedType; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); var converted = Expression.MakeMemberAccess( base.Visit(node.Expression), activeRecordType.GetProperty(node.Member.Name)); return converted; } protected override Expression VisitParameter(ParameterExpression node) { var dataContractType = node.Type; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); return Expression.Parameter(activeRecordType, node.Name); } } With this visitor, GetMany becomes: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var visitor = new Visitor(...); var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( visitor.Visit(predicate.Body), predicate.Parameters.Select(p => visitor.Visit(p)); var widgets = ActiveRecord.Widget.Repository().Where(lambda); // This is just for reference, see below Expression<Func<ActiveRecord.Widget, bool>> referenceLambda = w => w.Id == 0; // Here we 'd convert the widgets to instances of DataContract.Widget and // return them -- this has nothing to do with the question though. } Results The good news is that lambda is constructed just fine. The bad news is that it isn't working; it's blowing up on me when I try to use it (the exception messages are really not helpful at all). I have examined the lambda my code produces and a hardcoded lambda with the same expression; they look exactly the same. I spent hours in the debugger trying to find some difference, but I can't. When predicate is w => w.Id == 0, lambda looks exactly like referenceLambda. But the latter works with e.g. IQueryable<T>.Where, while the former does not (I have tried this in the immediate window of the debugger). I should also mention that when predicate is w => true, it all works just fine. Therefore I am assuming that I 'm not doing enough work in Visitor, but I can't find any more leads to follow on. Can someone point me in the right direction? Thanks in advance for your help!

    Read the article

  • ffmpeg-php permission denied on localhost

    - by user572271
    Hello, I am very new to php. I recently setup php on my mac and I am trying to setup ffmpeg-php to convert various videos to flv or other formats as desired. I used this tutorial FFmpeg Mac Installation and I got ffmpeg to work using the terminal, however, when I try to encode a movie using php I get an error. In my apache error_log file it says permission denied next to the flv file (shown below). FFmpeg version 0.6, Copyright (c) 2000-2010 the FFmpeg developers built on Dec 30 2010 08:36:24 with gcc 4.2.1 (Apple Inc. build 5646) (dot 1) configuration: --prefix=/usr/local --enable-shared --disable-mmx --enable-libmp3lame --enable-gpl --enable-libfaad --enable-zlib --enable-libvorbis --enable-libfaac --enable-nonfree libavutil 50.15. 1 / 50.15. 1 libavcodec 52.72. 2 / 52.72. 2 libavformat 52.64. 2 / 52.64. 2 libavdevice 52. 2. 0 / 52. 2. 0 libswscale 0.11. 0 / 0.11. 0 Seems stream 1 codec frame rate differs from container frame rate: 1200.00 (1200/1) - 30.00 (30/1) Input #0, mov,mp4,m4a,3gp,3g2,mj2, from '/Users/myApple/Sites/AdHere/test.mov': Metadata: major_brand : qt minor_version : 537199360 compatible_brands: qt Duration: 00:00:02.04, start: 0.000000, bitrate: 1109 kb/s Stream #0.0(eng): Audio: aac, 44100 Hz, stereo, s16, 97 kb/s Stream #0.1(eng): Video: h264, yuv420p, 640x480, 1027 kb/s, 30.15 fps, 30 tbr, 600 tbn, 1200 tbc /Users/myApple/Sites/AdHere/movteststuff.flv: Permission denied I have no idea what the problem is. I am using the following php code: <?php extension_loaded('ffmpeg') or die('Error in loading ffmpeg'); $ffmpegInstance = new ffmpeg_movie('test.AVI'); echo "getDuration: " . $ffmpegInstance->getDuration() . "<br>getFrameCount: " . $ffmpegInstance->getFrameCount() . "<br>getFrameRate: " . $ffmpegInstance->getFrameRate() . "<br>getFilename: " . $ffmpegInstance->getFilename() . "<br>getComment: " . $ffmpegInstance->getComment() . "<br>getTitle: " . $ffmpegInstance->getTitle() . "<br>getAuthor: " . $ffmpegInstance->getAuthor() . "<br>getCopyright: " . $ffmpegInstance->getCopyright() . "<br>getArtist: " . $ffmpegInstance->getArtist() . "<br>getGenre: " . $ffmpegInstance->getGenre() . "<br>getTrackNumber: " . $ffmpegInstance->getTrackNumber() . "<br>getYear: " . $ffmpegInstance->getYear() . "<br>getFrameHeight: " . $ffmpegInstance->getFrameHeight() . "<br>getFrameWidth: " . $ffmpegInstance->getFrameWidth() . "<br>getPixelFormat: " . $ffmpegInstance->getPixelFormat() . "<br>getBitRate: " . $ffmpegInstance->getBitRate() . "<br>getVideoBitRate: " . $ffmpegInstance->getVideoBitRate() . "<br>getAudioBitRate: " . $ffmpegInstance->getAudioBitRate() . "<br>getAudioSampleRate: " . $ffmpegInstance->getAudioSampleRate() . "<br>getVideoCodec: " . $ffmpegInstance->getVideoCodec() . "<br>getAudioCodec: " . $ffmpegInstance->getAudioCodec() . "<br>getAudioChannels: " . $ffmpegInstance->getAudioChannels() . "<br>hasAudio: " . $ffmpegInstance->hasAudio(); exec('ffmpeg -i /Users/myApple/Sites/AdHere/test.mov /Users/myApple/Sites/AdHere/movteststuff.flv'); ?> I am able to see various parameters like filename, frameheight, framewidth, which leads me to believe that ffmpeg-php is kind of working, but maybe I am just doing something wrong in the exec() command. Anyone have any ideas. I have been struggling with setting up ffmpeg for quite some time now. Thanks! -Jon

