Search Results

Search found 89638 results on 3586 pages for 'file table'.

Page 38/3586 | < Previous Page | 34 35 36 37 38 39 40 41 42 43 44 45  | Next Page >

  • ValueError with multi-table inheritance in Django Admin

    - by jorde
    I created two new classes which inherit model Entry: class Entry(models.Model): LANGUAGE_CHOICES = settings.LANGUAGES language = models.CharField(max_length=2, verbose_name=_('Comment language'), choices=LANGUAGE_CHOICES) user = models.ForeignKey(User) country = models.ForeignKey(Country, null=True, blank=True) created = models.DateTimeField(auto_now=True) class Comment(Entry): comment = models.CharField(max_length=2000, blank=True, verbose_name=_('Comment in English')) class Discount(Entry): discount = models.CharField(max_length=2000, blank=True, verbose_name=_('Comment in English')) coupon = models.CharField(max_length=2000, blank=True, verbose_name=_('Coupon code if needed')) After adding these new models to admin via admin.site.register I'm getting ValueError when trying to create a comment or a discount via admin. Adding entries works fine. Error msg: ValueError at /admin/reviews/discount/add/ Cannot assign "''": "Discount.discount" must be a "Discount" instance. Request Method: GET Request URL: http://127.0.0.1:8000/admin/reviews/discount/add/ Exception Type: ValueError Exception Value: Cannot assign "''": "Discount.discount" must be a "Discount" instance. Exception Location: /Library/Python/2.6/site-packages/django/db/models/fields/related.py in set, line 211 Python Executable: /usr/bin/python Python Version: 2.6.1

    Read the article

  • SQL: Recursively get parent records using Common Table Expressions

    - by Martijn B
    Hi there, Suposse you have to following tables where a sale consists of products and a product can be placed in multiple categories. Whereby categories have a hierachly structure like: Man Shoes Sport Casual Watches Women Shoes Sport Casual Watches Tables: Sale: id name 1 Sale1 Product: id saleidfk name 1 1 a 2 1 b 3 1 c 4 1 d 5 1 e ProductCategory : productid categoryid 1 3 2 3 3 4 4 5 5 10 Category: id ParentCategoryIdFk name 1 null Men 2 1 Shoes 3 2 Sport 4 2 Casual 5 1 Watches 6 null Women 7 6 Shoes 8 7 Sport 9 7 Casual 10 6 Watches Question: Now on my website I want to create a control where only the categories are shown of a certain sale and where the categories are filled with the products of the sale. I also want to include the hierachly structure of the categories. So if we have a leave node, recusivly go up to the top node. So with sale1 I should have a query with the following result: Men Shoes Sport Casual Watches Women Watches This thing is driving me crazy :-) Thanks in advance! Gr Martijn

    Read the article

  • One-to-many relationship in the same table in zend

    - by Behrang
    I have groupTable(group_id,group_name,group_date,group_parent_id) in face each group have many group child I create groupModel and I want to begin coding is this right code to handle protected $_name = 'group'; protected $_dependentTables = array('Model_group'); protected $_referenceMap = array('Model_group' = array('columns' = array('group_parent_id') , 'refTableClass' = 'Model_group' , 'refColumns' = array('group_id') , 'onDelete' = self::CASCADE , 'onUpdate' = self::RESTRICT) );

    Read the article

  • Table Partitioning

    - by Ankur Gahlot
    How advantageous is it to use partitioning of tables as compared to normal approach ? Is there a sort of sample case or detailed comparative analysis that could statistically ( i know this is too strong a word, but it would really help if it is illustrated by some numbers ) emphasize on the utility of the process. Thanks, Ankur

    Read the article

  • Simplest possible table entry editing / addition / deletion web toolkit (for use with php)

    - by Dave
    Hi, i'm building a website in php and i have tables presented that i need to allow the user to: 1. add new entry (only one at a time, which should appear as a new modal overlay) 2. delete multiple selected entries from 3. edit an existing entry (only one at one time, in a view similar to 1.) 4. re-arrange entries up and down. One by one is fine. Multiple / Grouping rearrangements are not not needed what jquery / js / anything toolkit would be the SIMPLEST to work with? (of course, i should be able to work with it in php). I did try hacking away at: http://www.ericmmartin.com/projects/simplemodal/ but had a terrible time trying to get it to work on editing some existing data (had problem passing data to it).

