Search Results

Search found 10005 results on 401 pages for 'regex trouble'.

Page 389/401 | < Previous Page | 385 386 387 388 389 390 391 392 393 394 395 396  | Next Page >

  • OpenGL-ES Texture Mapping. Texture is reversed?

    - by Feet
    I am trying to get my head around Texture mapping, I thought I had it the other day after asking this. However, I am having some trouble with my texture coordinates being flipped from what I am expecting. I am loading my texture like so int[] textures = new int[1]; gl.glGenTextures(1, textures, 0); _textureID = textures[0]; gl.glBindTexture(GL10.GL_TEXTURE_2D, _textureID); Bitmap bmp = BitmapFactory.decodeResource( _context.getResources(), R.drawable.die_1); GLUtils.texImage2D(GL10.GL_TEXTURE_2D, 0, bmp, 0); gl.glTexParameterx(GL10.GL_TEXTURE_2D, GL10.GL_TEXTURE_MIN_FILTER, GL10.GL_LINEAR); gl.glTexParameterx(GL10.GL_TEXTURE_2D, GL10.GL_TEXTURE_MAG_FILTER, GL10.GL_LINEAR); bmp.recycle(); My cube is this float vertices[] = { // Front face -width, -height, depth, // 0 width, -height, depth, // 1 width, height, depth, // 2 -width, height, depth, // 3 // Back Face width, -height, -depth, // 4 -width, -height, -depth, // 5 -width, height, -depth, // 6 width, height, -depth, // 7 // Left face -width, -height, -depth, // 8 -width, -height, depth, // 9 -width, height, depth, // 10 -width, height, -depth, // 11 // Right face width, -height, depth, // 12 width, -height, -depth, // 13 width, height, -depth, // 14 width, height, depth, // 15 // Top face -width, height, depth, // 16 width, height, depth, // 17 width, height, -depth, // 18 -width, height, -depth, // 19 // Bottom face -width, -height, -depth, // 20 width, -height, -depth, // 21 width, -height, depth, // 22 -width, -height, depth, // 23 }; short indices[] = { // Front 0,1,2, 0,2,3, // Back 4,5,6, 4,6,7, // Left 8,9,10, 8,10,11, // Right 12,13,14, 12,14,15, // Top 16,17,18, 16,18,19, // Bottom 20,21,22, 20,22,23, }; float texCoords[] = { // Front face textured only, for simplicity 0.0f, 1.0f, 1.0f, 1.0f, 0.0f, 0.0f, 1.0f, 0.0f}; And it is drawn like so // Counter-clockwise winding. gl.glFrontFace(GL10.GL_CCW); // Enable face culling. gl.glEnable(GL10.GL_CULL_FACE); // What faces to remove with the face culling. gl.glCullFace(GL10.GL_BACK); // Enabled the vertices buffer for writing and to be used during // rendering. gl.glEnableClientState(GL10.GL_VERTEX_ARRAY); // Specifies the location and data format of an array of vertex // coordinates to use when rendering. gl.glVertexPointer(3, GL10.GL_FLOAT, 0, verticesBuffer); if (normalsBuffer != null) { // Enabled the normal buffer for writing and to be used during rendering. gl.glEnableClientState(GL10.GL_NORMAL_ARRAY); // Specifies the location and data format of an array of normals to use when rendering. gl.glNormalPointer(GL10.GL_FLOAT, 0, normalsBuffer); } // Set flat color gl.glColor4f(rgba[0], rgba[1], rgba[2], rgba[3]); // Smooth color if ( colorBuffer != null ) { // Enable the color array buffer to be used during rendering. gl.glEnableClientState(GL10.GL_COLOR_ARRAY); // Point out the where the color buffer is. gl.glColorPointer(4, GL10.GL_FLOAT, 0, colorBuffer); } // Use textures? if ( textureBuffer != null) { gl.glEnableClientState(GL10.GL_TEXTURE_COORD_ARRAY); gl.glEnable(GL10.GL_TEXTURE_2D); gl.glTexCoordPointer(2, GL10.GL_FLOAT, 0, textureBuffer); } // Translation and rotation before drawing gl.glTranslatef(x, y, z); gl.glRotatef(rx, 1, 0, 0); gl.glRotatef(ry, 0, 1, 0); gl.glRotatef(rz, 0, 0, 1); gl.glDrawElements(GL10.GL_TRIANGLES, numOfIndices, GL10.GL_UNSIGNED_SHORT, indicesBuffer); // Disable the vertices buffer. gl.glDisableClientState(GL10.GL_VERTEX_ARRAY); gl.glDisableClientState(GL10.GL_COLOR_ARRAY); gl.glDisableClientState(GL10.GL_NORMAL_ARRAY); gl.glDisableClientState(GL10.GL_TEXTURE_COORD_ARRAY); // Disable face culling. gl.glDisable(GL10.GL_CULL_FACE); However my front face looks like this I also add, I haven't got any normals set, are textures affected by normals? float texCoords[] = { // Front 1.0f, 1.0f, 0.0f, 1.0f, 0.0f, 0.0f, 1.0f, 0.0f} It seems as if the texture is being flipped, so the coordinates don't match up properly?

    Read the article

  • Representing game states in Tic Tac Toe

    - by dacman
    The goal of the assignment that I'm currently working on for my Data Structures class is to create a of Quantum Tic Tac Toe with an AI that plays to win. Currently, I'm having a bit of trouble finding the most efficient way to represent states. Overview of current Structure: AbstractGame Has and manages AbstractPlayers (game.nextPlayer() returns next player by int ID) Has and intializes AbstractBoard at the beginning of the game Has a GameTree (Complete if called in initialization, incomplete otherwise) AbstractBoard Has a State, a Dimension, and a Parent Game Is a mediator between Player and State, (Translates States from collections of rows to a Point representation Is a StateConsumer AbstractPlayer Is a State Producer Has a ConcreteEvaluationStrategy to evaluate the current board StateTransveralPool Precomputes possible transversals of "3-states". Stores them in a HashMap, where the Set contains nextStates for a given "3-state" State Contains 3 Sets -- a Set of X-Moves, O-Moves, and the Board Each Integer in the set is a Row. These Integer values can be used to get the next row-state from the StateTransversalPool SO, the principle is Each row can be represented by the binary numbers 000-111, where 0 implies an open space and 1 implies a closed space. So, for an incomplete TTT board: From the Set<Integer> board perspective: X_X R1 might be: 101 OO_ R2 might be: 110 X_X R3 might be: 101, where 1 is an open space, and 0 is a closed space From the Set<Integer> xMoves perspective: X_X R1 might be: 101 OO_ R2 might be: 000 X_X R3 might be: 101, where 1 is an X and 0 is not From the Set<Integer> oMoves perspective: X_X R1 might be: 000 OO_ R2 might be: 110 X_X R3 might be: 000, where 1 is an O and 0 is not Then we see that x{R1,R2,R3} & o{R1,R2,R3} = board{R1,R2,R3} The problem is quickly generating next states for the GameTree. If I have player Max (x) with board{R1,R2,R3}, then getting the next row-states for R1, R2, and R3 is simple.. Set<Integer> R1nextStates = StateTransversalPool.get(R1); The problem is that I have to combine each one of those states with R1 and R2. Is there a better data structure besides Set that I could use? Is there a more efficient approach in general? I've also found Point<-State mediation cumbersome. Is there another approach that I could try there? Thanks! Here is the code for my ConcretePlayer class. It might help explain how players produce new states via moves, using the StateProducer (which might need to become StateFactory or StateBuilder). public class ConcretePlayerGeneric extends AbstractPlayer { @Override public BinaryState makeMove() { // Given a move and the current state, produce a new state Point playerMove = super.strategy.evaluate(this); BinaryState currentState = super.getInGame().getBoard().getState(); return StateProducer.getState(this, playerMove, currentState); } } EDIT: I'm starting with normal TTT and moving to Quantum TTT. Given the framework, it should be as simple as creating several new Concrete classes and tweaking some things.

