Search Results

Search found 88829 results on 3554 pages for 'new office'.

Page 388/3554 | < Previous Page | 384 385 386 387 388 389 390 391 392 393 394 395  | Next Page >

  • Strange results - I obtain same value for all keys

    - by Pietro Luciani
    I have a problem with mapreduce. Giving as input a list of song ("Songname"#"UserID"#"boolean") i must have as result a song list in which is specified how many time different useres listen them... so a output ("Songname","timelistening"). I used hashtable to allow only one couple . With short files it works well but when I put as input a list about 1000000 of records it returns me the same value (20) for all records. This is my mapper: public static class CanzoniMapper extends Mapper<Object, Text, Text, IntWritable>{ private IntWritable userID = new IntWritable(0); private Text song = new Text(); public void map(Object key, Text value, Context context) throws IOException, InterruptedException { /*StringTokenizer itr = new StringTokenizer(value.toString()); while (itr.hasMoreTokens()) { word.set(itr.nextToken()); context.write(word, one); }*/ String[] caratteri = value.toString().split("#"); if(caratteri[2].equals("1")){ song.set(caratteri[0]); userID.set(Integer.parseInt(caratteri[1])); context.write(song,userID); } } } This is my reducer: public static class CanzoniReducer extends Reducer<Text,IntWritable,Text,IntWritable> { private IntWritable result = new IntWritable(); public void reduce(Text key, Iterable<IntWritable> values, Context context) throws IOException, InterruptedException { Hashtable<IntWritable,Text> doppioni = new Hashtable<IntWritable,Text>(); for (IntWritable val : values) { doppioni.put(val,key); } result.set(doppioni.size()); //doppioni.clear(); context.write(key,result); } } and main: Configuration conf = new Configuration(); Job job = new Job(conf, "word count"); job.setJarByClass(Canzoni.class); job.setMapperClass(CanzoniMapper.class); //job.setCombinerClass(CanzoniReducer.class); //job.setNumReduceTasks(2); job.setReducerClass(CanzoniReducer.class); job.setOutputKeyClass(Text.class); job.setOutputValueClass(IntWritable.class); FileInputFormat.addInputPath(job, new Path(args[0])); FileOutputFormat.setOutputPath(job, new Path(args[1])); System.exit(job.waitForCompletion(true) ? 0 : 1); Any idea???

    Read the article

  • Jetty RewriteHandler and RewriteRegexRule

    - by Justin
    I'm trying to rewrite a URL for a servlet. The URL gets rewritten correctly, but the context doesn't match after that. Any idea how to get this to work? RewriteHandler rewriteHandler = new RewriteHandler(); rewriteHandler.setRewriteRequestURI(true); rewriteHandler.setRewritePathInfo(true); rewriteHandler.setOriginalPathAttribute("requestedPath"); RewriteRegexRule rewriteRegexRule = new RewriteRegexRule(); rewriteRegexRule.setRegex("/r/([^/]*).*"); rewriteRegexRule.setReplacement("/r?z=$1"); rewriteHandler.addRule(rewriteRegexRule); ContextHandlerCollection contextHandlerCollection = new ContextHandlerCollection(); Context servletContext = new Context(contextHandlerCollection, "/"); servletContext.addServlet(new ServletHolder(new RedirectServlet()), "/r"); So basically /r/asdf gets rewritten to /r?z=asdf. However, the rewritten /r?z=asdf is now not processed by the servlet. Also, /r?z=asdf does work if called directly.

    Read the article

  • ASP .net Dropdown list not saving the selected value to database

    - by user326010
    Hi In the following code i want to save the value selected by user from drop downlist into database. but whatever value is selected by user, first value of dropdown lsit is saved to database View <% =Html.DropDownList("lstUsertype", (SelectList)ViewData["UserTypeID"])%> Controller public ActionResult CreateUser() { UmUser _UmUser = new UmUser(); UMRepository _UMRepository = new UMRepository(); EvoLetDataContext db = new EvoLetDataContext(); ViewData["UserTypeID"] = new SelectList(_UMRepository.FillUserTypes(), "UserTypeID", "UserType",2); return View(_UmUser); } [AcceptVerbs(HttpVerbs.Post)] public ActionResult CreateUser(UmUser _umUser) { //try //{ if (ModelState.IsValid) { //try //{ UserRepository _UserRepository = new UserRepository(); _UserRepository.Add(_umUser); _UserRepository.Save(); return RedirectToAction("Details", new { id = _umUser.UserID }); /*} catch { ModelState.AddModelErrors(_umUser.GetRuleViolations()); }*/ } return View(); //} /*catch { return View(); }*/ }