    Read the article

  • problems in trying ieee 802.15.4 working from msk

    - by asel
    Hi, i took a msk code from dsplog.com and tried to modify it to test the ieee 802.15.4. There are several links on that site for ieee 802.15.4. Currently I am getting simulated ber results all approximately same for all the cases of Eb_No values. Can you help me to find why? thanks in advance! clear PN = [ 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0; 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0; 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0; 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1; 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0 0 0 1 1; 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1 1 1 0 0; 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 1; 1 0 0 1 1 1 0 0 0 0 1 1 0 1 0 1 0 0 1 0 0 0 1 0 1 1 1 0 1 1 0 1; 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1; 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1; 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1; 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0; 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1 0 1 1 0; 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 1; 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0; 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 0 1 1 1 0 1 1 1 1 0 1 1 1 0 0 0; ]; N = 5*10^5; % number of bits or symbols fsHz = 1; % sampling period T = 4; % symbol duration Eb_N0_dB = [0:10]; % multiple Eb/N0 values ct = cos(pi*[-T:N*T-1]/(2*T)); st = sin(pi*[-T:N*T-1]/(2*T)); for ii = 1:length(Eb_N0_dB) tx = []; % MSK Transmitter ipBit = round(rand(1,N/32)*15); for k=1:length(ipBit) sym = ipBit(k); tx = [tx PN((sym+1),1:end)]; end ipMod = 2*tx - 1; % BPSK modulation 0 -> -1, 1 -> 1 ai = kron(ipMod(1:2:end),ones(1,2*T)); % even bits aq = kron(ipMod(2:2:end),ones(1,2*T)); % odd bits ai = [ai zeros(1,T) ]; % padding with zero to make the matrix dimension match aq = [zeros(1,T) aq ]; % adding delay of T for Q-arm % MSK transmit waveform xt = 1/sqrt(T)*[ai.*ct + j*aq.*st]; % Additive White Gaussian Noise nt = 1/sqrt(2)*[randn(1,N*T+T) + j*randn(1,N*T+T)]; % white gaussian noise, 0dB variance % Noise addition yt = xt + 10^(-Eb_N0_dB(ii)/20)*nt; % additive white gaussian noise % MSK receiver % multiplying with cosine and sine waveforms xE = conv(real(yt).*ct,ones(1,2*T)); xO = conv(imag(yt).*st,ones(1,2*T)); bHat = zeros(1,N); bHat(1:2:end) = xE(2*T+1:2*T:end-2*T); % even bits bHat(2:2:end) = xO(3*T+1:2*T:end-T); % odd bits result=zeros(16,1); chiplen=32; seqstart=1; recovered = []; while(seqstart<length(bHat)) A = bHat(seqstart:seqstart+(chiplen-1)); for j=1:16 B = PN(j,1:end); result(j)=sum(A.*B); end [value,index] = max(result); recovered = [recovered (index-1)]; seqstart = seqstart+chiplen; end; %# create binary string - the 4 forces at least 4 bits bstr1 = dec2bin(ipBit,4); bstr2 = dec2bin(recovered,4); %# convert back to numbers (reshape so that zeros are preserved) out1 = str2num(reshape(bstr1',[],1))'; out2 = str2num(reshape(bstr2',[],1))'; % counting the errors nErr(ii) = size(find([out1 - out2]),2); end nErr/(length(ipBit)*4) % simulated ber theoryBer = 0.5*erfc(sqrt(10.^(Eb_N0_dB/10))) % theoretical ber