    Read the article

  • Wrong background colors in Swing ListCellRenderer

    - by Johannes Rössel
    I'm currently trying to write a custom ListCellRenderer for a JList. Unfortunately, nearly all examples simply use DefaultListCellRenderer as a JLabel and be done with it; I needed a JPanel, however (since I need to display a little more info than just an icon and one line of text). Now I have a problem with the background colors, specifically with the Nimbus PLAF. Seemingly the background color I get from list.getBackground() is white, but paints as a shade of gray (or blueish gray). Outputting the color I get yields the following: Background color: DerivedColor(color=255,255,255 parent=nimbusLightBackground offsets=0.0,0.0,0.0,0 pColor=255,255,255 However, as can be seen, this isn't what gets painted. It obviously works fine for the selected item. Currently I even have every component I put into the JPanel the cell renderer returns set to opaque and with the correct foreground and background colors—to no avail. Any ideas what I'm doing wrong here? ETA: Example code which hopefully runs. public class ParameterListCellRenderer implements ListCellRenderer { @Override public Component getListCellRendererComponent(JList list, Object value, int index, boolean isSelected, boolean cellHasFocus) { // some values we need Border border = null; Color foreground, background; if (isSelected) { background = list.getSelectionBackground(); foreground = list.getSelectionForeground(); } else { background = list.getBackground(); foreground = list.getForeground(); } if (cellHasFocus) { if (isSelected) { border = UIManager.getBorder("List.focusSelectedCellHighlightBorder"); } if (border == null) { border = UIManager.getBorder("List.focusCellHighlightBorder"); } } else { border = UIManager.getBorder("List.cellNoFocusBorder"); } System.out.println("Background color: " + background.toString()); JPanel outerPanel = new JPanel(new BorderLayout()); setProperties(outerPanel, foreground, background); outerPanel.setBorder(border); JLabel nameLabel = new JLabel("Factory name here"); setProperties(nameLabel, foreground, background); outerPanel.add(nameLabel, BorderLayout.PAGE_START); Box innerPanel = new Box(BoxLayout.PAGE_AXIS); setProperties(innerPanel, foreground, background); innerPanel.setAlignmentX(Box.LEFT_ALIGNMENT); innerPanel.setBorder(BorderFactory.createEmptyBorder(0, 10, 0, 0)); JLabel label = new JLabel("param: value"); label.setFont(label.getFont().deriveFont( AffineTransform.getScaleInstance(0.95, 0.95))); setProperties(label, foreground, background); innerPanel.add(label); outerPanel.add(innerPanel, BorderLayout.CENTER); return outerPanel; } private void setProperties(JComponent component, Color foreground, Color background) { component.setOpaque(true); component.setForeground(foreground); component.setBackground(background); } } The weird thing is, if I do if (isSelected) { background = new Color(list.getSelectionBackground().getRGB()); foreground = new Color(list.getSelectionForeground().getRGB()); } else { background = new Color(list.getBackground().getRGB()); foreground = new Color(list.getForeground().getRGB()); } it magically works. So maybe the DerivedColor with nimbusLightBackground I'm getting there may have trouble?

    Read the article

  • DoubleBuffering in Java

    - by DDP
    Hello there, I'm having some trouble implementing DoubleBuffer into my program. Before you faint from the wall of text, you should know that a lot of it is there just in case you need to know. The actual place where I think I'm having problems is in one method. I've recently looked up a tutorial on the gpwiki about double buffering, and decided to try and implement the code they had into the code I have that I'm trying to implement doublebuffer in. I get the following error: "java.lang.IllegalStateException: Component must have a valid peer". I don't know if it makes any difference if you know it or not, but the following is the code with the main method. This is just a Frame that displays the ChronosDisplay class inside it. I omitted irrelevant code with "..." public class CDM extends JFrame { public CDM(String str) { super("CD:M - "+str); try { ... ChronosDisplay theGame = new ChronosDisplay(str); ((Component)theGame).setFocusable(true); add(theGame); } catch(Exception e) { System.out.println("CDM ERROR: " +e); } } public static void main( String args[] ) { CDM run = new CDM("DP_Mini"); } } Here is the code where I think the problem resides (I think the problem is in the paint() method). This class is displayed in the CDM class public class ChronosDisplay extends Canvas implements Runnable { String mapName; public ChronosDisplay (String str) { mapName = str; new Thread(this).start(); setVisible(true); createBufferStrategy(2); } public void paint( Graphics window ) { BufferStrategy b = getBufferStrategy(); Graphics g = null; window.setColor(Color.white); try { g = b.getDrawGraphics(); paintMap(g); paintUnits(g); paintBullets(g); } finally { g.dispose(); } b.show(); Toolkit.getDefaultToolkit().sync(); } public void paintMap( Graphics window ) { TowerMap m = new TowerMap(); try { m = new TowerMap(mapName); for(int x=0; x<m.getRows()*50; x+=50) { for(int y = 0; y<m.getCols()*50; y+=50) { int tileType = m.getLocation(x/50,y/50); Image img; if(tileType == 0) { Tile0 t = new Tile0(x,y); t.draw(window); } ...// More similar if statements for other integers } catch(Exception e) ... } ...// Additional methods not shown here public void run() { try { while(true) { Thread.currentThread().sleep(20); repaint(); } } catch(Exception e) ... } } If you're curious (I doubt it matters), the draw() method in the Tile0 class is: public void draw( Graphics window ) { window.drawImage(img,getX(),getY(),50,50,null); } Any pointers, tips, or solutions are greatly appreciated. Thanks for your time! :D

    Read the article

  • Receiving POST data in ASP.NET

    - by grast
    Hi, I want to use ASP for code generation in a C# desktop application. To achieve this, I set up a simple host (derived from System.MarshalByRefObject) that processes a System.Web.Hosting.SimpleWorkerRequest via HttpRuntime.ProcessRequest. This processes the ASPX script specified by the incoming request (using System.Net.HttpListener to wait for requests). The client-part is represented by a System.ComponentModel.BackgroundWorker that builds the System.Net.HttpWebRequest and receives the response from the server. A simplified version of my client-part-code looks like this: private void SendRequest(object sender, DoWorkEventArgs e) { // create request with GET parameter var uri = "http://localhost:9876/test.aspx?getTest=321"; var request = (HttpWebRequest)WebRequest.Create(uri); // append POST parameter request.Method = "POST"; request.ContentType = "application/x-www-form-urlencoded"; var postData = Encoding.Default.GetBytes("postTest=654"); var postDataStream = request.GetRequestStream(); postDataStream.Write(postData, 0, postData.Length); // send request, wait for response and store/print content using (var response = (HttpWebResponse)request.GetResponse()) { using (var reader = new StreamReader(response.GetResponseStream(), Encoding.UTF8)) { _processsedContent = reader.ReadToEnd(); Debug.Print(_processsedContent); } } } My server-part-code looks like this (without exception-handling etc.): public void ProcessRequests() { // HttpListener at http://localhost:9876/ var listener = SetupListener(); // SimpleHost created by ApplicationHost.CreateApplicationHost var host = SetupHost(); while (_running) { var context = listener.GetContext(); using (var writer = new StreamWriter(context.Response.OutputStream)) { // process ASP script and send response back to client host.ProcessRequest(GetPage(context), GetQuery(context), writer); } context.Response.Close(); } } So far all this works fine as long as I just use GET parameters. But when it comes to receiving POST data in my ASPX script I run into trouble. For testing I use the following script: // GET parameters are working: var getTest = Request.QueryString["getTest"]; Response.Write("getTest: " + getTest); // prints "getTest: 321" // don't know how to access POST parameters: var postTest1 = Request.Form["postTest"]; // Request.Form is empty?! Response.Write("postTest1: " + postTest1); // so this prints "postTest1: " var postTest2 = Request.Params["postTest"]; // Request.Params is empty?! Response.Write("postTest2: " + postTest2); // so this prints "postTest2: " It seems that the System.Web.HttpRequest object I'm dealing with in ASP does not contain any information about my POST parameter "postTest". I inspected it in debug mode and none of the members did contain neither the parameter-name "postTest" nor the parameter-value "654". I also tried the BinaryRead method of Request, but unfortunately it is empty. This corresponds to Request.InputStream==null and Request.ContentLength==0. And to make things really confusing the Request.HttpMethod member is set to "GET"?! To isolate the problem I tested the code by using a PHP script instead of the ASPX script. This is very simple: print_r($_GET); // prints all GET variables print_r($_POST); // prints all POST variables And the result is: Array ( [getTest] = 321 ) Array ( [postTest] = 654 ) So with the PHP script it works, I can access the POST data. Why does the ASPX script don't? What am I doing wrong? Is there a special accessor or method in the Response object? Can anyone give a hint or even know how to solve this? Thanks in advance.