    Read the article

  • Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

    - by SidC
    Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem to focus JTextField

    - by Tom Brito
    I have used the approach of the ComponentListener to call focus in JTextField within a dialog, but for this case is just not working, I don't know why. It shows the focus in the text field and fast change to the button. Run and see: import java.awt.Component; import java.awt.GridLayout; import java.awt.event.ComponentEvent; import java.awt.event.ComponentListener; import javax.swing.JDialog; import javax.swing.JLabel; import javax.swing.JOptionPane; import javax.swing.JPanel; import javax.swing.JPasswordField; import javax.swing.JTextField; public class User { private String username = ""; private String password = ""; public User() { // default constructor } public User(String username, String password) { this.username = username; this.password = password; } /** Create a panel containing the componet and tha label. */ public JPanel createLabeledComponent(JLabel label, Component comp) { GridLayout layout = new GridLayout(2, 1); JPanel panel = new JPanel(layout); panel.add(label); panel.add(comp); label.setLabelFor(comp); return panel; } public void showEditDialog() { JLabel usernameLbl = new JLabel(username); final JTextField usernameField = new JTextField(); usernameField.setText(username); JPanel usernamePnl = createLabeledComponent(usernameLbl, usernameField); JLabel passwordLbl = new JLabel(password); JPasswordField passwordField = new JPasswordField(password); JPanel passwordPnl = createLabeledComponent(passwordLbl, passwordField); Object[] fields = { "User:", usernamePnl, "Password:", passwordPnl }; JOptionPane optionPane = new JOptionPane(fields, JOptionPane.PLAIN_MESSAGE, JOptionPane.OK_CANCEL_OPTION, null, null); JDialog dialog = optionPane.createDialog("User Data"); dialog.addComponentListener(new ComponentListener() { public void componentShown(ComponentEvent e) { usernameField.requestFocusInWindow(); } public void componentResized(ComponentEvent e) {} public void componentMoved(ComponentEvent e) {} public void componentHidden(ComponentEvent e) {} }); dialog.setVisible(true); } public static void main(String[] args) { new User().showEditDialog(); } } Any idea how to solve this?

    Read the article

  • HttpPost request unsuccessful

    - by The Thom
    I have written a web service and am now writing a tester to perform integration testing from the outside. I am writing my tester using apache httpclient 4.3. Based on the code here: http://hc.apache.org/httpcomponents-client-4.3.x/quickstart.html and here: http://hc.apache.org/httpcomponents-client-4.3.x/tutorial/html/fundamentals.html#d5e186 I have written the following code. Map<String, String> parms = new HashMap<>(); parms.put(AirController.KEY_VALUE, json); postUrl(SERVLET, parms); ... protected String postUrl(String servletName, Map<String, String> parms) throws AirException{ String url = rootUrl + servletName; HttpPost post = new HttpPost(url); List<NameValuePair> nvps = new ArrayList<NameValuePair>(); for(Map.Entry<String, String> entry:parms.entrySet()){ BasicNameValuePair parm = new BasicNameValuePair(entry.getKey(), entry.getValue()); nvps.add(parm); } try { post.setEntity(new UrlEncodedFormEntity(nvps)); } catch (UnsupportedEncodingException use) { String msg = "Invalid parameters:" + parms; throw new AirException(msg, use); } CloseableHttpResponse response; try { response = httpclient.execute(post); } catch (IOException ioe) { throw new AirException(ioe); } String result; if(HttpStatus.SC_OK == response.getStatusLine().getStatusCode()){ result = processResponse(response); } else{ String msg = MessageFormat.format("Invalid status code {0} received from query {1}.", new Object[]{response.getStatusLine().getStatusCode(), url}); throw new AirException(msg); } return result; } This code successfully reaches my servlet. In my servlet, I have (using Spring's AbstractController): protected ModelAndView post(HttpServletRequest request, HttpServletResponse response) { String json = String.valueOf(request.getParameter(KEY_VALUE)); if(json.equals("null")){ log.info("Received null value."); response.setStatus(406); return null; } And this code always falls into the null parameter code and returns a 406. I'm sure I'm missing something simple, but can't see what it is.