    Read the article

  • create new inbox folder and save emails

    - by kasunmit
    i am trying http://www.c-sharpcorner.com/uploadfile/rambab/outlookintegration10282006032802am/outlookintegration.aspx[^] this code for create inbox personal folder and save same mails at the datagrid view (outlook 2007 and vsto 2008) i am able to create inbox folder according to above example but couldn't wire code for save e-mails at that example to save contect they r using following code if (chkVerify.Checked) { OutLook._Application outlookObj = new OutLook.Application(); MyContact cntact = new MyContact(); cntact.CustomProperty = txtProp1.Text.Trim().ToString(); //CREATING CONTACT ITEM OBJECT AND FINDING THE CONTACT ITEM OutLook.ContactItem newContact = (OutLook.ContactItem)FindContactItem(cntact, CustomFolder); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . if (newContact != null) { newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if(string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } else { //IF THE CONTACT DOES NOT EXIST WITH SAME CUSTOM PROPERTY CREATES THE CONTACT. newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { OutLook._Application outlookObj = new OutLook.Application(); OutLook.ContactItem newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { //CREATES THE OUTLOOK CONTACT IN DEFAULT CONTACTS FOLDER. OutLook._Application outlookObj = new OutLook.Application(); OutLook.MAPIFolder fldContacts = (OutLook.MAPIFolder)outlookObj.Session.GetDefaultFolder(OutLook.OlDefaultFolders.olFolderContacts); OutLook.ContactItem newContact = (OutLook.ContactItem)fldContacts.Items.Add(OutLook.OlItemType.olContactItem); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); newContact.Save(); this.Close(); } } /// /// ENABLING AND DISABLING THE CUSTOM FOLDER AND PROPERY OPTIONS. /// /// /// private void rdoCustom_CheckedChanged(object sender, EventArgs e) { if (rdoCustom.Checked) { txFolder.Enabled = true; chkAdd.Enabled = true; chkVerify.Enabled = true; txtProp1.Enabled = true; } else { txFolder.Enabled = false; chkAdd.Enabled = false; chkVerify.Enabled = false; txtProp1.Enabled = false; } } i don t have idea to convert it to save e-mails in the datagrid view the data gride view i am mentioning here is containing details (sender address, subject etc.) of unread mails and the i i am did was perform some filter for that mails as follows string senderMailAddress = txtMailAddress.Text.ToLower(); List list = (List)dgvUnreadMails.DataSource; List myUnreadMailList; List filteredList = (List)(from ci in list where ci.SenderAddress.StartsWith(senderMailAddress) select ci).ToList(); dgvUnreadMails.DataSource = filteredList; it was done successfully then i need to save those filtered e-mails to that personal inbox folder i created already for that pls give me some help my issue is that how can i assign outlook object just like they assign it to contacts (name, address, e-mail etc.) because in the e-mails we couldn't find it ..