    Read the article

  • How can I implement the Gale-Shapley stable marriage algorithm in Perl?

    - by srk
    Problem : We have equal number of men and women.each men has a preference score toward each woman. So do the woman for each man. each of the men and women have certain interests. Based on the interest we calculate the preference scores. So initially we have an input in a file having x columns. First column is the person(men/woman) id. id are nothing but 0.. n numbers.(first half are men and next half woman) the remaining x-1 columns will have the interests. these are integers too. now using this n by x-1 matrix... we have come up with a n by n/2 matrix. the new matrix has all men and woman as their rows and scores for opposite sex in columns. We have to sort the scores in descending order, also we need to know the id of person related to the scores after sorting. So here i wanted to use hash table. once we get the scores we need to make up pairs.. for which we need to follow some rules. My trouble is with the second matrix of n by n/2 that needs to give information of which man/woman has how much preference on a woman/man. I need these scores sorted so that i know who is the first preferred woman/man, 2nd preferred and so on for a man/woman. I hope to get good suggestions on the data structures i use.. I prefer php or perl. Thank you in advance Hey guys this is not an home work. This a little modified version of stable marriage algorithm. I have working solution. I am only working on optimizing my code. more info: It is very similar to stable marriage problem but here we need to calculate the scores based on the interests they share. So i have implemented it as the way you see in the wiki page http://en.wikipedia.org/wiki/Stable_marriage_problem. my problem is not solving the problem. i solved it and can run it. I am just trying to have a better solution. so i am asking suggestions on the type of data structure to use. Conceptually I tried using an array of hashes. where the array index give the person id and the hash in it gives the id's <= score's in sorted manner. I initially start with an array of hashes. now i sort the hashes on values, but i could not store the sorted hashes back in an array.So just stored the keys after sorting and used these to get the values from my initial unsorted hashes. Can we store the hashes after sorting ? Can you suggest a better structure ?

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • A RenderTargetView cannot be created from a NULL Resource

    - by numerical25
    I am trying to create my render target view but I get this error from direct X A RenderTargetView cannot be created from a NULL Resource To my knowledge it seems that I must fill the rendertarget pointer with data before passing it. But I am having trouble figure out how. Below is my declaration and implementation declaration #pragma once #include "stdafx.h" #include "resource.h" #include "d3d10.h" #include "d3dx10.h" #include "dinput.h" #define MAX_LOADSTRING 100 class RenderEngine { protected: RECT m_screenRect; //direct3d Members ID3D10Device *m_pDevice; // The IDirect3DDevice10 // interface ID3D10Texture2D *m_pBackBuffer; // Pointer to the back buffer ID3D10RenderTargetView *m_pRenderTargetView; // Pointer to render target view IDXGISwapChain *m_pSwapChain; // Pointer to the swap chain RECT m_rcScreenRect; // The dimensions of the screen ID3DX10Font *m_pFont; // The font used for rendering text // Sprites used to hold font characters ID3DX10Sprite *m_pFontSprite; ATOM RegisterEngineClass(); void Present(); public: static HINSTANCE m_hInst; HWND m_hWnd; int m_nCmdShow; TCHAR m_szTitle[MAX_LOADSTRING]; // The title bar text TCHAR m_szWindowClass[MAX_LOADSTRING]; // the main window class name void DrawTextString(int x, int y, D3DXCOLOR color, const TCHAR *strOutput); //static functions static LRESULT CALLBACK WndProc(HWND hWnd, UINT message, WPARAM wParam, LPARAM lParam); static INT_PTR CALLBACK About(HWND hDlg, UINT message, WPARAM wParam, LPARAM lParam); bool InitWindow(); bool InitDirectX(); bool InitInstance(); int Run(); RenderEngine() { m_screenRect.right = 800; m_screenRect.bottom = 600; } }; my implementation bool RenderEngine::InitDirectX() { //potential error. You did not set to zero memory and you did not set the scaling property DXGI_MODE_DESC bd; bd.Width = m_screenRect.right; bd.Height = m_screenRect.bottom; bd.Format = DXGI_FORMAT_R8G8B8A8_UNORM; bd.RefreshRate.Numerator = 60; bd.RefreshRate.Denominator = 1; DXGI_SAMPLE_DESC sd; sd.Count = 1; sd.Quality = 0; DXGI_SWAP_CHAIN_DESC swapDesc; ZeroMemory(&swapDesc, sizeof(swapDesc)); swapDesc.BufferDesc = bd; swapDesc.SampleDesc = sd; swapDesc.BufferUsage = DXGI_USAGE_RENDER_TARGET_OUTPUT; swapDesc.OutputWindow = m_hWnd; swapDesc.BufferCount = 1; swapDesc.SwapEffect = DXGI_SWAP_EFFECT_DISCARD, swapDesc.Windowed = true; swapDesc.Flags = 0; HRESULT hr; hr = D3D10CreateDeviceAndSwapChain(NULL, D3D10_DRIVER_TYPE_HARDWARE, NULL, D3D10_CREATE_DEVICE_DEBUG, D3D10_SDK_VERSION , &swapDesc, &m_pSwapChain, &m_pDevice); if(FAILED(hr)) return false; // Create a render target view hr = m_pDevice->CreateRenderTargetView( m_pBackBuffer, NULL, &m_pRenderTargetView); // FAILS RIGHT HERE // if(FAILED(hr)) return false; return true; }

    Read the article

  • Cluster failover and strange gratuitous arp behavior

    - by lazerpld
    I am experiencing a strange Windows 2008R2 cluster related issue that is bothering me. I feel that I have come close as to what the issue is, but still don't fully understand what is happening. I have a two node exchange 2007 cluster running on two 2008R2 servers. The exchange cluster application works fine when running on the "primary" cluster node. The problem occurs when failing over the cluster ressource to the secondary node. When failing over the cluster to the "secondary" node, which for instance is on the same subnet as the "primary", the failover initially works ok and the cluster ressource continues to work for a couple of minutes on the new node. Which means that the recieving node does send out a gratuitous arp reply packet that updated the arp tables on the network. But after x amount of time (typically within 5 minutes time) something updates the arp-tables again because all of a sudden the cluster service does not answer to pings. So basically I start a ping to the exchange cluster address when its running on the "primary node". It works just great. I failover the cluster ressource group to the "secondary node" and I only have loss of one ping which is acceptable. The cluster ressource still answers for some time after being failed over and all of a sudden the ping starts timing out. This is telling me that the arp table initially is updated by the secondary node, but then something (which I haven't found out yet) wrongfully updates it again, probably with the primary node's MAC. Why does this happen - has anyone experienced the same problem? The cluster is NOT running NLB and the problem stops immidiately after failing over back to the primary node where there are no problems. Each node is using NIC teaming (intel) with ALB. Each node is on the same subnet and has gateway and so on entered correctly as far as I am concerned. Edit: I was wondering if it could be related to network binding order maybe? Because I have noticed that the only difference I can see from node to node is when showing the local arp table. On the "primary" node the arp table is generated on the cluster address as the source. While on the "secondary" its generated from the nodes own network card. Any input on this? Edit: Ok here is the connection layout. Cluster address: A.B.6.208/25 Exchange application address: A.B.6.212/25 Node A: 3 physical nics. Two teamed using intels teaming with the address A.B.6.210/25 called public The last one used for cluster traffic called private with 10.0.0.138/24 Node B: 3 physical nics. Two teamed using intels teaming with the address A.B.6.211/25 called public The last one used for cluster traffic called private with 10.0.0.139/24 Each node sits in a seperate datacenter connected together. End switches being cisco in DC1 and NEXUS 5000/2000 in DC2. Edit: I have been testing a little more. I have now created an empty application on the same cluster, and given it another ip address on the same subnet as the exchange application. After failing this empty application over, I see the exact same problem occuring. After one or two minutes clients on other subnets cannot ping the virtual ip of the application. But while clients on other subnets cannot, another server from another cluster on the same subnet has no trouble pinging. But if i then make another failover to the original state, then the situation is the opposite. So now clients on same subnet cannot, and on other they can. We have another cluster set up the same way and on the same subnet, with the same intel network cards, the same drivers and same teaming settings. Here we are not seeing this. So its somewhat confusing. Edit: OK done some more research. Removed the NIC teaming of the secondary node, since it didnt work anyway. After some standard problems following that, I finally managed to get it up and running again with the old NIC teaming settings on one single physical network card. Now I am not able to reproduce the problem described above. So it is somehow related to the teaming - maybe some kind of bug? Edit: Did some more failing over without being able to make it fail. So removing the NIC team looks like it was a workaround. Now I tried to reestablish the intel NIC teaming with ALB (as it was before) and i still cannot make it fail. This is annoying due to the fact that now i actually cannot pinpoint the root of the problem. Now it just seems to be some kind of MS/intel hick-up - which is hard to accept because what if the problem reoccurs in 14 days? There is a strange thing that happened though. After recreating the NIC team I was not able to rename the team to "PUBLIC" which the old team was called. So something has not been cleaned up in windows - although the server HAS been restarted! Edit: OK after restablishing the ALB teaming the error came back. So I am now going to do some thorough testing and i will get back with my observations. One thing is for sure. It is related to Intel 82575EB NICS, ALB and Gratuitous Arp.