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • AJAX Issue, Works in all browsers except IE

    - by Nik
    Alright, this code works in Chrome and FF, but not IE (which is to be expected). Does anyone see anything wrong with this code that would render it useless in IE? var waittime=400; chatmsg = document.getElementById("chatmsg"); room = document.getElementById("roomid").value; sessid = document.getElementById("sessid").value; chatmsg.focus() document.getElementById("chatwindow").innerHTML = "loading..."; document.getElementById("userwindow").innerHTML = "Loading User List..."; var xmlhttp = false; var xmlhttp2 = false; var xmlhttp3 = false; function ajax_read() { if(window.XMLHttpRequest){ xmlhttp=new XMLHttpRequest(); if(xmlhttp.overrideMimeType){ xmlhttp.overrideMimeType('text/xml'); } } else if(window.ActiveXObject){ try{ xmlhttp=new ActiveXObject("Msxml2.XMLHTTP"); } catch(e) { try{ xmlhttp=new ActiveXObject("Microsoft.XMLHTTP"); } catch(e){ } } } if(!xmlhttp) { alert('Giving up :( Cannot create an XMLHTTP instance'); return false; } xmlhttp.onreadystatechange = function() { if (xmlhttp.readyState==4) { document.getElementById("chatwindow").innerHTML = xmlhttp.responseText; setTimeout("ajax_read()", waittime); } } xmlhttp.open('GET','methods.php?method=r&room=' + room +'',true); xmlhttp.send(null); } function user_read() { if(window.XMLHttpRequest){ xmlhttp3=new XMLHttpRequest(); if(xmlhttp3.overrideMimeType){ xmlhttp3.overrideMimeType('text/xml'); } } else if(window.ActiveXObject){ try{ xmlhttp3=new ActiveXObject("Msxml2.XMLHTTP"); } catch(e) { try{ xmlhttp3=new ActiveXObject("Microsoft.XMLHTTP"); } catch(e){ } } } if(!xmlhttp3) { alert('Giving up :( Cannot create an XMLHTTP instance'); return false; } xmlhttp3.onreadystatechange = function() { if (xmlhttp3.readyState==4) { document.getElementById("userwindow").innerHTML = xmlhttp3.responseText; setTimeout("user_read()", 10000); } } xmlhttp3.open('GET','methods.php?method=u&room=' + room +'',true); xmlhttp3.send(null); } function ajax_write(url){ if(window.XMLHttpRequest){ xmlhttp2=new XMLHttpRequest(); if(xmlhttp2.overrideMimeType){ xmlhttp2.overrideMimeType('text/xml'); } } else if(window.ActiveXObject){ try{ xmlhttp2=new ActiveXObject("Msxml2.XMLHTTP"); } catch(e) { try{ xmlhttp2=new ActiveXObject("Microsoft.XMLHTTP"); } catch(e){ } } } if(!xmlhttp2) { alert('Giving up :( Cannot create an XMLHTTP instance'); return false; } xmlhttp2.open('GET',url,true); xmlhttp2.send(null); } function submit_msg(){ nick = document.getElementById("chatnick").value; msg = document.getElementById("chatmsg").value; document.getElementById("chatmsg").value = ""; ajax_write("methods.php?method=w&m=" + msg + "&n=" + nick + "&room=" + room + "&sessid=" + sessid + ""); } function keyup(arg1) { if (arg1 == 13) submit_msg(); } var intUpdate = setTimeout("ajax_read()", waittime); var intUpdate = setTimeout("user_read()", 0);