    Read the article

  • wcf rest service 400 error : There might be a typing error in the address

    - by Lokesh Kondapalli
    I am trying to invoke wcf rest service from url but its showing error like this Error : Most likely causes: •There might be a typing error in the address. •If you clicked on a link, it may be out of date. ** I need JSON responce Here my code : Iservice.cs using System; using System.Collections.Generic; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Web; using System.Text; namespace SampleRestSample { interface name "IService1" in both code and config file together. [ServiceContract] public interface IService1 { [OperationContract] [WebInvoke(Method = "GET", UriTemplate = "Book/{id}", BodyStyle = WebMessageBodyStyle.Wrapped, ResponseFormat = WebMessageFormat.Json)] List<Prasad> GetBookById(string id); } [DataContract] public class Prasad { [DataMember] public string Name { get; set; } [DataMember] public string Age { get; set; } } } Service1.svc.cs using System; using System.Collections.Generic; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Web; using System.Text; namespace LoginRestSample { // NOTE: You can use the "Rename" command on the "Refactor" menu to change the class name "Service1" in code, svc and config file together. public class Service1 : SampleRestSample { List<Prasad> list = new List<Prasad>(); public List<Prasad> GetBookById(string id) { try { Prasad cls = new Prasad(); cls.Age = "24"; cls.Name = "prasad"; list.Add(cls); //int bookId = Convert.ToInt32(id); //using (SampleDbEntities entities = new SampleDbEntities()) //{ // return entities.Books.SingleOrDefault(book => book.ID == bookId); //} } catch { throw new FaultException("Something went wrong"); } return list; } } } web.config <?xml version="1.0" encoding="utf-8"?> <configuration> <system.web> <compilation debug="true" targetFramework="4.0"> <assemblies> <add assembly="System.Data.Entity, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" /> </assemblies> </compilation> </system.web> <system.serviceModel> <services> <service name="WcfRestSample.SampleRestSample"> <endpoint address="" behaviorConfiguration="restfulBehavior" binding="webHttpBinding" bindingConfiguration="" contract="WcfRestSample.ISampleRestSample" /> <host> <baseAddresses> <add baseAddress="http://localhost/SampleRestSample" /> </baseAddresses> </host> </service> </services> <behaviors> <endpointBehaviors> <behavior name="restfulBehavior"> <webHttp automaticFormatSelectionEnabled="true" /> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name=""> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> </system.webServer> </configuration> Any solutions? Thank you in advance.

    Read the article

  • LevelToVisibilityConverter in silverligt 4

    - by prince23
    <UserControl x:Class="SLGridImage.MainPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" d:DesignHeight="300" d:DesignWidth="400" xmlns:sdk="http://schemas.microsoft.com/winfx/2006/xaml/presentation/sdk"> <UserControl.Resources> <local:LevelToVisibilityConverter x:Key="LevelToVisibility" /> </UserControl.Resources> <Grid x:Name="LayoutRoot" Background="White"> <sdk:DataGrid x:Name="dgMarks" CanUserResizeColumns="False" SelectionMode="Single" AutoGenerateColumns="False" VerticalAlignment="Top" ItemsSource="{Binding MarkCollection}" IsReadOnly="True" Margin="13,44,0,0" RowDetailsVisibilityMode="Collapsed" Height="391" HorizontalAlignment="Left" Width="965" VerticalScrollBarVisibility="Visible" > <sdk:DataGrid.Columns> <sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Button x:Name="myButton" Click="myButton_Click"> <StackPanel Orientation="Horizontal"> <Image Margin="2, 2, 2, 2" x:Name="imgMarks" Stretch="Fill" Width="12" Height="12" Source="Images/test.png" VerticalAlignment="Center" HorizontalAlignment="Center" Visibility="{Binding Level, Converter={StaticResource LevelToVisibility}}" /> <TextBlock Text="{Binding Level}" TextWrapping="NoWrap" ></TextBlock> </StackPanel> </Button> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Name" > <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <Border> <TextBlock Text="{Binding Name}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Marks" Width="80"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Border> <TextBlock Text="{Binding Marks}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> </sdk:DataGrid.Columns> </sdk:DataGrid> </Grid> </UserControl> in .cs using System; using System.Collections.Generic; using System.Linq; using System.Net; using System.Windows; using System.Windows.Controls; using System.Windows.Documents; using System.Windows.Input; using System.Windows.Media; using System.Windows.Media.Animation; using System.Windows.Shapes; using System.Collections.ObjectModel; using System.ComponentModel; namespace SLGridImage { public partial class MainPage : UserControl { private MarksViewModel model = new MarksViewModel(); public MainPage() { InitializeComponent(); this.DataContext = model; } private void myButton_Click(object sender, RoutedEventArgs e) { } } public class MarksViewModel : INotifyPropertyChanged { public MarksViewModel() { markCollection.Add(new Mark() { Name = "ABC", Marks = 23, Level = 0 }); markCollection.Add(new Mark() { Name = "XYZ", Marks = 67, Level = 1 }); markCollection.Add(new Mark() { Name = "YU", Marks = 56, Level = 0 }); markCollection.Add(new Mark() { Name = "AAA", Marks = 89, Level = 1 }); } private ObservableCollection<Mark> markCollection = new ObservableCollection<Mark>(); public ObservableCollection<Mark> MarkCollection { get { return this.markCollection; } set { this.markCollection = value; OnPropertyChanged("MarkCollection"); } } public event PropertyChangedEventHandler PropertyChanged; public void OnPropertyChanged(string propName) { if (PropertyChanged != null) this.PropertyChanged(this, new PropertyChangedEventArgs(propName)); } } public class Mark { public string Name { get; set; } public int Marks { get; set; } public int Level { get; set; } } public class LevelToVisibilityConverter : System.Windows.Data.IValueConverter { #region IValueConverter Members public object Convert(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { Visibility isVisible = Visibility.Collapsed; if ((value == null)) return isVisible; int condition = (int)value; isVisible = condition == 1 ? Visibility.Visible : Visibility.Collapsed; return isVisible; } public object ConvertBack(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { throw new NotImplementedException(); } #endregion } } when i run getting error The type 'local:LevelToVisibilityConverter' was not found. Verify that you are not missing an assembly reference and that all referenced assemblies have been built. what i am i missing here looking forward for an solution thank you