    Read the article

  • Longest Path in Boost Graph

    - by TheTSPSolver
    Hi, Sorry if this is a very basic questions for some of you but I'm new to C++ (let alone Boost Graph Library) and couldn't figure out this problem. So far I've been able to formulate/gather code to create a graph using the code below. Now I'm trying to figure out the code to find the longest path in this graph. Can someone please help with what would the code be? I was having trouble trying to figure out if/how to traverse through each node and/or edge when trying to find the path? I have to try to return all the nodes and edges in the longest path. Any help will be greatly appreciated. P.S. does anyone know if C++ has organized documentation like Javadoc?? #include <boost/graph/dag_shortest_paths.hpp> #include <boost/graph/adjacency_list.hpp> #include <windows.h> #include <iostream> int main() { using namespace boost; typedef adjacency_list<vecS, vecS, directedS, property<vertex_distance_t, double>, property<edge_weight_t, double> > graph_t; graph_t g(6); enum verts { stationA, stationB, stationC, stationD, stationE, stationF }; char name[] = "rstuvx"; add_edge(stationA, stationB, 5000.23, g); add_edge(stationA, stationC, 3001, g); add_edge(stationA, stationD, 2098.67, g); add_edge(stationA, stationE, 3298.84, g); add_edge(stationB, stationF, 2145, g); add_edge(stationC, stationF, 4290, g); add_edge(stationD, stationF, 2672.78, g); add_edge(stationE, stationF, 11143.876, g); add_edge(stationA, stationF, 1, g); //Display all the vertices typedef property_map<graph_t, vertex_index_t>::type IndexMap; IndexMap index = get(vertex_index, g); std::cout << "vertices(g) = "; typedef graph_traits<graph_t>::vertex_iterator vertex_iter; std::pair<vertex_iter, vertex_iter> vp; for (vp = vertices(g); vp.first != vp.second; ++vp.first) std::cout << index[*vp.first] << " "; std::cout << std::endl; // ... // Display all the edges // ... std::cout << "edges(g) = " << std::endl; graph_traits<graph_t>::edge_iterator ei, ei_end; for (tie(ei, ei_end) = edges(g); ei != ei_end; ++ei) std::cout << "(" << index[source(*ei, g)] << "," << index[target(*ei, g)] << ") \n"; std::cout << std::endl; // ...

    Read the article

  • Can't seem to redirect from a ViewScoped constructor.

    - by Andrew
    I'm having trouble redirecting from a view scoped bean in the case that we don't have the required info for the page in question. The log entry in the @PostContruct is visible in the log right before a NPE relating to the view trying to render itself instead of following my redirect. Why is it ignoring the redirect? Here's my code: @ManagedBean public class WelcomeView { private String sParam; private String aParam; public WelcomeView() { super(); sParam = getURL_Param("surveyName"); aParam = getURL_Param("accountName"); project = fetchProject(sParam, aParam); } @PostConstruct public void redirectWithoutProject() { if (null == project) { try { logger.warn("NO project [" + sParam + "] for account [" + aParam + "]"); FacesContext fc = FacesContext.getCurrentInstance(); fc.getExternalContext().redirect("/errors/noSurvey.jsf"); return; } catch (Exception e) { e.printStackTrace(); } } } .... public boolean getAuthenticated() { if (project.getPasswordProtected()) { return enteredPassword.equals(project.getLoginPassword()); } else return true; } } Here's the stack trace: SEVERE: Error Rendering View[/participant/welcome.xhtml] javax.el.ELException: /templates/participant/welcome.xhtml @80,70 rendered="#{welcomeView.authenticated}": Error reading 'authenticated' on type com.MYCODE.general.controllers.participant.WelcomeView at com.sun.faces.facelets.el.TagValueExpression.getValue(TagValueExpression.java:107) at javax.faces.component.ComponentStateHelper.eval(ComponentStateHelper.java:190) at javax.faces.component.UIComponentBase.isRendered(UIComponentBase.java:416) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1607) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1616) at javax.faces.render.Renderer.encodeChildren(Renderer.java:168) at javax.faces.component.UIComponentBase.encodeChildren(UIComponentBase.java:848) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1613) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1616) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1616) at com.sun.faces.application.view.FaceletViewHandlingStrategy.renderView(FaceletViewHandlingStrategy.java:380) at com.sun.faces.application.view.MultiViewHandler.renderView(MultiViewHandler.java:126) at com.sun.faces.lifecycle.RenderResponsePhase.execute(RenderResponsePhase.java:127) at com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) at com.sun.faces.lifecycle.LifecycleImpl.render(LifecycleImpl.java:139) at javax.faces.webapp.FacesServlet.service(FacesServlet.java:313) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at com.MYCODE.general.filters.StatsFilter.doFilter(StatsFilter.java:28) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:233) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:433) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:128) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.apache.catalina.valves.AccessLogValve.invoke(AccessLogValve.java:568) at org.apache.catalina.authenticator.SingleSignOn.invoke(SingleSignOn.java:421) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:286) at org.apache.coyote.http11.Http11Processor.process(Http11Processor.java:845) at org.apache.coyote.http11.Http11Protocol$Http11ConnectionHandler.process(Http11Protocol.java:583) at org.apache.tomcat.util.net.JIoEndpoint$Worker.run(JIoEndpoint.java:447) at java.lang.Thread.run(Thread.java:637) Caused by: java.lang.NullPointerException at com.MYCODE.general.controllers.participant.WelcomeView$$M$863c205f.getAuthenticated(WelcomeView.java:127) at com.MYCODE.general.controllers.participant.WelcomeView$$A$863c205f.getAuthenticated(<generated>) at com.MYCODE.general.controllers.participant.WelcomeView.getAuthenticated(WelcomeView.java:125) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at javax.el.BeanELResolver.getValue(BeanELResolver.java:62) at javax.el.CompositeELResolver.getValue(CompositeELResolver.java:53) at com.sun.faces.el.FacesCompositeELResolver.getValue(FacesCompositeELResolver.java:72) at org.apache.el.parser.AstValue.getValue(AstValue.java:118) at org.apache.el.ValueExpressionImpl.getValue(ValueExpressionImpl.java:186) at com.sun.faces.facelets.el.TagValueExpression.getValue(TagValueExpression.java:102) ... 33 more

    Read the article

  • How to use a nested form for multiple models in one form?

