Search Results

Search found 9764 results on 391 pages for 'cross join'.

Page 387/391 | < Previous Page | 383 384 385 386 387 388 389 390 391  | Next Page >

  • Wisdom of merging 100s of Oracle instances into one instance

    - by hoytster
    Our application runs on the web, is mostly an inquiry tool, does some transactions. We host the Oracle database. The app has always had a different instance of Oracle for each customer. A customer is a company which pays us to provide our service to the company's employees, typically 10,000-25,000 employees per customer. We do a major release every few years, and migrating to that new release is challenging: we might have a team at the customer site for a couple weeks, explaining new functionality and setting up the driving data to suit that customer. We're considering going multi-client, putting all our customers into a single shared Oracle 11g instance on a big honkin' Windows Server 2008 server -- in order to reduce costs. I'm wondering if that's advisable. There are some advantages to having separate instances for each customer. Tell me if these are bogus, please. In my rough guess about decreasing importance: Our customers MyCorp and YourCo can be migrated separately when breaking changes are made to the schema. (With multi-client, we'd be migrating 300+ customers overnight!?!) MyCorp's data can be easily backed up and (!!!) restored, without affecting other customers. MyCorp's data is securely separated from their competitor YourCo's data, without depending on developers to get the code right and/or DBAs getting the configuration right. Performance is better because the database is smaller (5,000 vs 2,000,000 rows in ~50 tables). If MyCorp's offices are (mostly) in just one region, then the MyCorp's instance can be geographically co-located there, so network lag doesn't hurt performance. We can provide better service to global clients, for the same reason. In MyCorp wants to take their database in-house, then we can easily export their instance, to get MyCorp their data. Load-balancing is easier because instances can be placed on different servers (this is with a web farm). When a DEV or QA instance is needed, it's easier to clone the real instance and anonymize the data, because there's much less data. Because they're small enough, developers can have their own instance running locally, so they can work on code while waiting at the airport and while in-flight, without fighting VPN hassles. Q1: What are other advantages of separate instances? We are contemplating changing the database schema and merging all of our customers into one Oracle instance, running on one hefty server. Here are advantages of the multi-client instance approach, most important first (my WAG). Please snipe if these are bogus: Less work for the DBAs, since they only need to maintain one instance instead of hundreds. Less DBA work translates to cheaper, our main motive for this change. With just one instance, the DBAs can do a better job of optimizing performance. They'll have time to add appropriate indexes and review our SQL. It will be easier for developers to debug & enhance the application, because there is only one schema and one app (there might be dozens of schema versions if there are hundreds of instances, with a different version of the app for each version of the schema). This reduces costs too. The alternative is having to start every debug session with (1) What version is this customer running and (2) Let's struggle to recreate the corresponding development environment, code and database. (We need a Virtual Machine that includes the code AND database instance for each patch and release!) Licensing Oracle is cheaper because it's priced per server irrespective of heft (or something -- I don't know anything about the subject). The database becomes a viable persistent store for web session data, because there is just one instance. Some database operations are easier with one multi-client instance, like finding a participant when they're hazy about which customer they (or their spouse, maybe) works for: all the names are in one table. Reporting across customers is straightforward. Q2: What are other advantages of having multiple clients in one instance? Q3: Which approach do you think is better (why)? Instance per customer, or all customers in one instance? I'm concerned that having one multi-client instance makes migration near-impossible, and that's a deal killer... ... unless there is a compromise solution like having two multi-client instances, the old and the new. In that case case, we would design cross-instance solutions for finding participants, reporting, etc. so customers could go from one multi-client instance to the next without anything breaking. THANKS SO MUCH for your collective advice! This issue is beyond me -- but not beyond the collective you. :) Hoytster

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • retriving hearders in all pages of word

    - by udaya
    Hi I am exporting data from php page to word,, there i get 'n' number of datas in each page .... How to set the maximum number of data that a word page can contain ,,,, I want only 20 datas in a single page This is the coding i use to export the data to word i got the data in word format but the headers are not available for all the pages ex: Page:1 slno name country state Town 1 vivek india tamilnadu trichy 2 uday india kerala coimbatore like this i am getting many details but in my page:2 i dont get the headers like name country state and town....But i can get the details like kumar america xxxx yyyy i want the result to be like slno name country state town n chris newzealand ghgg jkgj Can i get the headers If it is not possible Is there anyway to limit the number of details being displayed in each page //EDIT YOUR MySQL Connection Info: $DB_Server = "localhost"; //your MySQL Server $DB_Username = "root"; //your MySQL User Name $DB_Password = ""; //your MySQL Password $DB_DBName = "cms"; //your MySQL Database Name $DB_TBLName = ""; //your MySQL Table Name $sql = "SELECT (SELECT COUNT(*) FROM tblentercountry t2 WHERE t2.dbName <= t1.dbName and t1.dbIsDelete='0') AS SLNO ,dbName as Namee,t3.dbCountry as Country,t4.dbState as State,t5.dbTown as Town FROM tblentercountry t1 join tablecountry as t3, tablestate as t4, tabletown as t5 where t1.dbIsDelete='0' and t1.dbCountryId=t3.dbCountryId and t1.dbStateId=t4.dbStateId and t1.dbTownId=t5.dbTownId order by dbName limit 0,50"; //Optional: print out title to top of Excel or Word file with Timestamp //for when file was generated: //set $Use_Titel = 1 to generate title, 0 not to use title $Use_Title = 1; //define date for title: EDIT this to create the time-format you need //$now_date = DATE('m-d-Y H:i'); //define title for .doc or .xls file: EDIT this if you want $title = "Country"; /* Leave the connection info below as it is: just edit the above. (Editing of code past this point recommended only for advanced users.) */ //create MySQL connection $Connect = @MYSQL_CONNECT($DB_Server, $DB_Username, $DB_Password) or DIE("Couldn't connect to MySQL:" . MYSQL_ERROR() . "" . MYSQL_ERRNO()); //select database $Db = @MYSQL_SELECT_DB($DB_DBName, $Connect) or DIE("Couldn't select database:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //execute query $result = @MYSQL_QUERY($sql,$Connect) or DIE("Couldn't execute query:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //if this parameter is included ($w=1), file returned will be in word format ('.doc') //if parameter is not included, file returned will be in excel format ('.xls') IF (ISSET($w) && ($w==1)) { $file_type = "vnd.ms-excel"; $file_ending = "xls"; }ELSE { $file_type = "msword"; $file_ending = "doc"; } //header info for browser: determines file type ('.doc' or '.xls') HEADER("Content-Type: application/$file_type"); HEADER("Content-Disposition: attachment; filename=database_dump.$file_ending"); HEADER("Pragma: no-cache"); HEADER("Expires: 0"); /* Start of Formatting for Word or Excel */ IF (ISSET($w) && ($w==1)) //check for $w again { /* FORMATTING FOR WORD DOCUMENTS ('.doc') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\n"; //new line character WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { //define field names $field_name = MYSQL_FIELD_NAME($result,$j); //will show name of fields $schema_insert .= "$field_name:\t"; IF(!ISSET($row[$j])) { $schema_insert .= "NULL".$sep; } ELSEIF ($row[$j] != "") { $schema_insert .= "$row[$j]".$sep; } ELSE { $schema_insert .= "".$sep; } } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); //end of each mysql row //creates line to separate data from each MySQL table row PRINT "\n----------------------------------------------------\n"; } }ELSE{ /* FORMATTING FOR EXCEL DOCUMENTS ('.xls') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\t"; //tabbed character //start of printing column names as names of MySQL fields FOR ($i = 0; $i < MYSQL_NUM_FIELDS($result); $i++) { ECHO MYSQL_FIELD_NAME($result,$i) . "\t"; } PRINT("\n"); //end of printing column names //start while loop to get data WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { IF(!ISSET($row[$j])) $schema_insert .= "NULL".$sep; ELSEIF ($row[$j] != "") $schema_insert .= "$row[$j]".$sep; ELSE $schema_insert .= "".$sep; } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); //following fix suggested by Josue (thanks, Josue!) //this corrects output in excel when table fields contain \n or \r //these two characters are now replaced with a space $schema_insert = PREG_REPLACE("/\r\n|\n\r|\n|\r/", " ", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); PRINT "\n"; } } ?