    Read the article

  • How to put a background image on GridBagLayout

    - by Loligans
    I am trying to work with layout managers for the first time, and they are just kicking me in the teeth. I am trying to make a background image and then put buttons on top, using GridBagLayout, if there is a a better layoutmanager please do tell. As for trying to learn how to use layout managers, its very difficult and any learning references would also be much appreciated. This is what it looks like currently, I can get the frame to show the full image, but when i use gridlayout manager, it does that public void addComponentsToPane(Container pane){ BackgroundImage image = new BackgroundImage(); JButton button1, button2, button3, button4, button5; pane.setLayout(new GridBagLayout()); GridBagConstraints c = new GridBagConstraints(); if(shouldFill){ c.fill = GridBagConstraints.NONE; } button1 = new JButton("Button 1"); if (shouldWeightX) { c.weightx = 0.5; } c.fill = GridBagConstraints.HORIZONTAL; c.gridx = 1; c.gridy = 0; button1.setOpaque(false); pane.add(button1, c); button2 = new JButton("Button 2"); c.fill = GridBagConstraints.HORIZONTAL; c.weightx = 0.5; c.gridx = 0; c.gridy = 0; button2.setOpaque(false); pane.add(button2, c); button3 = new JButton("Button 3"); c.fill = GridBagConstraints.HORIZONTAL; c.weightx = 0.5; c.gridx = 2; c.gridy = 0; button3.setOpaque(false); pane.add(button3, c); button4 = new JButton("Long-Named Button 4"); c.fill = GridBagConstraints.HORIZONTAL; c.ipady = 40; //make this component tall c.weightx = 0.0; c.gridwidth = 3; c.gridx = 0; c.gridy = 1; pane.add(button4, c); button5 = new JButton("button 1"); c.fill = GridBagConstraints.HORIZONTAL; c.ipady = 0; //reset to default c.weighty = 1.0; //request any extra vertical space c.anchor = GridBagConstraints.PAGE_END; //bottom of space c.insets = new Insets(10,0,0,0); //top padding c.gridx = 1; //aligned with button 2 c.gridwidth = 2; //2 columns wide c.gridy = 2; //third row pane.add(button5, c); c.ipadx = 800; c.ipady = 400; pane.add(image, c); } This is what i'm trying to make it look like

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • How to encrypt and save a binary stream after serialization and read it back?

    - by Anindya Chatterjee
    I am having some problems in using CryptoStream when I want to encrypt a binary stream after binary serialization and save it to a file. I am getting the following exception System.ArgumentException : Stream was not readable. Can anybody please show me how to encrypt a binary stream and save it to a file and deserialize it back correctly? The code is as follows: class Program { public static void Main(string[] args) { var b = new B {Name = "BB"}; WriteFile<B>(@"C:\test.bin", b, true); var bb = ReadFile<B>(@"C:\test.bin", true); Console.WriteLine(b.Name == bb.Name); Console.ReadLine(); } public static T ReadFile<T>(string file, bool decrypt) { T bObj = default(T); var _binaryFormatter = new BinaryFormatter(); Stream buffer = null; using (var stream = new FileStream(file, FileMode.OpenOrCreate)) { if(decrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Read); } buffer = cs; } else buffer = stream; try { bObj = (T) _binaryFormatter.Deserialize(buffer); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } return bObj; } public static void WriteFile<T>(string file, T bObj, bool encrypt) { var _binaryFormatter = new BinaryFormatter(); Stream buffer; using (var stream = new FileStream(file, FileMode.Create)) { try { if(encrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Write); buffer = cs; } } else buffer = stream; _binaryFormatter.Serialize(buffer, bObj); buffer.Flush(); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } } } [Serializable] public class B { public string Name {get; set;} } It throws the serialization exception as follows The input stream is not a valid binary format. The starting contents (in bytes) are: 3F-17-2E-20-80-56-A3-2A-46-63-22-C4-49-56-22-B4-DA ...

    Read the article

  • How to change Gmap markers color?

    - by user191687
    Hi! I've a custom google map with different points: Markers[0] = new Array(new GMarker(new GLatLng(45.0, 9.0)), "Location1", "<strong>Address Line</strong><br/>Some information"); Markers[1] = new Array(new GMarker(new GLatLng(45.0, 12.0)), "Location2", "<strong>Address Line</strong><br/>Some information"); etc. Simply I want to change the color of the markers from the default red. I.E. the 2nd blue. How to do this?