    - by Magicked
    I'm struggling to come up with the proper way to design a form that will allow me to input data for two different models. The form is for an 'Incident', which has the following relationships: belongs_to :customer belongs_to :user has_one :incident_status has_many :incident_notes accepts_nested_attributes_for :incident_notes, :allow_destroy => false So an incident is assigned to a 'Customer' and a 'User', and the user is able to add 'Notes' to the incident. I'm having trouble with the notes part of the form. Here how the form is being submitted: {"commit"=>"Create", "authenticity_token"=>"ECH5Ziv7JAuzs53kt5m/njT9w39UJhfJEs2x0Ms2NA0=", "customer_id"=>"4", "incident"=>{"title"=>"Something bad", "incident_status_id"=>"2", "user_id"=>"2", "other_id"=>"AAA01-042310-001", "incident_note"=>{"note"=>"This is a note"}}} It appears to be attempting to add the incident_note as a field under 'Incident', rather than creating a new entry in the incident_note table with an incident_id foreign key linking back to the incident. Here is the 'IncidentNote' model: belongs_to :incident belongs_to :user Here is the form for 'Incident': <% form_for([@customer,@incident]) do |f| %> <%= f.error_messages %> <p> <%= f.label :other_id, "ID" %><br /> <%= f.text_field :capc_id %> </p> <p> <%= f.label :title %><br /> <%= f.text_field :title %> </p> <p> <%= label_tag 'user', 'Assign to user?' %> <%= f.select :user_id, @users.collect {|u| [u.name, u.id]} %> </p> <p> <%= f.label :incident_status, 'Status?' %> <%= f.select :incident_status_id, @statuses.collect {|s| [s.name, s.id]} %> </p> <p> <% f.fields_for :incident_note do |inote_form| %> <%= inote_form.label :note, 'Add a Note' %> <%= inote_form.text_area :note, :cols => 40, :rows => 20 %> <% end %> </p> <p> <%= f.submit "Create" %> </p> <% end %> And finally, here are the incident_controller entries for New and Create. New: def new @customer = current_user.customer @incident = Incident.new @users = @customer.users @statuses = IncidentStatus.find(:all) @incident_note = IncidentNote.new respond_to do |format| format.html # new.html.erb format.xml { render :xml => @incident } end end Create: def create @users = @customer.users @statuses = IncidentStatus.find(:all) @incident = Incident.new(params[:incident]) @incident.customer = @customer @incident_note = @incident.incident_note.build(params[:incident_note]) @incident_note.user = current_user respond_to do |format| if @incident.save flash[:notice] = 'Incident was successfully created.' format.html { redirect_to(@incident) } format.xml { render :xml => @incident, :status => :created, :location => @incident } else format.html { render :action => "new" } format.xml { render :xml => @incident.errors, :status => :unprocessable_entity } end end end I'm not really sure where to look at this point. I'm sure it's just a limitation of my current Rails skill (I don't know much). So if anyone can point me in the right direction I would be very appreciative. Please let me know if more information is needed! Thanks!

    Read the article

  • Using wget to download pdf files from a site that requires cookies to be set

    - by matt74tm
    I want to access a newspaper site and then download their epaper copies (in PDF). The site requires me to login using my email address and password and then it permits me to access those PDF URLs. I'm having trouble 'setting my session' in wget. When I login into the site from my browser, it sets two cookie values: [email protected] Password=12345 I tried: wget --post-data "[email protected]&Password=12345" http://epaper.abc.com/login.aspx However, that just downloaded the login page and saved it locally The FORM on the login page has two fields: txtUserID txtPassword and radiobuttons like this: <input id="rbtnManchester" type="radio" checked="checked" name="txtpub" value="44"> Another button: <input id="rbtnLondon" type="radio" name="txtpub" value="64"> If I post this to the login.aspx page, I get the same output wget --post-data "[email protected]&txtPassword=12345&txtpub=44" http://epaper.abc.com/login.aspx If I do: --save-cookies abc_cookies.txt it doesnt seem to have anything other than the default content. For the last if I do --debug as well it says: ... Set-Cookie: ASP.NET_SessionId=05kphcn4hjmblq45qgnjoe41; path=/; HttpOnly ... Stored cookie epaper.abc.com -1 (ANY) / <session> <insecure> [expiry none] ASP.NET_SessionId 05kphcn4hjmblq45qgnjoe41 Length: 107253 (105K) [text/html] Saving to: `login.aspx' ... Saving cookies to abc_cookies.txt. However, abc_cookies.txt shows ONLY the following: # HTTP cookie file. # Generated by Wget on 2011-08-16 08:03:05. # Edit at your own risk. (Not sure why I'm not getting any responses on SO - perhaps SU is a better forum - http://stackoverflow.com/questions/7064171/using-wget-to-download-pdf-files-from-a-site-that-requires-cookies-to-be-set) EDIT 1 C:\Temp>wget --cookies=on --keep-session-cookies --save-cookies abc_cookies.txt --post-data "txtUserID=abc%40gmail.com&txtPassword=password&txtpub=44&chkbox=checkbox&submit.x=48&submit.y=7" http://epaper.abc.com/login.aspx --debug SYSTEM_WGETRC = c:/progra~1/wget/etc/wgetrc syswgetrc = C:\Program Files (x86)\GnuWin32/etc/wgetrc DEBUG output created by Wget 1.11.4 on Windows-MinGW. --2011-08-18 08:15:59-- http://epaper.abc.com/login.aspx Resolving epaper.abc.com... seconds 0.00, 999.999.99.99 Caching epaper.abc.com => 999.999.99.99 Connecting to epaper.abc.com|999.999.99.99|:80... seconds 0.00, connected. Created socket 300. Releasing 0x00a2ae80 (new refcount 1). ---request begin--- POST /login.aspx HTTP/1.0 User-Agent: Wget/1.11.4 Accept: */* Host: epaper.abc.com Connection: Keep-Alive Content-Type: application/x-www-form-urlencoded Content-Length: 100 ---request end--- [POST data: txtUserID=abc%40gmail.com&txtPassword=password&txtpub=44&chkbox=checkbox&submit.x=48&submit.y=7] HTTP request sent, awaiting response... ---response begin--- HTTP/1.1 200 OK Connection: keep-alive Date: Thu, 18 Aug 2011 02:46:17 GMT Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET X-AspNet-Version: 2.0.50727 Set-Cookie: ASP.NET_SessionId=owcrje55yl45kgmhn43gq145; path=/; HttpOnly Cache-Control: private Content-Type: text/html; charset=utf-8 Content-Length: 107253 ---response end--- 200 OK Registered socket 300 for persistent reuse. Stored cookie epaper.abc.com -1 (ANY) / <session> <insecure> [expiry none] ASP.NET_SessionId owcrje55yl45kgmhn43gq145 Length: 107253 (105K) [text/html] Saving to: `login.aspx.1' 100%[======================================================================================================================>] 107,253 24.9K/s in 4.2s 2011-08-18 08:16:05 (24.9 KB/s) - `login.aspx.1' saved [107253/107253] Saving cookies to abc_cookies.txt. Done saving cookies. C:\Temp>wget --referer=http://epaper.abc.com/login.aspx --cookies=on --load-cookies abc_cookies.txt --keep-session-cookies --save-cookies abc_cookies.txt http://epaper.abc.com/PagePrint/16_08_2011_001.pdf --debug SYSTEM_WGETRC = c:/progra~1/wget/etc/wgetrc syswgetrc = C:\Program Files (x86)\GnuWin32/etc/wgetrc DEBUG output created by Wget 1.11.4 on Windows-MinGW. Stored cookie epaper.abc.com -1 (ANY) / <session> <insecure> [expiry none] ASP.NET_SessionId owcrje55yl45kgmhn43gq145 --2011-08-18 08:16:12-- http://epaper.abc.com/PagePrint/16_08_2011_001.pdf Resolving epaper.abc.com... seconds 0.00, 999.999.99.99 Caching epaper.abc.com => 999.999.99.99 Connecting to epaper.abc.com|999.999.99.99|:80... seconds 0.00, connected. Created socket 300. Releasing 0x00598290 (new refcount 1). ---request begin--- GET /PagePrint/16_08_2011_001.pdf HTTP/1.0 Referer: http://epaper.abc.com/login.aspx User-Agent: Wget/1.11.4 Accept: */* Host: epaper.abc.com Connection: Keep-Alive Cookie: ASP.NET_SessionId=owcrje55yl45kgmhn43gq145 ---request end--- HTTP request sent, awaiting response... ---response begin--- HTTP/1.1 200 OK Connection: keep-alive Date: Thu, 18 Aug 2011 02:46:30 GMT Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET X-AspNet-Version: 2.0.50727 content-disposition: attachement; filename=Default_logo.gif Cache-Control: private Content-Type: image/GIF Content-Length: 4568 ---response end--- 200 OK Registered socket 300 for persistent reuse. Length: 4568 (4.5K) [image/GIF] Saving to: `16_08_2011_001.pdf' 100%[======================================================================================================================>] 4,568 7.74K/s in 0.6s 2011-08-18 08:16:14 (7.74 KB/s) - `16_08_2011_001.pdf' saved [4568/4568] Saving cookies to abc_cookies.txt. Done saving cookies. Contents of abc_cookies.txt epaper.abc.com FALSE / FALSE 0 ASP.NET_SessionId owcrje55yl45kgmhn43gq145