    Read the article

  • 2 columns 100% height. Can the problem ever be solved in html markup???!!

    - by denja
    I'm in despair trying to draw this simple thing. Two columns stretching 100% vertically. Is this ever possible? here there are two tries <html> <head> <title>Columns</title> </head> <body> <style type="text/css"> .wrapper {font-size:900px; width:1200px; margin:0 auto; } .col1 { width:600px; height:100%; float:left; background:#f00; } .col2 { width:600px; height:100%; float:left; background:#00f; } </style> <div class="wrapper"> <div class="col1"> C o l u m n 1 </div> <div class="col2"> C ol u m n 2 </div> </div> </body> </html> and <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en-GB"> <head> <title>2 Column CSS Demo - Equal Height Columns with Cross-Browser CSS</title> <style media="screen" type="text/css"> /* <!-- */ *{ margin:0; padding:0; } html { background-color: #ccc; height: 100%; } body { background-color: white; width: 600px; margin: 0 auto; height:100%; position: relative; border-left: 1px solid #888; border-right: 2px solid black; } #footer { clear:both; width:100%; height:0px;font-size:0px; } #container2 { clear:left; float:left; width:600px; overflow:hidden; background:#ffa7a7; } #container1 { float:left; width:600px; position:relative; right:200px; background:#fff689; } #col1 { float:left; width:400px; position:relative; left:200px; overflow:hidden; } #col2 { float:left; width:200px; position:relative; left:200px; overflow:hidden; } /* --> */ </style> </head> <body> <div id="container2"> <div id="container1"> <div id="col1"> aaaa a a a a a a a a a aa aa a a a a a a a a aa aa a a a a a a a a aa aa a a a a a a a aa a a a a aa aa a a a a a a a a aa aa a a a a a a a a aa aa a a a a aa a a a a aa aa a </div> <div id="col2"> fghdfghsfgddn fghdfghsfgddn fghdfghsfgddn fghdfghsfgddn fghdfghsfgddn fghdfghsfgddn fghdfghsfgddn v </div> </div> </div> <div id="footer"> &nbsp; </div> </body>

    Read the article

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • Android draw using SurfaceView and Thread

    - by Morten Høgseth
    I am trying to draw a ball to my screen using 3 classes. I have read a little about this and I found a code snippet that works using the 3 classes on one page, Playing with graphics in Android I altered the code so that I have a ball that is moving and shifts direction when hitting the wall like the picture below (this is using the code in the link). Now I like to separate the classes into 3 different pages for not making everything so crowded, everything is set up the same way. Here are the 3 classes I have. BallActivity.java Ball.java BallThread.java package com.brick.breaker; import android.app.Activity; import android.os.Bundle; import android.view.Window; import android.view.WindowManager; public class BallActivity extends Activity { private Ball ball; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); getWindow().setFlags(WindowManager.LayoutParams.FLAG_FULLSCREEN,WindowManager.LayoutParams.FLAG_FULLSCREEN); ball = new Ball(this); setContentView(ball); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); setContentView(null); ball = null; finish(); } } package com.brick.breaker; import android.content.Context; import android.graphics.Bitmap; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.view.SurfaceHolder; import android.view.SurfaceView; public class Ball extends SurfaceView implements SurfaceHolder.Callback { private BallThread ballThread = null; private Bitmap bitmap; private float x, y; private float vx, vy; public Ball(Context context) { super(context); // TODO Auto-generated constructor stub bitmap = BitmapFactory.decodeResource(getResources(), R.drawable.ball); x = 50.0f; y = 50.0f; vx = 10.0f; vy = 10.0f; getHolder().addCallback(this); ballThread = new BallThread(getHolder(), this); } protected void onDraw(Canvas canvas) { update(canvas); canvas.drawBitmap(bitmap, x, y, null); } public void update(Canvas canvas) { checkCollisions(canvas); x += vx; y += vy; } public void checkCollisions(Canvas canvas) { if(x - vx < 0) { vx = Math.abs(vx); } else if(x + vx > canvas.getWidth() - getBitmapWidth()) { vx = -Math.abs(vx); } if(y - vy < 0) { vy = Math.abs(vy); } else if(y + vy > canvas.getHeight() - getBitmapHeight()) { vy = -Math.abs(vy); } } public int getBitmapWidth() { if(bitmap != null) { return bitmap.getWidth(); } else { return 0; } } public int getBitmapHeight() { if(bitmap != null) { return bitmap.getHeight(); } else { return 0; } } public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // TODO Auto-generated method stub } public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub ballThread.setRunnable(true); ballThread.start(); } public void surfaceDestroyed(SurfaceHolder holder) { // TODO Auto-generated method stub boolean retry = true; ballThread.setRunnable(false); while(retry) { try { ballThread.join(); retry = false; } catch(InterruptedException ie) { //Try again and again and again } break; } ballThread = null; } } package com.brick.breaker; import android.graphics.Canvas; import android.view.SurfaceHolder; public class BallThread extends Thread { private SurfaceHolder sh; private Ball ball; private Canvas canvas; private boolean run = false; public BallThread(SurfaceHolder _holder,Ball _ball) { sh = _holder; ball = _ball; } public void setRunnable(boolean _run) { run = _run; } public void run() { while(run) { canvas = null; try { canvas = sh.lockCanvas(null); synchronized(sh) { ball.onDraw(canvas); } } finally { if(canvas != null) { sh.unlockCanvasAndPost(canvas); } } } } public Canvas getCanvas() { if(canvas != null) { return canvas; } else { return null; } } } Here is a picture that shows the outcome of these classes. I've tried to figure this out but since I am pretty new to Android development I thought I could ask for help. Does any one know what is causing the ball to be draw like that? The code is pretty much the same as the one in the link and I have tried to experiment to find a solution but no luck. Thx in advance for any help=)

    Read the article

  • How do I use texture-mapping in a simple ray tracer?