    Read the article

  • Sorting/Paginating/Filtering Complex Multi-AR Object Tables in Rails

    - by Matt Rogish
    I have a complex table pulled from a multi-ActiveRecord object array. This listing is a combined display of all of a particular user's "favorite" items (songs, messages, blog postings, whatever). Each of these items is a full-fledged AR object. My goal is to present the user with a simplified search, sort, and pagination interface. The user need not know that the Song has a singer, and that the Message has an author -- to the end user both entries in the table will be displayed as "User". Thus, the search box will simply be a dropdown list asking them which to search on (User name, created at, etc.). Internally, I would need to convert that to the appropriate object search, combine the results, and display. I can, separately, do pagination (mislav will_paginate), sorting, and filtering, but together I'm having some problems combining them. For example, if I paginate the combined list of items, the pagination plugin handles it just fine. It is not efficient since the pagination is happening in the app vs. the DB, but let's assume the intended use-case would indicate the vast majority of the users will have less than 30 favorited items and all other behavior, server capabilities, etc. indicates this will not be a bottleneck. However, if I wish to sort the list I cannot sort it via the pagination plugin because it relies on the assumption that the result set is derived from a single SQL query, and also that the field name is consistent throughout. Thus, I must sort the merged array via ruby, e.g. @items.sort_by{ |i| i.whatever } But, since the items do not share common names, I must first interrogate the object and then call the correct sort by. For example, if the user wishes to sort by user name, if the sorted object is a message, I sort by author but if the object is a song, I sort by singer. This is all very gross and feels quite un-ruby-like. This same problem comes into play with the filter. If the user filters on the "parent item" (the message's thread, the song's album), I must translate that to the appropriate collection object method. Also gross. This is not the exact set-up but is close enough. Note that this is a legacy app so changing it is quite difficult, although not impossible. Also, yes there is some DRY that can be done, but don't focus on the style or elegance of the following code. Style/elegance of the SOLUTION is important, however! :D models: class User < ActiveRecord::Base ... has_and_belongs_to_many :favorite_messages, :class_name => "Message" has_and_belongs_to_many :favorite_songs, :class_name => "Song" has_many :authored_messages, :class_name => "Message" has_many :sung_songs, :class_name => "Song" end class Message < ActiveRecord::Base has_and_belongs_to_many :favorite_messages belongs_to :author, :class_name => "User" belongs_to :thread end class Song < ActiveRecord::Base has_and_belongs_to_many :favorite_songs belongs_to :singer, :class_name => "User" belongs_to :album end controller: def show u = User.find 123 @items = Array.new @items << u.favorite_messages @items << u.favorite_songs # etc. etc. @items.flatten! @items = @items.sort_by{ |i| i.created_at } @items = @items.paginate :page => params[:page], :per_page => 20 end def search # Assume user is searching for username like 'Bob' u = User.find 123 @items = Array.new @items << u.favorite_messages.find( :all, :conditions => "LOWER( author ) LIKE LOWER('%bob%')" ) @items << u.favorite_songs.find( :all, :conditions => "LOWER( singer ) LIKE ... " ) # etc. etc. @items.flatten! @items = @items.sort_by{ |i| determine appropriate sorting based on user selection } @items = @items.paginate :page => params[:page], :per_page => 20 end view: #index.html.erb ... <table> <tr> <th>Title (sort ASC/DESC links)</th> <th>Created By (sort ASC/DESC links))</th> <th>Collection Title (sort ASC/DESC links)</th> <th>Created At (sort ASC/DESC links)</th> </tr> <% @items.each |item| do %> <%= render { :partial => "message", :locals => item } if item.is_a? Message %> <%= render { :partial => "song", :locals => item } if item.is_a? Song %> <%end%> ... </table> #message.html.erb # shorthand, not real ruby print out message title, author name, thread title, message created at #song.html.erb # shorthand print out song title, singer name, album title, song created at