    Read the article

  • How to handle ordering of @Rule's when they are dependant on eachother

    - by Lennart Schedin
    I use embedded servers that run inside Junit test cases. Sometimes these servers require a working directory (for example the Apache Directory server). The new @Rule in Junit 4.7 can handle these cases. The TemporaryFolder-Rule can create a temporary directory. A custom ExternalResource-Rule can be created for server. But how do I handle if I want to pass the result from one rule into another: import static org.junit.Assert.assertEquals; import java.io.*; import org.junit.*; import org.junit.rules.*; public class FolderRuleOrderingTest { @Rule public TemporaryFolder folder = new TemporaryFolder(); @Rule public MyNumberServer server = new MyNumberServer(folder); @Test public void testMyNumberServer() throws IOException { server.storeNumber(10); assertEquals(10, server.getNumber()); } /** Simple server that can store one number */ private static class MyNumberServer extends ExternalResource { private TemporaryFolder folder; /** The actual datafile where the number are stored */ private File dataFile; public MyNumberServer(TemporaryFolder folder) { this.folder = folder; } @Override protected void before() throws Throwable { if (folder.getRoot() == null) { throw new RuntimeException("TemporaryFolder not properly initialized"); } //All server data are stored to a working folder File workingFolder = folder.newFolder("my-work-folder"); dataFile = new File(workingFolder, "datafile"); } public void storeNumber(int number) throws IOException { dataFile.createNewFile(); DataOutputStream out = new DataOutputStream(new FileOutputStream(dataFile)); out.writeInt(number); } public int getNumber() throws IOException { DataInputStream in = new DataInputStream(new FileInputStream(dataFile)); return in.readInt(); } } } In this code the folder is sent as a parameter into the server so that the server can create a working directory to store data. However this does not work because Junit processes the rules in reverse order as they are defined in the file. The TemporaryFolder Rule will not be executed before the server Rule. Thus the root-folder in TempraryFolder will be null, resulting that any files are created relative to the current working directory. If I reverse the order of the attributes in my class I get a compile error because I cannot reference a variable before it is defined. I'm using Junit 4.8.1 (because the ordering of rules was fixed a bit from the 4.7 release)

    Read the article

  • Dojo How to ColorPalette + TooltipDialog + DropDownButton

    - by portoalet
    I am trying to add a ColorPalette into a TooltipDialog, which in turn is contained inside DropDownButton (dojo 1.3.1) Code: var paramsContent = new dijit.layout.ContentPane(); var colorPalette = new dijit.ColorPalette(); var tooltipThematic = new dijit.TooltipDialog({content: paramsContent}); var colorField = new dijit.form.DropDownButton( {label: 'Select Color', dropDown: tooltipThematic } ); How can I add the colorPalette into tooltipThematic? I did var tooltipThematic = new dijit.TooltipDialog(new dijit.ColorPalette()) but then I got this message: Already registered widget (error message on 1.0) http://o.dojotoolkit.org/forum/dijit-dijit-0-9/dijit-support/already-registered-widget-error-message How can I add the ColorPalette into the TooltipDialog?

    Read the article

  • Adding checkbox dynamically

    - by shiv09
    public Form1 f1 = new Form1(); int p = 150; int q = 100; public void add() { //CheckBox c = new CheckBox(); //c.Location = new Point(p, q); //c.Text = f1.sub[0]; //this.Controls.Add(c); CheckBox chkBox = new CheckBox(); chkBox.Location = new Point(p, q); chkBox.Text = "Checked"; chkBox.Checked = false; chkBox.CheckState = CheckState.Checked; chkBox.CheckedChanged += new EventHandler(chkBox_CheckedChanged);// this.Controls.Add(chkBox); chkBox.Text = f1.sub[1];//The problem is here...whatever value I supply to sub[] it gives the below mentioned error } Index was out of range. Must be non-negative and less than the size of the collection. Parameter name: index Here sub[] is a list in form1 which has 5 values...

    Read the article

  • How to make a control invisible?