    - by fastrack20
    I am attempting to add features to a ray tracer in C++. Namely, I am trying to add texture mapping to the spheres. For simplicity, I am using an array to store the texture data. I obtained the texture data by using a hex editor and copying the correct byte values into an array in my code. This was just for my testing purposes. When the values of this array correspond to an image that is simply red, it appears to work close to what is expected except there is no shading. The bottom right of the image shows what a correct sphere should look like. This sphere's colour using one set colour, not a texture map. Another problem is that when the texture map is of something other than just one colour pixels, it turns white. My test image is a picture of water, and when it maps, it shows only one ring of bluish pixels surrounding the white colour. When this is done, it simply appears as this: Here are a few code snippets: Color getColor(const Object *object,const Ray *ray, float *t) { if (object->materialType == TEXTDIF || object->materialType == TEXTMATTE) { float distance = *t; Point pnt = ray->origin + ray->direction * distance; Point oc = object->center; Vector ve = Point(oc.x,oc.y,oc.z+1) - oc; Normalize(&ve); Vector vn = Point(oc.x,oc.y+1,oc.z) - oc; Normalize(&vn); Vector vp = pnt - oc; Normalize(&vp); double phi = acos(-vn.dot(vp)); float v = phi / M_PI; float u; float num1 = (float)acos(vp.dot(ve)); float num = (num1 /(float) sin(phi)); float theta = num /(float) (2 * M_PI); if (theta < 0 || theta == NAN) {theta = 0;} if (vn.cross(ve).dot(vp) > 0) { u = theta; } else { u = 1 - theta; } int x = (u * IMAGE_WIDTH) -1; int y = (v * IMAGE_WIDTH) -1; int p = (y * IMAGE_WIDTH + x)*3; return Color(TEXT_DATA[p+2],TEXT_DATA[p+1],TEXT_DATA[p]); } else { return object->color; } }; I call the colour code here in Trace: if (object->materialType == MATTE) return getColor(object, ray, &t); Ray shadowRay; int isInShadow = 0; shadowRay.origin.x = pHit.x + nHit.x * bias; shadowRay.origin.y = pHit.y + nHit.y * bias; shadowRay.origin.z = pHit.z + nHit.z * bias; shadowRay.direction = light->object->center - pHit; float len = shadowRay.direction.length(); Normalize(&shadowRay.direction); float LdotN = shadowRay.direction.dot(nHit); if (LdotN < 0) return 0; Color lightColor = light->object->color; for (int k = 0; k < numObjects; k++) { if (Intersect(objects[k], &shadowRay, &t) && !objects[k]->isLight) { if (objects[k]->materialType == GLASS) lightColor *= getColor(objects[k], &shadowRay, &t); // attenuate light color by glass color else isInShadow = 1; break; } } lightColor *= 1.f/(len*len); return (isInShadow) ? 0 : getColor(object, &shadowRay, &t) * lightColor * LdotN; } I left out the rest of the code as to not bog down the post, but it can be seen here. Any help is greatly appreciated. The only portion not included in the code, is where I define the texture data, which as I said, is simply taken straight from a bitmap file of the above image. Thanks.

    Read the article

  • Opacity in CSS, some doubts

    - by André
    Hi, I have some doubts with opacity in CSS. I have a Header and a Footer that uses opacity, but I would like to turn off opacity the opacity in the text. Is that possible? To a better understanding I will post the code. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title> stu nicholls | CSS PLaY | cross browser fixed header/footer layout basic method </title> <style type="text/css" media="screen"> #printhead {display:none;} html { height:100%; max-height:100%; padding:0; margin:0; border:0; background:#fff; font-size:80%; font-family: "trebuchet ms", tahoma, verdana, arial, sans-serif; /* hide overflow:hidden from IE5/Mac */ /* \*/ overflow: hidden; /* */ } body {height:100%; max-height:100%; overflow:hidden; padding:0; margin:0; border:0;} #content {display:block; height:100%; max-height:100%; overflow:hidden; padding-left:0px; position:relative; z-index:3; word-wrap:break-word;} #head {position:absolute; margin:0; top:0; right:18px; display:block; width:100%; height:1; background-color:transparent; font-size:1em; z-index:5; color:#000; border-bottom:1px solid #000;} #foot {position:absolute; margin:0; bottom:-1px; right:18px; display:block; width:100%; height:30px; background-color:transparent; color:#000; text-align:right; font-size:2em; z-index:4; border-top:1px solid #000;} .pad1 {display:block; width:18px; height:18px; float:left;} /* Com este "height", alinho a border do header */ .pad2 {display:block; height:100px;} .pad3 {display:block; height:0px;} /* Com este "height" controlo onde começa o content e o scroll do browser */ #content p {padding:5px;} .bold {font-size:1.2em; font-weight:bold;} .red {color:#c00; margin-left:5px; font-family:"trebuchet ms", "trebuchet", "verdana", sans-serif;} h2 {margin-left:5px;} h3 {margin-left:5px;} /* Esta classe controla as caracteristicas do background do footer e do header. */ .bkg { background-color: blue; filter:alpha(opacity=35); /* IE's opacity*/ opacity: 0.35; height: 10; } iframe { border-style: none; width: 100%; height: 100%; } </style> </head> <body> <div id="head"> <div class="bkg"> <div class="pad1"></div>Header </div> </div> <div id="content"> <div class="pad3"></div> <iframe src="http://www.yahoo.com" id="iFrame"></iframe> <div class="pad2"></div> </div> </div> <div id="foot"><div class="bkg">Footer</div></div> </body> </html> I want to maintain the opacity in the blue color in the footer and header but I would like to put the text stronger. Is that possible? Best Regards,

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • Yet another C# Deadlock Debugging Question

    - by Roo
    Hi All, I have a multi-threaded application build in C# using VS2010 Professional. It's quite a large application and we've experienced the classing GUI cross-threading and deadlock issues before, but in the past month we've noticed the appears to lock up when left idle for around 20-30 minutes. The application is irresponsive and although it will repaint itself when other windows are dragged in front of the application and over it, the GUI still appears to be locked... interstingly (unlike if the GUI thread is being used for a considerable amount of time) the Close, Maximise and minimise buttons are also irresponsive and when clicked the little (Not Responding...) text is not displayed in the title of the application i.e. Windows still seems to think it's running fine. If I break/pause the application using the debugger, and view the threads that are running. There are 3 threads of our managed code that are running, and a few other worker threads whom the source code cannot be displayed for. The 3 threads that run are: The main/GUI thread A thread that loops indefinitely A thread that loops indefinitely If I step into threads 2 and 3, they appear to be looping correctly. They do not share locks (even with the main GUI thread) and they are not using the GUI thread at all. When stepping into the main/GUI thread however, it's broken on Application.Run... This problem screams deadlock to me, but what I don't understand is if it's deadlock, why can't I see the line of code the main/GUI thread is hanging on? Any help will be greatly appreciated! Let me know if you need more information... Cheers, Roo -----------------------------------------------------SOLUTION-------------------------------------------------- Okay, so the problem is now solved. Thanks to everyone for their suggestions! Much appreciated! I've marked the answer that solved my initial problem of determining where on the main/UI thread the application hangs (I handn't turned off the "Enable Just My Code" option). The overall issue I was experiencing was indeed Deadlock, however. After obtaining the call-stack and popping the top half of it into Google I came across this which explains exactly what I was experiencing... http://timl.net/ This references a lovely guide to debugging the issue... http://www.aaronlerch.com/blog/2008/12/15/debugging-ui/ This identified a control I was constructing off the GUI thread. I did know this, however, and was marshalling calls correctly, but what I didn't realise was that behind the scenes this Control was subscribing to an event or set of events that are triggered when e.g. a Windows session is unlocked or the screensaver exits. These calls are always made on the main/UI thread and were blocking when it saw the call was made on the incorrect thread. Kim explains in more detail here... http://krgreenlee.blogspot.com/2007/09/onuserpreferencechanged-hang.html In the end I found an alternative solution which did not require this Control off the main/UI thread. That appears to have solved the problem and the application no longer hangs. I hope this helps anyone who's confronted by a similar problem. Thanks again to everyone on here who helped! (and indirectly, the delightful bloggers I've referenced above!) Roo -----------------------------------------------------SOLUTION II-------------------------------------------------- Aren't threading issues delightful...you think you've solved it, and a month down the line it pops back up again. I still believe the solution above resolved an issue that would cause simillar behaviour, but we encountered the problem again. As we spent a while debugging this, I thought I'd update this question with our (hopefully) final solution: The problem appears to have been a bug in the Infragistics components in the WinForms 2010.1 release (no hot fixes). We had been running from around the time the freeze issue appeared (but had also added a bunch of other stuff too). After upgrading to WinForms 2010.3, we've yet to reproduce the issue (deja vu). See my question here for a bit more information: 'http://stackoverflow.com/questions/4077822/net-4-0-and-the-dreaded-onuserpreferencechanged-hang'. Hans has given a nice summary of the general issue. I hope this adds a little to the suggestions/information surrounding the nutorious OnUserPreferenceChanged Hang (or whatever you'd like to call it). Cheers, Roo