    Read the article

  • Getting a NullPointerException at seemingly random intervals, not sure why

    - by Miles
    I'm running an example from a Kinect library for Processing (http://www.shiffman.net/2010/11/14/kinect-and-processing/) and sometimes get a NullPointerException pointing to this line: int rawDepth = depth[offset]; The depth array is created in this line: int[] depth = kinect.getRawDepth(); I'm not exactly sure what a NullPointerException is, and much googling hasn't really helped. It seems odd to me that the code compiles 70% of the time and returns the error unpredictably. Could the hardware itself be affecting it? Here's the whole example if it helps: // Daniel Shiffman // Kinect Point Cloud example // http://www.shiffman.net // https://github.com/shiffman/libfreenect/tree/master/wrappers/java/processing import org.openkinect.*; import org.openkinect.processing.*; // Kinect Library object Kinect kinect; float a = 0; // Size of kinect image int w = 640; int h = 480; // We'll use a lookup table so that we don't have to repeat the math over and over float[] depthLookUp = new float[2048]; void setup() { size(800,600,P3D); kinect = new Kinect(this); kinect.start(); kinect.enableDepth(true); // We don't need the grayscale image in this example // so this makes it more efficient kinect.processDepthImage(false); // Lookup table for all possible depth values (0 - 2047) for (int i = 0; i < depthLookUp.length; i++) { depthLookUp[i] = rawDepthToMeters(i); } } void draw() { background(0); fill(255); textMode(SCREEN); text("Kinect FR: " + (int)kinect.getDepthFPS() + "\nProcessing FR: " + (int)frameRate,10,16); // Get the raw depth as array of integers int[] depth = kinect.getRawDepth(); // We're just going to calculate and draw every 4th pixel (equivalent of 160x120) int skip = 4; // Translate and rotate translate(width/2,height/2,-50); rotateY(a); for(int x=0; x<w; x+=skip) { for(int y=0; y<h; y+=skip) { int offset = x+y*w; // Convert kinect data to world xyz coordinate int rawDepth = depth[offset]; PVector v = depthToWorld(x,y,rawDepth); stroke(255); pushMatrix(); // Scale up by 200 float factor = 200; translate(v.x*factor,v.y*factor,factor-v.z*factor); // Draw a point point(0,0); popMatrix(); } } // Rotate a += 0.015f; } // These functions come from: http://graphics.stanford.edu/~mdfisher/Kinect.html float rawDepthToMeters(int depthValue) { if (depthValue < 2047) { return (float)(1.0 / ((double)(depthValue) * -0.0030711016 + 3.3309495161)); } return 0.0f; } PVector depthToWorld(int x, int y, int depthValue) { final double fx_d = 1.0 / 5.9421434211923247e+02; final double fy_d = 1.0 / 5.9104053696870778e+02; final double cx_d = 3.3930780975300314e+02; final double cy_d = 2.4273913761751615e+02; PVector result = new PVector(); double depth = depthLookUp[depthValue];//rawDepthToMeters(depthValue); result.x = (float)((x - cx_d) * depth * fx_d); result.y = (float)((y - cy_d) * depth * fy_d); result.z = (float)(depth); return result; } void stop() { kinect.quit(); super.stop(); } And here are the errors: processing.app.debug.RunnerException: NullPointerException at processing.app.Sketch.placeException(Sketch.java:1543) at processing.app.debug.Runner.findException(Runner.java:583) at processing.app.debug.Runner.reportException(Runner.java:558) at processing.app.debug.Runner.exception(Runner.java:498) at processing.app.debug.EventThread.exceptionEvent(EventThread.java:367) at processing.app.debug.EventThread.handleEvent(EventThread.java:255) at processing.app.debug.EventThread.run(EventThread.java:89) Exception in thread "Animation Thread" java.lang.NullPointerException at org.openkinect.processing.Kinect.enableDepth(Kinect.java:70) at PointCloud.setup(PointCloud.java:48) at processing.core.PApplet.handleDraw(PApplet.java:1583) at processing.core.PApplet.run(PApplet.java:1503) at java.lang.Thread.run(Thread.java:637)