    - by Nakilon
    I've made several TextCtrls and Button, but currently users of my application don't want to see them. So I have to hide them temporary (for current build). Here they are: class MainFrame < Wx::Frame def initialize (parent = nil) super nil,:title=>"sometitle",:size=>[600,600] set_sizer Wx::BoxSizer.new Wx::VERTICAL @tag1 = Wx::TextCtrl.new self sizer.add_item @tag1,:flag=>Wx::RIGHT|Wx::EXPAND @tag1.set_value 'property' @tag1title = Wx::TextCtrl.new self sizer.add_item @tag1title,:flag=>Wx::RIGHT|Wx::EXPAND @tag1title.set_value 'title' @tag2 = Wx::TextCtrl.new self sizer.add_item @tag2,:flag=>Wx::RIGHT|Wx::EXPAND @tag2.set_value 'description' @tag2title = Wx::TextCtrl.new self sizer.add_item @tag2title,:flag=>Wx::RIGHT|Wx::EXPAND @tag2title.set_value '' @button_parse = Wx::Button.new self sizer.add_item @button_parse @button_parse.label = "Parse XML" evt_button @button_parse, :click_parse # ...... end # ...... end I see nothing about it in docs and Google is also not a friend for me today.

    Read the article

  • click buttons error

    - by sara
    I will retrieve student information (id -number- name) from a database (MySQL) as a list view, each student have 2 buttons (delete - alert ) and radio buttons Every thing is ok, but how can I make an onClickListener, for example for the delete button because I try lots of examples, I heard that I can use (custom list or get view or direct onClickListener as in my code (but it is not working ) or Simple Cursor Adapter) I do not know what to use, I looked around for examples that can help me, but in my case but I did not find any so I hope this be reference for anyone have the same problem. this is my code which I use direct onClick with Simple Adapter public class ManageSection extends ListActivity { //ProgresogressDialog pDialog; private ProgressDialog pDialog; // Creating JSON Parser object // Creating JSON Parser object JSONParser jParser = new JSONParser(); //class boolean x =true; Button delete; ArrayList<HashMap<String, String>> studentList; //url to get all products list private static String url_all_student = "http://10.0.2.2/SmsPhp/view_student_info.php"; String cl; // JSON Node names private static final String TAG_SUCCESS = "success"; private static final String TAG_student = "student"; private static final String TAG_StudentID = "StudentID"; private static final String TAG_StudentNo = "StudentNo"; private static final String TAG_FullName = "FullName"; private static final String TAG_Avatar="Avatar"; HashMap<String, String> selected_student; // course JSONArray JSONArray student = null; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.manage_section); studentList = new ArrayList<HashMap<String, String>>(); ListView list1 = getListView(); list1.setAdapter(getListAdapter()); list1.setOnItemClickListener(new OnItemClickListener() { @Override public void onItemClick(AdapterView<?> adapterView, View view, int pos, long l) { selected_student =(HashMap<String, String>) studentList.get(pos); //member of your activity. delete =(Button)view.findViewById(R.id.DeleteStudent); cl=selected_student.get(TAG_StudentID); Toast.makeText(getBaseContext(),cl,Toast.LENGTH_LONG).show(); delete.setOnClickListener(new View.OnClickListener() { public void onClick(View v) { Log.d("id: ",cl); Toast.makeText(getBaseContext(),cl,Toast.LENGTH_LONG).show(); } }); } }); new LoadAllstudent().execute(); } /** * Background Async Task to Load all student by making HTTP Request * */ class LoadAllstudent extends AsyncTask<String, String, String> { /** * Before starting background thread Show Progress Dialog * */ @Override protected void onPreExecute() { super.onPreExecute(); pDialog = new ProgressDialog(ManageSection.this); pDialog.setMessage("Loading student. Please wait..."); pDialog.setIndeterminate(false); } /** * getting All student from u r l * */ @Override protected String doInBackground(String... args) { // Building Parameters List<NameValuePair> params = new ArrayList<NameValuePair>(); // getting JSON string from URL JSONObject json = jParser.makeHttpRequest(url_all_student, "GET", params); // Check your log cat for JSON response Log.d("All student : ", json.toString()); try { // Checking for SUCCESS TAG int success = json.getInt(TAG_SUCCESS); if (success == 1) { // student found // Getting Array of course student = json.getJSONArray(TAG_student); // looping through All courses for (int i = 0; i < student.length(); i++)//course JSONArray { JSONObject c = student.getJSONObject(i); // read first // Storing each json item in variable String StudentID = c.getString(TAG_StudentID); String StudentNo = c.getString(TAG_StudentNo); String FullName = c.getString(TAG_FullName); // String Avatar = c.getString(TAG_Avatar); // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); // adding each child node to HashMap key => value map.put(TAG_StudentID, StudentID); map.put(TAG_StudentNo, StudentNo); map.put(TAG_FullName, FullName); // adding HashList to ArrayList studentList.add(map); } } else { x=false; } } catch (JSONException e) { e.printStackTrace(); } return null; } /** * After completing background task Dismiss the progress dialog * **/ protected void onPostExecute(String file_url) { // dismiss the dialog after getting all products pDialog.dismiss(); if (x==false) Toast.makeText(getBaseContext(),"no student" ,Toast.LENGTH_LONG).show(); ListAdapter adapter = new SimpleAdapter( ManageSection.this, studentList, R.layout.list_student, new String[] { TAG_StudentID, TAG_StudentNo,TAG_FullName}, new int[] { R.id.StudentID, R.id.StudentNo,R.id.FullName}); setListAdapter(adapter); // Updating parsed JSON data into ListView } } } So what do you think, why doesn't the delete button work? There is no error in my log cat. What is the alternative way ?.. what should I do ?