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • Swing object: first setText() gets "stuck" when using Mac Java SE 6

    - by Tim
    Hi there, I am a Java newbie trying to maintain an application that works fine under J2SE 5.0 (32- and 64-bit) but has a very specific problem when run under Java SE 6 64-bit: [Tims-MPB:~] tlynch% java -version java version "1.6.0_15" Java(TM) SE Runtime Environment (build 1.6.0_15-b03-226) Java HotSpot(TM) 64-Bit Server VM (build 14.1-b02-92, mixed mode) The application is cross-platform and reportedly works correctly on Java SE 6 under Windows, though I haven't been able to verify that myself. The program uses a JTextField for some text entry and a JLabel to indicate the text to be entered. The first time the showDialog() method is called to set the label text and display the dialog, it works correctly, but subsequent calls all result in the display of the label from the initial invocation rather than the one most recently specified via setText(). public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } [the full text of the class is provided below] The added printlns validate that expected text is passed to the label's setText() method and is confirmed by retrieving it using getText(), but what shows up on the screen/GUI is always the text from the very first time the method was called for the object. A similar issue is observed with a JTextArea used to label another dialog box. These problem are consistent across multiple Mac systems running Java SE 6 under OS 10.5.x and 10.6.x, but they are never observed when one reverts to J2SE 5.0. If there is some background information pertinent to this problem that I have omitted, please let me know. Any insights or advice appreciated. package gui; import java.awt.*; import java.awt.event.KeyEvent; import javax.swing.*; // Referenced classes of package gui: // MyJPanel, ChatDialog_jTextField1_keyAdapter, WarWindow public class ChatDialog extends JDialog { public ChatDialog(JFrame parent, WarWindow w) { super(parent, true); text = ""; borderLayout1 = new BorderLayout(); jPanel1 = new MyJPanel(); borderLayout2 = new BorderLayout(); jPanel2 = new MyJPanel(); jPanel3 = new MyJPanel(); jLabel1 = new JLabel(); jTextField1 = new JTextField(); warWindow = w; try { jbInit(); } catch(Exception exception) { System.out.println("Problem with ChatDialog init"); exception.printStackTrace(); } return; } public String getText() { return text; } void jTextField1_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' text = jTextField1.getText(); setVisible(false); break; } } private void jbInit() throws Exception { setLocation(232, 450); setSize(560, 60); setModal(true); setResizable(false); setUndecorated(true); getContentPane().setLayout(borderLayout1); jPanel1.setLayout(borderLayout2); jPanel2.setMinimumSize(new Dimension(10, 20)); jPanel2.setPreferredSize(new Dimension(10, 20)); jLabel1.setPreferredSize(new Dimension(380, 15)); jLabel1.setHorizontalAlignment(0); jLabel1.setText("Chat Message"); jTextField1.setPreferredSize(new Dimension(520, 21)); jTextField1.setRequestFocusEnabled(false); jTextField1.addKeyListener(new ChatDialog_jTextField1_keyAdapter(this)); getContentPane().add(jPanel1, "Center"); jPanel1.add(jPanel2, "North"); jPanel2.add(jLabel1, null); jPanel1.add(jPanel3, "Center"); jPanel3.add(jTextField1, null); } public void setVisible(boolean b) { jTextField1.setText(""); super.setVisible(b); } public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } void this_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' System.exit(88); break; } } BorderLayout borderLayout1; BorderLayout borderLayout2; JLabel jLabel1; JPanel jPanel1; JPanel jPanel2; JPanel jPanel3; JTextField jTextField1; String text; WarWindow warWindow; }

    Read the article

  • if isset PHP not working?

    - by Ellie
    Okay, Im trying to set a captcha up, However with this code in, it breaks. if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) When i do it with out it, the page works, but the captcha is letting incorrect submits through. Parse error: syntax error, unexpected '"', expecting T_STRING or T_VARIABLE or T_NUM_STRING in /hermes/waloraweb085/b2027/moo.lutarinet/jointest.php on line 71 <?php $pagetitle = "Home"; $checkrank = 0; include ($_SERVER['DOCUMENT_ROOT'].'/header.inc.php'); ECHO <<<END <br><br> <b><center><i><u>DO NOT</u> USE YOUR NEOPETS PASSWORD OR PIN NUMBER!!!</b></i></center> <p> ?> <?php session_start() ?> <center><P><FORM ACTION="join.pro.php" enctype="multipart/form-data" METHOD=POST> <table width="393" height="188" border="0" cellpadding="0" cellspacing="0"> <td width="150">Username</td> <td width="243"><input type=text name="name" value="" size=32 maxlength=15></td> </tr> <tr> <td>Password</td> <td><input type=password name="pass1" VALUE="" maxlength=15></td> </tr> <tr> <td>Confirm Password</td> <td><input type=password name="pass2" VALUE="" size=32 maxlength=15></td> </tr> <tr> <td>Security Code (4 Diget Number)</td> <td><input type=password name="security" VALUE="" size=32 maxlength=4></td> </tr> <tr> <td>Email Address</td> <td><INPUT TYPE=text NAME="email" VALUE="" SIZE=32 maxlength=100></td> </tr> <tr> <td height="41" colspan="2" valign="middle"><p><p><center> By registering an account here you agree to all of our <A HREF="$baseurl/tos.php">Terms and Conditions</A>. You can also view our <A HREF="$baseurl/privacy.php">Privacy Policy</A>. </center></p></td> </tr> <tr><td align="center">CAPTCHA:<br> (antispam code, 3 black symbols)<br> <table><tr><td><img src="captcha.php" alt="captcha image"></td><td><input type="text" name="captcha" size="3" maxlength="3"></td></tr></table> </td></tr> <td height="27" colspan="2" valign="middle"> <center><input type=submit name=Submit value="Register"></center> </td> </table> </form> <?php if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) { //CAPTHCA is valid; proceed the message: save to database, send by e-mail ... echo 'CAPTHCA is valid; proceed the message'; } else { echo 'CAPTHCA is not valid; ignore submission'; } ?> <?php END; include ($_SERVER['DOCUMENT_ROOT'].'/footer.inc.php'); ?> captcha.php <?php session_start(); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: " . gmdate("D, d M Y H:i:s") . " GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); function _generateRandom($length=6) { $_rand_src = array( array(48,57) //digits , array(97,122) //lowercase chars // , array(65,90) //uppercase chars ); srand ((double) microtime() * 1000000); $random_string = ""; for($i=0;$i<$length;$i++){ $i1=rand(0,sizeof($_rand_src)-1); $random_string .= chr(rand($_rand_src[$i1][0],$_rand_src[$i1][1])); } return $random_string; } $im = @imagecreatefromjpeg("http://sketchedneo.com/images/sitedesigns/captcha.jpg"); $rand = _generateRandom(3); $_SESSION['captcha'] = $rand; ImageString($im, 5, 2, 2, $rand[0]." ".$rand[1]." ".$rand[2]." ", ImageColorAllocate ($im, 0, 0, 0)); $rand = _generateRandom(3); ImageString($im, 5, 2, 2, " ".$rand[0]." ".$rand[1]." ".$rand[2], ImageColorAllocate ($im, 255, 0, 0)); Header ('Content-type: image/jpeg'); imagejpeg($im,NULL,100); ImageDestroy($im); ?> Help please anyone? Line 71: if(isset($_POST["captcha"])) Line 72: if($_SESSION["captcha"]==$_POST["captcha"])