    Read the article

  • Why does jquery leak memory so badly?

    - by Thomas Lane
    This is kind of a follow-up to a question I posted last week: http://stackoverflow.com/questions/2429056/simple-jquery-ajax-call-leaks-memory-in-ie I love the jquery syntax and all of its nice features, but I've been having trouble with a page that automatically updates table cells via ajax calls leaking memory. So I created two simple test pages for experimenting. Both pages do an ajax call every .1 seconds. After each successful ajax call, a counter is incremented and the DOM is updated. The script stops after 1000 cycles. One uses jquery for both the ajax call and to update the DOM. The other uses the Yahoo API for the ajax and does a document.getElementById(...).innerHTML to update the DOM. The jquery version leaks memory badly. Running in drip (on XP Home with IE7), it starts at 9MB and finishes at about 48MB, with memory growing linearly the whole time. If I comment out the line that updates the DOM, it still finishes at 32MB, suggesting that even simple DOM updates leak a significant amount of memory. The non-jquery version starts and finishes at about 9MB, regardless of whether it updates the DOM. Does anyone have a good explanation of what is causing jquery to leak so badly? Am I missing something obvious? Is there a circular reference that I'm not aware of? Or does jquery just have some serious memory issues? Here is the source for the leaky (jquery) version: <html> <head> <script type="text/javascript" src="http://www.google.com/jsapi"></script> <script type="text/javascript"> google.load('jquery', '1.4.2'); </script> <script type="text/javascript"> var counter = 0; leakTest(); function leakTest() { $.ajax({ url: '/html/delme.x', type: 'GET', success: incrementCounter }); } function incrementCounter(data) { if (counter<1000) { counter++; $('#counter').text(counter); setTimeout(leakTest,100); } else $('#counter').text('finished.'); } </script> </head> <body> <div>Why is memory usage going up?</div> <div id="counter"></div> </body> </html> And here is the non-leaky version: <html> <head> <script type="text/javascript" src="http://yui.yahooapis.com/2.8.0r4/build/yahoo/yahoo-min.js"></script> <script type="text/javascript" src="http://yui.yahooapis.com/2.8.0r4/build/event/event-min.js"></script> <script type="text/javascript" src="http://yui.yahooapis.com/2.8.0r4/build/connection/connection_core-min.js"></script> <script type="text/javascript"> var counter = 0; leakTest(); function leakTest() { YAHOO.util.Connect.asyncRequest('GET', '/html/delme.x', {success:incrementCounter}); } function incrementCounter(o) { if (counter<1000) { counter++; document.getElementById('counter').innerHTML = counter; setTimeout(leakTest,100); } else document.getElementById('counter').innerHTML = 'finished.' } </script> </head> <body> <div>Memory usage is stable, right?</div> <div id="counter"></div> </body> </html>

    Read the article

  • Multidimensional array problem in VHDL?

    - by Nektarios
    I'm trying to use a multidimensional array in VHDL and I'm having a lot of trouble getting it to work properly. My issue is that I've got an array of 17, of 16 vectors, of a given size. What I want to do is create 17 registers that are array of 16 * std_logic_vector of 32 bits (which = my b, 512). So, I'm trying to pass in something to input and output on the register instantiation that tells the compiler/synthesizer that I want to pass in something that is 512 bits worth... Similar to in C if I had: int var[COLS][ROWS][ELEMENTS]; memcpy(&var[3].. // I'm talking about 3rd COL here, passing in memory that is ROWS*ELEMENTS long (My actual declaration is here:) type partial_pipeline_registers_type is array (0 to 16, 0 to 15) of std_logic_vector(iw - 1 downto 0); signal h_blk_pipelined_input : partial_pipeline_registers_type; I tried simply using h_blk_pipelined_input(0) .. up to (16) but this doesn't work. I get the following error, which makes me see that I need to double index in to the array: ERROR:HDLParsers:821 - (at the register) Wrong index type for h_blk_pipelined_input. So then I tried what's below, and I get this error: ERROR:HDLParsers:164 - (at the register code). parse error, unexpected TO, expecting COMMA or CLOSEPAR instantiate_h_pipelined_reg : regn generic map ( N=> b, init => bzeros ) port map ( clk => clk , rst => '0', en => '1', input => h_blk_pipelined_input((i - 1), 0 to 15), output=> h_blk_pipelined_input((i), 0 to 15)); -- Changing 0 to 15 to (0 to 15) has no effect... I'm using XST, and from their documentation (http://www.xilinx.com/itp/xilinx6/books/data/docs/xst/xst0067_9.html), the above should have worked: ...declaration: subtype MATRIX15 is array(4 downto 0, 2 downto 0) of STD_LOGIC_VECTOR (7 downto 0); A multi-dimensional array signal or variable can be completely used: Just a slice of one row can be specified: MATRIX15 (4,4 downto 1) <= TAB_B (3 downto 0); One alternative is that I can create more registers that are 16 times smaller, and instead of trying to do all '0 to 15' at once, I would just do that 15 additional times. However, I think this may lead to inefficiency in synthesis and I don't feel like this is the right solution. EDIT: Tried what Ben said, instantiate_h_m_qa_pipeline_registers: for i in 1 to 16 generate instantiate_h_pipelined_reg : regn generic map ( N=> b, init => bzeros ) port map ( clk => clk , rst => '0', en => '1', input => h_blk_pipelined_input(i - 1), output=> h_blk_pipelined_input(i)); end generate instantiate_h_m_qa_pipeline_registers; The signals are now defined as: type std_logic_block is array (0 to 15) of std_logic_vector(iw - 1 downto 0) ; type partial_pipeline_registers_type is array (0 to 16) of std_logic_block; signal h_blk_pipelined_input : partial_pipeline_registers_type; And the error I get from XST is: ERROR:HDLParsers:800 - ((where the register part is)) Type of input is incompatible with type of h_blk_pipelined_input. I'm able to do everything I was able to do before, using ()() syntax instead of ( , ) so I haven't lost anything going this way, but it still doesn't resolve my problem.