    Read the article

  • Passing a comparator syntax help in Java

    - by Crystal
    I've tried this a couple ways, the first is have a class that implements comparator at the bottom of the following code. When I try to pass the comparat in sortListByLastName, I get a constructor not found error and I am not sure why import java.util.*; public class OrganizeThis implements WhoDoneIt { /** Add a person to the organizer @param p A person object */ public void add(Person p) { staff.put(p.getEmail(), p); //System.out.println("Person " + p + "added"); } /** * Remove a Person from the organizer. * * @param email The email of the person to be removed. */ public void remove(String email) { staff.remove(email); } /** * Remove all contacts from the organizer. * */ public void empty() { staff.clear(); } /** * Find the person stored in the organizer with the email address. * Note, each person will have a unique email address. * * @param email The person email address you are looking for. * */ public Person findByEmail(String email) { Person aPerson = staff.get(email); return aPerson; } /** * Find all persons stored in the organizer with the same last name. * Note, there can be multiple persons with the same last name. * * @param lastName The last name of the persons your are looking for. * */ public Person[] find(String lastName) { ArrayList<Person> names = new ArrayList<Person>(); for (Person s : staff.values()) { if (s.getLastName() == lastName) { names.add(s); } } // Convert ArrayList back to Array Person nameArray[] = new Person[names.size()]; names.toArray(nameArray); return nameArray; } /** * Return all the contact from the orgnizer in * an array sorted by last name. * * @return An array of Person objects. * */ public Person[] getSortedListByLastName() { PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(comp); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; } private Map<String, Person> staff = new HashMap<String, Person>(); public static void main(String[] args) { OrganizeThis testObj = new OrganizeThis(); Person person1 = new Person("J", "W", "111-222-3333", "[email protected]"); Person person2 = new Person("K", "W", "345-678-9999", "[email protected]"); Person person3 = new Person("Phoebe", "Wang", "322-111-3333", "[email protected]"); Person person4 = new Person("Nermal", "Johnson", "322-342-5555", "[email protected]"); Person person5 = new Person("Apple", "Banana", "123-456-1111", "[email protected]"); testObj.add(person1); testObj.add(person2); testObj.add(person3); testObj.add(person4); testObj.add(person5); System.out.println(testObj.findByEmail("[email protected]")); System.out.println("------------" + '\n'); Person a[] = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("------------" + '\n'); a = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("SORTED" + '\n'); a = testObj.getSortedListByLastName(); for (Person b : a) { System.out.println(b); } System.out.println(testObj.getAuthor()); } } class PersonLastNameComparator implements Comparator<Person> { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } } And then when I tried doing it by creating an anonymous inner class, I also get a constructor TreeMap cannot find symbol error. Any thoughts? inner class method: public Person[] getSortedListByLastName() { //PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(new Comparator<Person>() { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } }); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 373 374 375 376 377 378 379 380 381 382 383  | Next Page >