    Read the article

  • Hibernate without primary keys generated by db?

    - by Michael Jones
    I'm building a data warehouse and want to use InfiniDB as the storage engine. However, it doesn't allow primary keys or foreign key constraints (or any constraints for that matter). Hibernate complains "The database returned no natively generated identity value" when I perform an insert. Each table is relational, and contains a unique integer column that was previously used as the primary key - I want to keep that, but just not have the constraint in the db that the column is the primary key. I'm assuming the problem is that Hibernate expects the db to return a generated key. Is it possible to override this behaviour so I can set the primary key field's value myself and keep Hibernate happy? -- edit -- Two of the mappings are as follows: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visitor" table="visitor" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <property name="firstSeen" type="timestamp"> <column name="first_seen" length="19" /> </property> <property name="lastSeen" type="timestamp"> <column name="last_seen" length="19" /> </property> <property name="sessionId" type="string"> <column name="session_id" length="26" unique="true" /> </property> <property name="userId" type="java.lang.Long"> <column name="user_id" /> </property> <set name="visits" inverse="true"> <key> <column name="visitor_id" /> </key> <one-to-many class="com.example.project.Visit" /> </set> </class> </hibernate-mapping> and: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visit" table="visit" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <many-to-one name="visitor" class="com.example.project.Visitor" fetch="join" cascade="all"> <column name="visitor_id" /> </many-to-one> <property name="visitId" type="string"> <column name="visit_id" length="20" unique="true" /> </property> <property name="startTime" type="timestamp"> <column name="start_time" length="19" /> </property> <property name="endTime" type="timestamp"> <column name="end_time" length="19" /> </property> <property name="userAgent" type="string"> <column name="user_agent" length="65535" /> </property> <set name="pageViews" inverse="true"> <key> <column name="visit_id" /> </key> <one-to-many class="com.example.project.PageView" /> </set> </class> </hibernate-mapping>

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • How do you overide a class that is called by another class with parent::method

    - by dan.codes
    I am trying to extend Mage_Catalog_Block_Product_View I have it setup in my local directory as its own module and everything works fine, I wasn't getting the results that I wanted. I then saw that another class extended that class as well. The method I am trying to override is the protected function _prepareLayout() This is the function class Mage_Review_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { $headBlock-&gt;setTitle($title); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { $headBlock-&gt;setDescription( ($description) ); } else { $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } return parent::_prepareLayout(); } I am trying to modify it just a bit with the following, keep in mind I know there is a title prefix and suffix but I needed it only for the product page and also I needed to add text to the description. class MyCompany_Catalog_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $storeId = Mage::app()-&gt;getStore()-&gt;getId(); $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { if($storeId == 2){ $title = "Pool Supplies Fast - " .$title; $headBlock-&gt;setTitle($title); } $headBlock-&gt;setTitle($title); }else{ $path = Mage::helper('catalog')-&gt;getBreadcrumbPath(); foreach ($path as $name =&gt; $breadcrumb) { $title[] = $breadcrumb['label']; } $newTitle = "Pool Supplies Fast - " . join($this-&gt;getTitleSeparator(), array_reverse($title)); $headBlock-&gt;setTitle($newTitle); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { if($storeId == 2){ $description = "Pool Supplies Fast - ". $this-&gt;getProduct()-&gt;getName() . " - " . $description; $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( ($description) ); } } else { if($storeId == 2){ $description = "Pool Supplies Fast: ". $this-&gt;getProduct()-&gt;getName() . " - " . $this-&gt;getProduct()-&gt;getDescription(); $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } } return Mage_Catalog_Block_Product_Abstract::_prepareLayout(); } This executs fine but then I notice that the following class Mage_Review_Block_Product_View_List extends which extends Mage_Review_Block_Product_View and that extends Mage_Catalog_Block_Product_View as well. Inside this class they call the _prepareLayout as well and call the parent with parent::_prepareLayout() class Mage_Review_Block_Product_View_List extends Mage_Review_Block_Product_View protected function _prepareLayout() { parent::_prepareLayout(); if ($toolbar = $this-&gt;getLayout()-&gt;getBlock('product_review_list.toolbar')) { $toolbar-&gt;setCollection($this-&gt;getReviewsCollection()); $this-&gt;setChild('toolbar', $toolbar); } return $this; } So obviously this just calls the same class I am extending and runs the function I am overiding but it doesn't get to my class because it is not in my class hierarchy and since it gets called after my class all the stuff in the parent class override what I have set. I'm not sure about the best way to extend this type of class and method, there has to be a good way to do this, I keep finding I am running into issues when trying to overide these prepare methods that are derived from the abstract classes, there seems to be so many classes overriding them and calling parent::method. What is the best way to override these functions?