    Read the article

  • Prevent lazy loading in nHibernate

    - by Ciaran
    Hi, I'm storing some blobs in my database, so I have a Document table and a DocumentContent table. Document contains a filename, description etc and has a DocumentContent property. I have a Silverlight client, so I don't want to load up and send the DocumentContent to the client unless I explicity ask for it, but I'm having trouble doing this. I've read the blog post by Davy Brion. I have tried placing lazy=false in my config and removing the virtual access modifier but have had no luck with it as yet. Every time I do a Session.Get(id), the DocumentContent is retrieved via an outer join. I only want this property to be populated when I explicity join onto this table and ask for it. Any help is appreciated. My NHibernate mapping is as follows: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="Jrm.Model" namespace="Jrm.Model"> <class name="JrmDocument" lazy="false"> <id name="JrmDocumentID"> <generator class="native" /> </id> <property name="FileName"/> <property name="Description"/> <many-to-one name="DocumentContent" class="JrmDocumentContent" unique="true" column="JrmDocumentContentID" lazy="false"/> </class> <class name="JrmDocumentContent" lazy="false"> <id name="JrmDocumentContentID"> <generator class="native" /> </id> <property name="Content" type="BinaryBlob" lazy="false"> <column name="FileBytes" sql-type="varbinary(max)"/> </property> </class> </hibernate-mapping> and my classes are: [DataContract] public class JrmDocument : ModelBase { private int jrmDocumentID; private JrmDocumentContent documentContent; private long maxFileSize; private string fileName; private string description; public JrmDocument() { } public JrmDocument(string fileName, long maxFileSize) { DocumentContent = new JrmDocumentContent(File.ReadAllBytes(fileName)); FileName = new FileInfo(fileName).Name; } [DataMember] public virtual int JrmDocumentID { get { return jrmDocumentID; } set { jrmDocumentID = value; OnPropertyChanged("JrmDocumentID"); } } [DataMember] public JrmDocumentContent DocumentContent { get { return documentContent; } set { documentContent = value; OnPropertyChanged("DocumentContent"); } } [DataMember] public virtual long MaxFileSize { get { return maxFileSize; } set { maxFileSize = value; OnPropertyChanged("MaxFileSize"); } } [DataMember] public virtual string FileName { get { return fileName; } set { fileName = value; OnPropertyChanged("FileName"); } } [DataMember] public virtual string Description { get { return description; } set { description = value; OnPropertyChanged("Description"); } } } [DataContract] public class JrmDocumentContent : ModelBase { private int jrmDocumentContentID; private byte[] content; public JrmDocumentContent() { } public JrmDocumentContent(byte[] bytes) { Content = bytes; } [DataMember] public int JrmDocumentContentID { get { return jrmDocumentContentID; } set { jrmDocumentContentID = value; OnPropertyChanged("JrmDocumentContentID"); } } [DataMember] public byte[] Content { get { return content; } set { content = value; OnPropertyChanged("Content"); } } }

    Read the article

  • Help with infrequent segmentation fault in accessing boost::unordered_multimap or struct

    - by Sarah
    I'm having trouble debugging a segmentation fault. I'd appreciate tips on how to go about narrowing in on the problem. The error appears when an iterator tries to access an element of a struct Infection, defined as: struct Infection { public: explicit Infection( double it, double rt ) : infT( it ), recT( rt ) {} double infT; // infection start time double recT; // scheduled recovery time }; These structs are kept in a special structure, InfectionMap: typedef boost::unordered_multimap< int, Infection > InfectionMap; Every member of class Host has an InfectionMap carriage. Recovery times and associated host identifiers are kept in a priority queue. When a scheduled recovery event arises in the simulation for a particular strain s in a particular host, the program searches through carriage of that host to find the Infection whose recT matches the recovery time (double recoverTime). (For reasons that aren't worth going into, it's not as expedient for me to use recT as the key to InfectionMap; the strain s is more useful, and coinfections with the same strain are possible.) assert( carriage.size() > 0 ); pair<InfectionMap::iterator,InfectionMap::iterator> ret = carriage.equal_range( s ); InfectionMap::iterator it; for ( it = ret.first; it != ret.second; it++ ) { if ( ((*it).second).recT == recoverTime ) { // produces seg fault carriage.erase( it ); } } I get a "Program received signal EXC_BAD_ACCESS, Could not access memory. Reason: KERN_INVALID_ADDRESS at address..." on the line specified above. The recoverTime is fine, and the assert(...) in the code is not tripped. As I said, this seg fault appears 'randomly' after thousands of successful recovery events. How would you go about figuring out what's going on? I'd love ideas about what could be wrong and how I can further investigate the problem. Update I added a new assert and a check just inside the for loop: assert( carriage.size() > 0 ); assert( carriage.count( s ) > 0 ); pair<InfectionMap::iterator,InfectionMap::iterator> ret = carriage.equal_range( s ); InfectionMap::iterator it; cout << "carriage.count(" << s << ")=" << carriage.count(s) << endl; for ( it = ret.first; it != ret.second; it++ ) { cout << "(*it).first=" << (*it).first << endl; // error here if ( ((*it).second).recT == recoverTime ) { carriage.erase( it ); } } The EXC_BAD_ACCESS error now appears at the (*it).first call, again after many thousands of successful recoveries. Can anyone give me tips on how to figure out how this problem arises? I'm trying to use gdb. Frame 0 from the backtrace reads "#0 0x0000000100001d50 in Host::recover (this=0x100530d80, s=0, recoverTime=635.91148029170529) at Host.cpp:317" I'm not sure what useful information I can extract here. Update 2 I added a break; after the carriage.erase(it). This works, but I have no idea why (e.g., why it would remove the seg fault at (*it).first.

    Read the article

  • Using label tags in a validation summary error list?

    - by patridge
    I was thinking about making use of <label> tags in my validation error summary on a failed form submit and I can't figure out if it is going to get me in trouble down the line. Can anyone think of a good reason to avoid this approach? Usability, functionality, design, or other issues are all helpful. I really like the idea of clicking a line item in the error list and being jumped to the offending input element, especially in a mobile HTML scenario where vertical orientation is more common and scrolling is a pain. So far the only problem I can find is that labels don't navigate for radio buttons or checkboxes without individual IDs (Clicking a label for a single ID-tagged radio/checkbox element alters its selection). It doesn't make it any worse than no label, though. Here is a stripped down HTML test sample of this idea (CSS omitted for simplicity). <div class="validation-errors"> <p>There was a problem saving your form.</p> <ul> <li><label for="select1">Select 1 is invalid.</label></li> <li><label for="text1">Text 1 is invalid.</label></li> <li><label for="textarea1">TextArea 1 is invalid.</label></li> <li><label for="radio1">Radio 1 is invalid.</label></li> <li><label for="checkbox1">Checkbox 1 is invalid.</label></li> </ul> </div> <form action="/somewhere"> <fieldset><legend>Some Form</legend> <ol> <li><label for="select1">select1</label> <select id="select1" name="select1"> <option value="value1">Value 1</option> <option value="value2">Value 2</option> <option selected="selected" value="value3">Value 3</option> </select></li> <li><label for="text1">text1</label> <input id="text1" name="text1" type="text" value="sometext" /></li> <li><label for="textarea1">textarea1</label> <textarea id="textarea1" name="textarea1" rows="5" cols="25">sometext</textarea></li> <li><ul> <li><label><input type="radio" name="radio1" value="value1" />Value 1</label></li> <li><label><input type="radio" name="radio1" value="value2" checked="checked" />Value 2</label></li> <li><label><input type="radio" name="radio1" value="value3" />Value 3</label></li> </ul></li> <li><ul> <li><label><input type="checkbox" name="checkbox1" value="value1" checked="checked" />Value 1</label></li> <li><label><input type="checkbox" name="checkbox1" value="value2" />Value 2</label></li> <li><label><input type="checkbox" name="checkbox1" value="value3" checked="checked" />Value 3</label></li> </ul></li> <li><input type="submit" value="Save &amp; Continue" /></li> </ol> </fieldset> </form> The only thing I have added to make the click-capable behavior more obvious is to add a CSS rule for the labels. .validation-errors label { text-decoration: underline; cursor: pointer; }

    Read the article

  • Cisco PIX 515 doesn't seem to be passing traffic through according to static route