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • How are DX and DY coordinates calculated in flash?

    - by Meganlee1984
    I'm trying to update a clients site and the original developer left almost no instructions. The code is all updated through XML. Here is a sample of the code enter code here<FOLDER NAME="COMMERCIAL"> <GALLERY NAME="LOCANDA VERDE: New York"> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda1.jpg" DX="60" DY="40" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="300" CAPTION="Some photo" WIDTH="450" SRC="locanda2.jpg" DX="160" DY="80" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda3.jpg" DX="80" DY="260" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda4.jpg" DX="120" DY="60" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="393" CAPTION="Some photo" WIDTH="500" SRC="locanda5.jpg" DX="180" DY="100" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="433" SRC="locanda6.jpg" DX="60" DY="140" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda7.jpg" DX="100" DY="200" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> </GALLERY>`enter code here It relates to this page: http://meyerdavis.com/ Click Commercial Click Laconda Verde New York. The xml file pulls a jpg from 2 places, one is a thumb nail that are all 60 x 60 and then one is the bigger sized image. The issue that I'm having is that I can't figure out how the DX and DY coordinates are generated for each item. Any help would be much appreciated. ` Edit: Here's the code from the comment below. platformblock.expandspeed = 0.02; platformblock.h = 450 - platformblock.dy1; //platformblock.h = 402; platformblock.dy2 = 0; platformblock.onResize(); /**/ platformblock.onEnterFrame = function() { this.dy1 += (48 - this.dy1)*this.expandspeed; this.h = 450 - this.dy1; if(this.expandspeed<0.3) { this.expandspeed += 0.02; } if(Math.abs(this.dy1-48)<0.2) { this.dy1 = 48; } if(this.platform._height==402 && this.dy1==48){ this.h = null; this.onResize(); this.onEnterFrame = null; } } platformblock._resizeto(800, 402, _root.play, _root, 0.08); titleblockcontainer.play(); /**/ stop();

    Read the article

  • How to invoke a delegate with a null parameter?

    - by Rodney Burton
    I get a null exception if I try to pass a null parameter to a delegate during an invoke. Here's what the code looks like: public void RequestPhoto() { WCF.Service.BeginGetUserPhoto(Contact.UserID, new AsyncCallback(RequestPhotoCB), null); } public void RequestPhotoCB(IAsyncResult result) { var photo = WCF.Service.EndGetUserPhoto(result); UpdatePhoto(photo); } public delegate void UpdatePhotoDelegate(Binary photo); public void UpdatePhoto(Binary photo) { if (InvokeRequired) { var d = new UpdatePhotoDelegate(UpdatePhoto); Invoke(d, new object[] { photo }); } else { var ms = new MemoryStream(photo.ToArray()); var bmp = new Bitmap(ms); pbPhoto.BackgroundImage = bmp; } } The problem is with the line: Invoke(d, new object[] { photo }); If the variable "photo" is null. What is the correct way to pass a null parameter during an invoke? Thanks!