    Read the article

  • incrementing in php

    - by Michael Stevens
    I have a function that works on other pages but on this particular page its not working 100% the piece of code that is failing to work is: $query = "SELECT * FROM rank_punting JOIN rank_player ON rank_player.full_name=rank_punting.name WHERE active='1' AND class='$class' ORDER BY ABS(`rank_punting`.`rank_final`) ASC"; $rank = 0; $lastpct = 0; $db->setQuery($query); $result = $db->query(); if(mysql_num_rows($result) > 0) { while($row = mysql_fetch_array($result, MYSQL_ASSOC)) { if ($row['rank_final'] > $lastpct) { $rank++; $lastpct = $row['rank_final']; } $name = $row['name']; $s1= $row['s1']; $s2= $row['s2']; $s3= $row['s3']; $s4= $row['s4']; $s5= $row['s5']; $s6= $row['s6']; $s7= $row['s7']; $s8= $row['s8']; $s9= $row['s9']; $c1= $row['c1']; $c2= $row['c2']; $c3= $row['c3']; $c4= $row['c4']; $c5= $row['c5']; $c6= $row['c6']; $v1= $row['v1']; $v2= $row['v2']; $comp= $row['comp_rank_final']; $season= $row['season_rank_final']; $final=$row['rank_final']; $link = "website_url"; $link2 = "<a href=\"http://{$link}\" target='_blank'>{$name}<br>Profile Page</a>"; if ($link = ''){$link2 = "<a href='index.php?option=com_ranking&view=playerprofile&player={$name}' >{$name}<br>Profile Page</a>";} echo '<tr>'; echo " <th scope'row'>{$link2} {$lastpct} </th>"; echo "<td>"; echo 'DEBUG: '; echo $row['rank_final']; echo $lastpct;echo "{$rank}</td>"; echo "<td> Competition</td>"; echo "<td> {$comp}</td>"; echo "<td> {$c1}</td>"; echo "<td> {$c2}</td>"; echo "<td> {$c3}</td>"; echo "<td> {$c4}</td>"; echo "<td> {$c5}</td>"; echo "<td> {$c6}</td>"; echo "<td> {$c7}</td>"; echo "<td> {$c8}</td>"; echo "<td> {$v2}</td>"; echo "</tr>"; echo '<tr>'; echo "<th scope'row'> </th>"; echo "<td> </td>"; echo "<td> Game Film</td>"; echo "<td> {$season}</td>"; echo "<td> {$s1}</td>"; echo "<td> {$s2}</td>"; echo "<td> {$s3}</td>"; echo "<td> {$s4}</td>"; echo "<td> {$s5}</td>"; echo "<td> {$s7}</td>"; echo "<td> {$s8}</td>"; echo "<td> {$s6}</td>"; echo "<td> {$v1}</td>"; echo "</tr>"; } } //---------------- echo '</tbody> </table>'; }

    Read the article

  • files get uploaded just before they get cancelled

    - by user1763986
    Got a little situation here where I am trying to cancel a file's upload. What I have done is stated that if the user clicks on the "Cancel" button, then it will simply remove the iframe so that it does not go to the page where it uploads the files into the server and inserts data into the database. Now this works fine if the user clicks on the "Cancel" button in quickish time the problem I have realised though is that if the user clicks on the "Cancel" button very late, it sometimes doesn't remove the iframe in time meaning that the file has just been uploaded just before the user has clicked on the "Cancel" button. So my question is that is there a way that if the file does somehow get uploaded before the user clicks on the "Cancel" button, that it deletes the data in the database and removes the file from the server? Below is the image upload form: <form action="imageupload.php" method="post" enctype="multipart/form-data" target="upload_target_image" onsubmit="return imageClickHandler(this);" class="imageuploadform" > <p class="imagef1_upload_process" align="center"> Loading...<br/> <img src="Images/loader.gif" /> </p> <p class="imagef1_upload_form" align="center"> <br/> <span class="imagemsg"></span> <label>Image File: <input name="fileImage" type="file" class="fileImage" /></label><br/> <br/> <label class="imagelbl"><input type="submit" name="submitImageBtn" class="sbtnimage" value="Upload" /></label> </p> <p class="imagef1_cancel" align="center"> <input type="reset" name="imageCancel" class="imageCancel" value="Cancel" /> </p> <iframe class="upload_target_image" name="upload_target_image" src="#" style="width:0px;height:0px;border:0px;solid;#fff;"></iframe> </form> Below is the jquery function which controls the "Cancel" button: $(imageuploadform).find(".imageCancel").on("click", function(event) { $('.upload_target_image').get(0).contentwindow $("iframe[name='upload_target_image']").attr("src", "javascript:'<html></html>'"); return stopImageUpload(2); }); Below is the php code where it uploads the files and inserts the data into the database. The form above posts to this php page "imageupload.php": <body> <?php include('connect.php'); session_start(); $result = 0; //uploads file move_uploaded_file($_FILES["fileImage"]["tmp_name"], "ImageFiles/" . $_FILES["fileImage"]["name"]); $result = 1; //set up the INSERT SQL query command to insert the name of the image file into the "Image" Table $imagesql = "INSERT INTO Image (ImageFile) VALUES (?)"; //prepare the above SQL statement if (!$insert = $mysqli->prepare($imagesql)) { // Handle errors with prepare operation here } //bind the parameters (these are the values that will be inserted) $insert->bind_param("s",$img); //Assign the variable of the name of the file uploaded $img = 'ImageFiles/'.$_FILES['fileImage']['name']; //execute INSERT query $insert->execute(); if ($insert->errno) { // Handle query error here } //close INSERT query $insert->close(); //Retrieve the ImageId of the last uploded file $lastID = $mysqli->insert_id; //Insert into Image_Question Table (be using last retrieved Image id in order to do this) $imagequestionsql = "INSERT INTO Image_Question (ImageId, SessionId, QuestionId) VALUES (?, ?, ?)"; //prepare the above SQL statement if (!$insertimagequestion = $mysqli->prepare($imagequestionsql)) { // Handle errors with prepare operation here echo "Prepare statement err imagequestion"; } //Retrieve the question number $qnum = (int)$_POST['numimage']; //bind the parameters (these are the values that will be inserted) $insertimagequestion->bind_param("isi",$lastID, 'Exam', $qnum); //execute INSERT query $insertimagequestion->execute(); if ($insertimagequestion->errno) { // Handle query error here } //close INSERT query $insertimagequestion->close(); ?> <!--Javascript which will output the message depending on the status of the upload (successful, failed or cancelled)--> <script> window.top.stopImageUpload(<?php echo $result; ?>, '<?php echo $_FILES['fileImage']['name'] ?>'); </script> </body> UPDATE: Below is the php code "cancelimage.php" where I want to delete the cancelled file from the server and delete the record from the database. It is set up but not finished, can somebody finish it off so I can retrieve the name of the file and it's id using $_SESSION? <?php // connect to the database include('connect.php'); /* check connection */ if (mysqli_connect_errno()) { printf("Connect failed: %s\n", mysqli_connect_error()); die(); } //remove file from server unlink("ImageFiles/...."); //need to retrieve file name here where the ... line is //DELETE query statement where it will delete cancelled file from both Image and Image Question Table $imagedeletesql = " DELETE img, img_q FROM Image AS img LEFT JOIN Image_Question AS img_q ON img_q.ImageId = img.ImageId WHERE img.ImageFile = ?"; //prepare delete query if (!$delete = $mysqli->prepare($imagedeletesql)) { // Handle errors with prepare operation here } //Dont pass data directly to bind_param store it in a variable $delete->bind_param("s",$img); //execute DELETE query $delete->execute(); if ($delete->errno) { // Handle query error here } //close query $delete->close(); ?> Can you please provide an sample code in your answer to make it easier for me. Thank you