    Read the article

  • Multiple Table Inheritance vs. Single Table Inheritance in Ruby on Rails

    - by Tony
    I have been struggling for the past few hours thinking about which route I should go. I have a Notification model. Up until now I have used a notification_type column to manage the types but I think it will be better to create separate classes for the types of notifications as they behave differently. Right now, there are 3 ways notifications can get sent out: SMS, Twitter, Email Each notification would have: id subject message valediction sent_people_count deliver_by geotarget event_id list_id processed_at deleted_at created_at updated_at Seems like STI is a good candidate right? Of course Twitter/SMS won't have a subject and Twitter won't have a sent_people_count, valediction. I would say in this case they share most of their fields. However what if I add a "reply_to" field for twitter and a boolean for DM? My point here is that right now STI makes sense but is this a case where I may be kicking myself in the future for not just starting with MTI? To further complicate things, I want a Newsletter model which is sort of a notification but the difference is that it won't use event_id or deliver_by. I could see all subclasses of notification using about 2/3 of the notification base class fields. Is STI a no-brainer, or should I use MTI? Thanks!

    Read the article

  • Jquery table cell

    - by Parhs
    Hello...This code produces a mess... What am i doing wrong??? cell=$("<td>"); if(normal.exam_type=="Exam_Boolean") { var input=cell.append("<input>").last(); input.attr("type","hidden"); input.attr("name","exam.exam_Normal['" +normal_id_unique + "'].boolean_v"); input.attr("value",normal.normal_boolean);

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • PHP edit unique row in table

    - by Robert
    I currently have a PHP form that uses AJAX to connect to MySQL and display records matching a user's selection (http://stackoverflow.com/questions/2593317/ajax-display-mysql-data-with-value-from-multiple-select-boxes) As well as displaying the data, I also place an 'Edit' button next to each result which displays a form where the data can be edited. My problem is editing unique records since currently I only use the selected values for 'name' and 'age' to find the record. If two (or more) records share the same name and age, I am only able to edit the first result.

    Read the article

  • Set inner table border in HTML

    - by ripper234
    How do I set the "inner border" - the border between different cells. By setting style attributes I manage to control the outer border, but the inner border just stays the same gray color and the same width. What attributes should I tweak to control the inner border?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Consecutive Tables in Latex

    - by Tim
    Hi, I wonder how to place several tables consecutively in Latex? The page with the text right before the first table has a little space but not enough for the first table, so the first table is to be placed on the top of the next page, although I use "\begin{table}[!h]" for it. The second table does not fit into the place in the rest of the page of the first table, so I think I might use longtable for it to span the rest of the page and the top of the next page. Similarly, I use longtable for the third table. The latex code is as follows: ... % some text \begin{table}[!h] \caption{Table 1. \label{tab:1}} \begin{center} \begin{tabular}{c c} ... \end{tabular} \end{center} \end{table} \begin{center} \begin{longtable}{ c c } \caption{Table 2. \label{tab:2}}\\ ... \end{longtable} \end{center} \begin{center} \begin{longtable}{ c c } \caption{Table 3. \label{tab:3}}\\ ... \end{longtable} \end{center} ... % some text In the compiled pdf file it turns out that the order of the tables is messed up. The first table is placed behind the second and third one, and the second one spans the page with text before the tables and the next page with the third one following it. I would like to know how I can make the three tables appear consecutively in order, and there are no space left blank between them and between the text and the tables? Or if what I hope is not possible, what is the best strategy then? Thanks and regards! EDIT: Removing [!h] does not make improvement, the first table is still behind the second and the third.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Core Data table record count

    - by user339633
    I have an entity called Person and it has a relationship called participatingGames, to another entity called GameParticipant. I (apparently) can retrieve the number of matches in the GameParticipant entity using this simple code in the Person object I created from the entity in the model: [self.participatingGames count]; However, I'd just like to retrieve the number of Person records and one might guess the syntax for this is just as simple. I have lots of books including those by Jeff LaMarche, but those sources and what I find around here make me wonder if I need to set up a fetchedResultsController just to know the count of some entity. My background is in SQL, so of course it seems odd that what would take 15 seconds to code in any other environment seems like such a well-guarded secret in Core Data. I'm using iPhone SDK 3.1.4 under OSX 10.5.8 Suggestions?