    Read the article

  • MySQL Trigger with dynamic table name

    - by Thomas
    I've look around a bit and can't quite find an answer to my problem: I want a trigger to execute after an insert on a table and to take that data that is being inserted and do two things Create a new table from the client id and partner id Insert the 'data' that just was inserted into the new table I am fairly new to the Stored procedures and triggers so I came up with this but am having difficulty debugging it: delimiter $$ CREATE TRIGGER trg_creas_insert BEFORE INSERT ON tracking.creas for each row BEGIN DECLARE @tableName varchar(40); DECLARE @createStmnt mediumtext; SET @tableName = concat('crea_','_', NEW.idClient_crea,'_',NEW.idPartenaire_crea); SET @createStmnt = concat('CREATE TABLE IF NOT EXISTS', @tableName, '( `data_crea` mediumtext NOT NULL ) ENGINE=MyISAM AUTO_INCREMENT=29483330 DEFAULT CHARSET=utf8 PACK_KEYS=0'); PREPARE stmt FROM @createStmnt; EXECUTE stmt; INSERT INTO @tableName (data_crea) values (NEW.data_crea); END$$ delimiter ; Thoughts?

    Read the article

  • How do I get the Jetty 6 FileServerXml example to work?

    - by Norm
    I have followed along with the Tutorial and the examples. Yet I always get this error when I copy and paste the code: Exception in thread "main" java.lang.NullPointerException at net.test.FileServerXml.main(FileServerXml.java:13) In Eclipse I have the directory structured as such: package net.test -FileServerXml.java -fileserver.xml -index.html FileServerXml.java package net.test; import org.mortbay.jetty.Server; import org.mortbay.resource.Resource; import org.mortbay.xml.XmlConfiguration; public class FileServerXml { public static void main(String[] args) throws Exception { Resource fileserver_xml = Resource.newSystemResource("fileserver.xml"); XmlConfiguration configuration = new XmlConfiguration(fileserver_xml.getInputStream()); Server server = (Server)configuration.configure(); server.start(); server.join(); } } ` fileserver.xml `<?xml version="1.0"?> <Call name="addConnector"> <Arg> <New class="org.eclipse.jetty.server.nio.SelectChannelConnector"> <Set name="port">8080</Set> </New> </Arg> </Call> <Set name="handler"> <New class="org.eclipse.jetty.server.handler.HandlerList"> <Set name="handlers"> <Array type="org.eclipse.jetty.server.Handler"> <Item> <New class="org.eclipse.jetty.server.handler.ResourceHandler"> <Set name="directoriesListed">true</Set> <Set name="welcomeFiles"> <Array type="String"><Item>index.html</Item></Array> </Set> <Set name="resourceBase">.</Set> </New> </Item> <Item> <New class="org.eclipse.jetty.server.handler.DefaultHandler"> </New> </Item> </Array> </Set> </New> </Set> ` Thanks for your input. Norm

    Read the article

  • how to put jcheckbox to table cell?

    - by joseph
    Hello, I cannot put jChceckBox to jTable cell. More likely I can put checkBox to table, but when I run module with that table, the cell where should be checkBox shows text "true" or "false". The behaviors of that cell are the same like checkbox, but it shows text value instead of checkbox. Here is the code. DefaultTableModel dm = new DefaultTableModel(); dm.setDataVector(new Object[][]{{"dd", "Edit", "Delete"}, {"dd","Edit", "Delete"}}, new Object[]{"Include","Component", "Ekvi"}); jTable1 = new javax.swing.JTable(); jTable1.setModel(dm); JCheckBox chBox=new JCheckBox(); jTable1.getColumn("Include").setCellEditor(new DefaultCellEditor(chBox)); jScrollPane1.setViewportView(jTable1);

    Read the article

< Previous Page | 384 385 386 387 388 389 390 391 392 393 394 395  | Next Page >