    Read the article

  • SSL in tomcat with apr and Centos 6

    - by Jonathan
    I'm facing a problem setting up my tomcat with apr native lib, I have the following: Tomcat: 7.0.42 Java: 1.7.0_40-b43 OS: Centos 6.4 (2.6.32-358.18.1.el6.i686) APR: 1.3.9 Native lib: 1.1.27 OpenSSL: openssl-1.0.0-27.el6_4.2.i686 My server.xml looks like: ... <Listener className="org.apache.catalina.core.AprLifecycleListener" SSLEngine="on" /> ... <Connector port="8443" protocol="HTTP/1.1" SSLEnabled="true" maxThreads="150" scheme="https" secure="true" clientAuth="false" sslProtocol="TLS" SSLCertificateFile="/tmp/monitoringPortalCert.pem" SSLCertificateKeyFile="/tmp/monitoringPortalKey.pem" SSLPassword="hide" /> ... I compiled the native lib as follow: ./configure --with-apr=/usr/bin/apr-1-config --with-ssl=yes --prefix=$CATALINA_HOME make && make install The APR is loaded ok: Oct 06, 2013 7:55:14 PM org.apache.catalina.core.AprLifecycleListener init INFO: Loaded APR based Apache Tomcat Native library 1.1.27 using APR version 1.3.9. But I'm still having this error: SEVERE: Failed to initialize the SSLEngine. org.apache.tomcat.jni.Error: 70023: This function has not been implemented on this platform ./configure outcome [root@localhost native]# ./configure --with-apr=/usr/bin/apr-1-config --with-ssl=yes -- prefix=$CATALINA_HOME && make && make install checking build system type... i686-pc-linux-gnu checking host system type... i686-pc-linux-gnu checking target system type... i686-pc-linux-gnu checking for a BSD-compatible install... /usr/bin/install -c checking for working mkdir -p... yes Tomcat Native Version: 1.1.27 checking for chosen layout... tcnative checking for APR... yes setting CC to "gcc" setting CPP to "gcc -E" checking for JDK location (please wait)... /usr/java/jdk1.7.0_40 from environment checking Java platform... checking Java platform... checking for sablevm... NONE adding "-I/usr/java/jdk1.7.0_40/include" to TCNATIVE_PRIV_INCLUDES checking os_type directory... linux adding "-I/usr/java/jdk1.7.0_40/include/linux" to TCNATIVE_PRIV_INCLUDES checking for gcc... gcc checking whether the C compiler works... yes checking for C compiler default output file name... a.out checking for suffix of executables... checking whether we are cross compiling... no checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for OpenSSL library... using openssl from /usr/lib and /usr/include checking OpenSSL library version... ok checking for OpenSSL DSA support... yes setting TCNATIVE_LDFLAGS to "-lssl -lcrypto" adding "-DHAVE_OPENSSL" to CFLAGS setting TCNATIVE_LIBS to "" setting TCNATIVE_LIBS to " /usr/lib/libapr-1.la -lpthread" configure: creating ./config.status config.status: creating tcnative.pc config.status: creating Makefile config.status: executing default commands make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' /usr/lib/apr-1/build/mkdir.sh /usr/apache-tomcat-7.0.42/include/apr-1 /usr/apache- tomcat-7.0.42/lib/pkgconfig \ /usr/apache-tomcat-7.0.42/lib /usr/apache-tomcat-7.0.42/bin /usr/bin/install -c -m 644 tcnative.pc /usr/apache-tomcat-7.0.42/lib/pkgconfig/tcnative- 1.pc list=''; for i in $list; do \ ( cd $i ; make DESTDIR= install ); \ done /bin/sh /usr/lib/apr-1/build/libtool --mode=install /usr/bin/install -c -m 755 libtcnative-1.la /usr/apache-tomcat-7.0.42/lib libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.so.0.1.27 /usr/apache- tomcat-7.0.42/lib/libtcnative-1.so.0.1.27 libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so.0 || { rm -f libtcnative-1.so.0 && ln -s libtcnative- 1.so.0.1.27 libtcnative-1.so.0; }; }) libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so || { rm -f libtcnative-1.so && ln -s libtcnative-1.so.0.1.27 libtcnative-1.so; }; }) libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.lai /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.la libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.a /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.a libtool: install: chmod 644 /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: ranlib /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: warning: remember to run `libtool --finish /usr/local/apr/lib' make && make install outcome: make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' /usr/lib/apr-1/build/mkdir.sh /usr/apache-tomcat-7.0.42/include/apr-1 /usr/apache- tomcat-7.0.42/lib/pkgconfig \ /usr/apache-tomcat-7.0.42/lib /usr/apache-tomcat-7.0.42/bin /usr/bin/install -c -m 644 tcnative.pc /usr/apache-tomcat-7.0.42/lib/pkgconfig/tcnative- 1.pc list=''; for i in $list; do \ ( cd $i ; make DESTDIR= install ); \ done /bin/sh /usr/lib/apr-1/build/libtool --mode=install /usr/bin/install -c -m 755 libtcnative-1.la /usr/apache-tomcat-7.0.42/lib libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.so.0.1.27 /usr/apache- tomcat-7.0.42/lib/libtcnative-1.so.0.1.27 libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so.0 || { rm -f libtcnative-1.so.0 && ln -s libtcnative- 1.so.0.1.27 libtcnative-1.so.0; }; }) libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so || { rm -f libtcnative-1.so && ln -s libtcnative-1.so.0.1.27 libtcnative-1.so; }; }) libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.lai /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.la libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.a /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.a libtool: install: chmod 644 /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: ranlib /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: warning: remember to run `libtool --finish /usr/local/apr/lib' It seems everything is fine, but the error is not self-explanatory Could you guys help to understand where my error is? What am I missing? Thanks in advance for your support.

    Read the article

  • how do i install PHP with JSON and OAuth on Mac Snow Leopard?

    - by meilas
    i want to use the dropbox api via this library http://code.google.com/p/dropbox-php/ i installed MAMP then I tried "sudo pecl install oauth" but I got downloading oauth-1.0.0.tgz ... Starting to download oauth-1.0.0.tgz (42,834 bytes) ............done: 42,834 bytes 6 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 building in /var/tmp/pear-build-root/oauth-1.0.0 running: /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/configure checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for a sed that does not truncate output... /opt/local/bin/gsed checking for cc... cc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether cc accepts -g... yes checking for cc option to accept ISO C89... none needed checking how to run the C preprocessor... cc -E checking for icc... no checking for suncc... no checking whether cc understands -c and -o together... yes checking for system library directory... lib checking if compiler supports -R... no checking if compiler supports -Wl,-rpath,... yes checking build system type... i686-apple-darwin10.4.0 checking host system type... i686-apple-darwin10.4.0 checking target system type... i686-apple-darwin10.4.0 checking for PHP prefix... /usr checking for PHP includes... -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib checking for PHP extension directory... /usr/lib/php/extensions/no-debug-non-zts-20090626 checking for PHP installed headers prefix... /usr/include/php checking if debug is enabled... no checking if zts is enabled... no checking for re2c... no configure: WARNING: You will need re2c 0.13.4 or later if you want to regenerate PHP parsers. checking for gawk... gawk checking for oauth support... yes, shared checking for cURL in default path... found in /usr checking for ld used by cc... /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld checking if the linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) is GNU ld... no checking for /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm checking whether ln -s works... yes checking how to recognise dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm output from cc object... rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory checking if cc static flag works... rm: conftest.dSYM: is a directory yes checking if cc supports -fno-rtti -fno-exceptions... rm: conftest.dSYM: is a directory no checking for cc option to produce PIC... -fno-common checking if cc PIC flag -fno-common works... rm: conftest.dSYM: is a directory yes checking if cc supports -c -o file.o... rm: conftest.dSYM: is a directory yes checking whether the cc linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) supports shared libraries... yes checking dynamic linker characteristics... darwin10.4.0 dyld checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... no creating libtool appending configuration tag "CXX" to libtool configure: creating ./config.status config.status: creating config.h running: make /bin/sh /private/var/tmp/pear-build-root/oauth-1.0.0/libtool --mode=compile cc -I. -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c -o oauth.lo mkdir .libs cc -I. "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c "/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c" -fno-common -DPIC -o .libs/oauth.o In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:29:18: error: pcre.h: No such file or directory In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:37: error: expected '=', ',', ';', 'asm' or 'attribute' before '*' token /usr/include/php/ext/pcre/php_pcre.h:38: error: expected '=', ',', ';', 'asm' or 'attribute' before '*' token /usr/include/php/ext/pcre/php_pcre.h:44: error: expected specifier-qualifier-list before 'pcre' make: * [oauth.lo] Error 1 ERROR: `make' failed