    Read the article

  • Copying contents of a MySQL table to a table in another (local) database

    - by Philip Eve
    I have two MySQL databases for my site - one is for a production environment and the other, much smaller, is for a testing/development environment. Both have identical schemas (except when I am testing something I intend to change, of course). A small number of the tables are for internationalisation purposes: TransLanguage - non-English languages TransModule - modules (bundles of phrases for translation, that can be loaded individually by PHP scripts) TransPhrase - individual phrases, in English, for potential translation TranslatedPhrase - translations of phrases that are submitted by volunteers ChosenTranslatedPhrase - screened translations of phrases. The volunteers who do translation are all working on the production site, as they are regular users. I wanted to create a stored procedure that could be used to synchronise the contents of four of these tables - TransLanguage, TransModule, TransPhrase and ChosenTranslatedPhrase - from the production database to the testing database, so as to keep the test environment up-to-date and prevent "unknown phrase" errors from being in the way while testing. My first effort was to create the following procedure in the test database: CREATE PROCEDURE `SynchroniseTranslations` () LANGUAGE SQL NOT DETERMINISTIC MODIFIES SQL DATA SQL SECURITY DEFINER BEGIN DELETE FROM `TransLanguage`; DELETE FROM `TransModule`; INSERT INTO `TransLanguage` SELECT * FROM `PRODUCTION_DB`.`TransLanguage`; INSERT INTO `TransModule` SELECT * FROM `PRODUCTION_DB`.`TransModule`; INSERT INTO `TransPhrase` SELECT * FROM `PRODUCTION_DB`.`TransPhrase`; INSERT INTO `ChosenTranslatedPhrase` SELECT * FROM `PRODUCTION_DB`.`ChosenTranslatedPhrase`; END When I try to run this, I get an error message: "SELECT command denied to user 'username'@'localhost' for table 'TransLanguage'". I also tried to create the procedure to work the other way around (that is, to exist as part of the data dictionary for the production database rather than the test database). If I do it that, way, I get an identical message except it tells me I'm denied the DELETE command rather than SELECT. I have made sure that my user has INSERT, DELETE, SELECT, UPDATE and CREATE ROUTINE privileges on both databases. However, it seems as though MySQL is reluctant to let this user exercise its privileges on both databases at the same time. How come, and is there a way around this?

    Read the article

  • Align table columns HTML

    - by Luigi Tiburzi
    I finally was able to align the columns in the tables of a page of my website. Though I found the solution I don't understand it. This is a fiddle I prepared. If you delete display: block from the CSS the columns are centered perfectly. The fact is that I don't understand what that instruction is causing problems, doesn't it means that elements are displayed as block elements? Shouldn't it cause the elements (the raw in particular) to fill an entire line? Thanks for your explanation

    Read the article

  • Zend Framework - Database Table Singleton

    - by Sonny
    I have found myself doing this in my code to 'cache' the work done when instantiating my Zend_Db_Table models: if (Zend_Registry::isRegistered('x_table')) { $x_table = Zend_Registry::get('x_table'); } else { $x_table = new Default_Model_DbTable_X; Zend_Registry::set('x_table', $x_table); } It bothered me that this method isn't very DRY and it dawned on me today that a singleton pattern would probably be a better way to do this. Problem is, I've never written a singleton class. When I did some web searches, I found some offhand comments about Zend_Db_Table singletons, but no real examples. I already have meta-data caching configured. How do I make my Zend_Db_Table models singletons? Are there pitfalls or downsides?

    Read the article

  • What JavaScript table widgets you can recommend? [2]

    - by sdespolit
    As so far i've "found" Yahoo UI library and it fully conforms to my requirements. Also there is jqGrid that i'm using right now. If there are any alternatives? UPDATE: Please suggest libraries and don't seek for matching all the requirements listed below. [i'll check it for myself] My reqs are: rows adding, deletinig rows reoder (optionally with drag and drop) rows selection inline editing json data over xhr (optional) simple integration with backbone.js disclaimer: there was almost the same question 2 years ago

    Read the article

  • Excel vba: error hiding calculated field in Pivot table

    - by Patrick Honorez
    I have written several Subs to show/hide fields in a PivotTable. Now I am trying to do the same with a calculated field, but I get an error when hiding it. I took my code from the recorder and the recorder's code also halts on the last line. I googled the error message, without serious result. Sub PrRemove() 'remove PR Dim pt As PivotTable Set pt = ActiveSheet.PivotTables("MyPivot") pt.PivotFields("MyField").Orientation = xlHidden '<- here is the error End Sub The same code works fine if MyField is a normal field (not a calculated one). I am using Excel 2007 with SP2. Any clue ?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

< Previous Page | 34 35 36 37 38 39 40 41 42 43 44 45  | Next Page >