    Read the article

  • How do I install PHP with JSON and OAuth on Mac Snow Leopard?

    - by meilas
    I want to use the Dropbox API via this library, http://code.google.com/p/dropbox-php/. I installed MAMP, and then I tried sudo pecl install oauth but I got the following. >>>> downloading oauth-1.0.0.tgz ... Starting to download oauth-1.0.0.tgz (42,834 bytes) ............done: 42,834 bytes 6 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 building in /var/tmp/pear-build-root/oauth-1.0.0 running: /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/configure checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for a sed that does not truncate output... /opt/local/bin/gsed checking for cc... cc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether cc accepts -g... yes checking for cc option to accept ISO C89... none needed checking how to run the C preprocessor... cc -E checking for icc... no checking for suncc... no checking whether cc understands -c and -o together... yes checking for system library directory... lib checking if compiler supports -R... no checking if compiler supports -Wl,-rpath,... yes checking build system type... i686-apple-darwin10.4.0 checking host system type... i686-apple-darwin10.4.0 checking target system type... i686-apple-darwin10.4.0 checking for PHP prefix... /usr checking for PHP includes... -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib checking for PHP extension directory... /usr/lib/php/extensions/no-debug-non-zts-20090626 checking for PHP installed headers prefix... /usr/include/php checking if debug is enabled... no checking if zts is enabled... no checking for re2c... no configure: WARNING: You will need re2c 0.13.4 or later if you want to regenerate PHP parsers. checking for gawk... gawk checking for oauth support... yes, shared checking for cURL in default path... found in /usr checking for ld used by cc... /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld checking if the linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) is GNU ld... no checking for /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm checking whether ln -s works... yes checking how to recognise dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm output from cc object... rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory checking if cc static flag works... rm: conftest.dSYM: is a directory yes checking if cc supports -fno-rtti -fno-exceptions... rm: conftest.dSYM: is a directory no checking for cc option to produce PIC... -fno-common checking if cc PIC flag -fno-common works... rm: conftest.dSYM: is a directory yes checking if cc supports -c -o file.o... rm: conftest.dSYM: is a directory yes checking whether the cc linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) supports shared libraries... yes checking dynamic linker characteristics... darwin10.4.0 dyld checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... no >>>> creating libtool appending configuration tag "CXX" to libtool configure: creating ./config.status config.status: creating config.h running: make /bin/sh /private/var/tmp/pear-build-root/oauth-1.0.0/libtool --mode=compile cc -I. -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c -o oauth.lo mkdir .libs cc -I. "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c "/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c" -fno-common -DPIC -o .libs/oauth.o In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:29:18: error: pcre.h: No such file or directory In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:37: error: expected '=', ',', ';', 'asm' or '__attribute__' before '*' token /usr/include/php/ext/pcre/php_pcre.h:38: error: expected '=', ',', ';', 'asm' or '__attribute__' before '*' token /usr/include/php/ext/pcre/php_pcre.h:44: error: expected specifier-qualifier-list before 'pcre' make: *** [oauth.lo] Error 1 ERROR: `make' failed </block>

    Read the article

  • How to run a DHCP service on Windows 7 Home

    - by Joshua Lim
    I'm trying to setup a DHCP server on Windows 7 Home, tried using a couple of freeware which I found on the Internet but none seemed to work. What I did: On the Windows 7 machine which I install the DHCP Server with the range 192.168.1.12-192.168.1.256. I set the Gigabit Ethernet adapter to a static IP address of 192.168.1.11 and subnet mask of 255.255.255.0. When I did an IP config, it showed. Ethernet adapter Local Area Connection: Connection-specific DNS Suffix . : Description . . . . . . . . . . . : Broadcom NetLink (TM) Gigabit Ethernet Physical Address. . . . . . . . . : 8C-73-6E-75-A7-56 DHCP Enabled. . . . . . . . . . . : No Autoconfiguration Enabled . . . . : Yes Link-local IPv6 Address . . . . . : fe80::196d:b6bb:8f93:2555%12(Preferred) IPv4 Address. . . . . . . . . . . : 192.168.1.11(Preferred) Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : DNS Servers . . . . . . . . . . . : fec0:0:0:ffff::1%1 fec0:0:0:ffff::2%1 fec0:0:0:ffff::3%1 NetBIOS over Tcpip. . . . . . . . : Enabled I connected another Window 7 machine to the "DHCP server" using a cross cable and set network adapter on that machine to automatically detect IP address. The client fails to acquire the correct IP address from the DHCP server and showed the autoconfigured IPv4 address instead. Here's the information returned by config /all on the client machine. Ethernet adapter Local Area Connection: Connection-specific DNS Suffix . : Description . . . . . . . . . . . : Atheros AR8152/8158 PCI-E Fast Ethernet Controller (NDIS 6.20) Physical Address. . . . . . . . . : 54-04-A6-40-96-4B DHCP Enabled. . . . . . . . . . . : Yes Autoconfiguration Enabled . . . . : Yes Link-local IPv6 Address . . . . . : fe80::4885:4082:5572:5a85%12(Preferred) Autoconfiguration IPv4 Address. . : 169.254.90.133(Preferred) Subnet Mask . . . . . . . . . . . : 255.255.0.0 Default Gateway . . . . . . . . . : DHCPv6 IAID . . . . . . . . . . . : 341050534 DHCPv6 Client DUID. . . . . . . . : 00-01-00-01-17-54-78-12-00-08-CA-46-4C-5A DNS Servers . . . . . . . . . . . : fec0:0:0:ffff::1%1 fec0:0:0:ffff::2%1 fec0:0:0:ffff::3%1 NetBIOS over Tcpip. . . . . . . . : Enabled DHCP client are running on both machines. I've tried many times but failed. Googling also returned no useful information for my scenario. Have I missed out any step? Thanks.

    Read the article

< Previous Page | 383 384 385 386 387 388 389 390 391  | Next Page >