    - by Liquidkristal
    Ok, so I am having a spot of bother with a Cisco PIX515, I have posted the current running config below, now I am no cisco expert by any means although I can do basic stuff with them, now I am having trouble with traffic sent from the outside to address: 10.75.32.25 it just doesn't appear to be going anywhere. Now this firewall is deep inside a private network, with an upstream firewall that we don't manage. I have spoken to the people that look after that firewall and they say they they have traffic routing to 10.75.32.21 and 10.75.32.25 and thats it (although there is a website that runs from the server 172.16.102.5 which (if my understanding is correct) gets traffic via 10.75.32.23. Any ideas would be greatly appreciated as to me it should all just work, but its not (obviously if the config is all correct then there could be a problem with the web server that we are trying to access on 10.75.32.25, although the users say that they can get to it internally (172.16.102.8) which is even more confusing) PIX Version 6.3(3) interface ethernet0 auto interface ethernet1 auto interface ethernet2 auto nameif ethernet0 outside security0 nameif ethernet1 inside security100 nameif ethernet2 academic security50 fixup protocol dns maximum-length 512 fixup protocol ftp 21 fixup protocol h323 h225 1720 fixup protocol h323 ras 1718-1719 fixup protocol http 80 fixup protocol rsh 514 fixup protocol rtsp 554 fixup protocol sip 5060 fixup protocol sip udp 5060 fixup protocol skinny 2000 fixup protocol smtp 25 fixup protocol sqlnet 1521 fixup protocol tftp 69 names name 195.157.180.168 outsideNET name 195.157.180.170 globalNAT name 195.157.180.174 gateway name 195.157.180.173 Mail-Global name 172.30.31.240 Mail-Local name 10.75.32.20 outsideIF name 82.219.210.17 frogman1 name 212.69.230.79 frogman2 name 78.105.118.9 frogman3 name 172.16.0.0 acadNET name 172.16.100.254 acadIF access-list acl_outside permit icmp any any echo-reply access-list acl_outside permit icmp any any unreachable access-list acl_outside permit icmp any any time-exceeded access-list acl_outside permit tcp any host 10.75.32.22 eq smtp access-list acl_outside permit tcp any host 10.75.32.22 eq 8383 access-list acl_outside permit tcp any host 10.75.32.22 eq 8385 access-list acl_outside permit tcp any host 10.75.32.22 eq 8484 access-list acl_outside permit tcp any host 10.75.32.22 eq 8485 access-list acl_outside permit ip any host 10.75.32.30 access-list acl_outside permit tcp any host 10.75.32.25 eq https access-list acl_outside permit tcp any host 10.75.32.25 eq www access-list acl_outside permit tcp any host 10.75.32.23 eq www access-list acl_outside permit tcp any host 10.75.32.23 eq https access-list acl_outside permit tcp host frogman1 host 10.75.32.23 eq ssh access-list acl_outside permit tcp host frogman2 host 10.75.32.23 eq ssh access-list acl_outside permit tcp host frogman3 host 10.75.32.23 eq ssh access-list acl_outside permit tcp any host 10.75.32.23 eq 2001 access-list acl_outside permit tcp host frogman1 host 10.75.32.24 eq 8441 access-list acl_outside permit tcp host frogman2 host 10.75.32.24 eq 8441 access-list acl_outside permit tcp host frogman3 host 10.75.32.24 eq 8441 access-list acl_outside permit tcp host frogman1 host 10.75.32.24 eq 8442 access-list acl_outside permit tcp host frogman2 host 10.75.32.24 eq 8442 access-list acl_outside permit tcp host frogman3 host 10.75.32.24 eq 8442 access-list acl_outside permit tcp host frogman1 host 10.75.32.24 eq 8443 access-list acl_outside permit tcp host frogman2 host 10.75.32.24 eq 8443 access-list acl_outside permit tcp host frogman3 host 10.75.32.24 eq 8443 access-list acl_outside permit tcp any host 10.75.32.23 eq smtp access-list acl_outside permit tcp any host 10.75.32.23 eq ssh access-list acl_outside permit tcp any host 10.75.32.24 eq ssh access-list acl_acad permit icmp any any echo-reply access-list acl_acad permit icmp any any unreachable access-list acl_acad permit icmp any any time-exceeded access-list acl_acad permit tcp any 10.0.0.0 255.0.0.0 eq www access-list acl_acad deny tcp any any eq www access-list acl_acad permit tcp any 10.0.0.0 255.0.0.0 eq https access-list acl_acad permit tcp any 10.0.0.0 255.0.0.0 eq 8080 access-list acl_acad permit tcp host 172.16.102.5 host 10.64.1.115 eq smtp pager lines 24 logging console debugging mtu outside 1500 mtu inside 1500 mtu academic 1500 ip address outside outsideIF 255.255.252.0 no ip address inside ip address academic acadIF 255.255.0.0 ip audit info action alarm ip audit attack action alarm pdm history enable arp timeout 14400 global (outside) 1 10.75.32.21 nat (academic) 1 acadNET 255.255.0.0 0 0 static (academic,outside) 10.75.32.22 Mail-Local netmask 255.255.255.255 0 0 static (academic,outside) 10.75.32.30 172.30.30.36 netmask 255.255.255.255 0 0 static (academic,outside) 10.75.32.23 172.16.102.5 netmask 255.255.255.255 0 0 static (academic,outside) 10.75.32.24 172.16.102.6 netmask 255.255.255.255 0 0 static (academic,outside) 10.75.32.25 172.16.102.8 netmask 255.255.255.255 0 0 access-group acl_outside in interface outside access-group acl_acad in interface academic route outside 0.0.0.0 0.0.0.0 10.75.32.1 1 timeout xlate 3:00:00 timeout conn 1:00:00 half-closed 0:10:00 udp 0:02:00 rpc 0:10:00 h225 1:00:00 timeout h323 0:05:00 mgcp 0:05:00 sip 0:30:00 sip_media 0:02:00 timeout uauth 0:05:00 absolute aaa-server TACACS+ protocol tacacs+ aaa-server RADIUS protocol radius aaa-server LOCAL protocol local snmp-server host outside 172.31.10.153 snmp-server host outside 172.31.10.154 snmp-server host outside 172.31.10.155 no snmp-server location no snmp-server contact snmp-server community CPQ_HHS no snmp-server enable traps floodguard enable telnet 172.30.31.0 255.255.255.0 academic telnet timeout 5 ssh timeout 5 console timeout 0 terminal width 120 Cryptochecksum:hi2u : end PIX515#

    Read the article

  • Help with simple linux shell implementation

    - by nunos
    I am implementing a simple version of a linux shell in c. I have succesfully written the parser, but I am having some trouble forking out the child process. However, I think the problem is due to arrays, pointers and such, because just started C with this project and am not still very knowledgable with them. I am getting a segmentation fault and don't know where from. Any help is greatly appreciated. #include <stdio.h> #include <stdlib.h> #include <unistd.h> #include <string.h> #include <sys/wait.h> #include <sys/types.h> #define MAX_COMMAND_LENGTH 250 #define MAX_ARG_LENGTH 250 typedef enum {false, true} bool; typedef struct { char **arg; char *infile; char *outfile; int background; } Command_Info; int parse_cmd(char *cmd_line, Command_Info *cmd_info) { char *arg; char *args[MAX_ARG_LENGTH]; int i = 0; arg = strtok(cmd_line, " "); while (arg != NULL) { args[i] = arg; arg = strtok(NULL, " "); i++; } int num_elems = i; if (num_elems == 0) return -1; cmd_info->infile = NULL; cmd_info->outfile = NULL; cmd_info->background = 0; int iarg = 0; for (i = 0; i < num_elems-1; i++) { if (!strcmp(args[i], "<")) { if (args[i+1] != NULL) cmd_info->infile = args[++i]; else return -1; } else if (!strcmp(args[i], ">")) { if (args[i+1] != NULL) cmd_info->outfile = args[++i]; else return -1; } else cmd_info->arg[iarg++] = args[i]; } if (!strcmp(args[i], "&")) cmd_info->background = true; else cmd_info->arg[iarg++] = args[i]; cmd_info->arg[iarg] = NULL; return 0; } void print_cmd(Command_Info *cmd_info) { int i; for (i = 0; cmd_info->arg[i] != NULL; i++) printf("arg[%d]=\"%s\"\n", i, cmd_info->arg[i]); printf("arg[%d]=\"%s\"\n", i, cmd_info->arg[i]); printf("infile=\"%s\"\n", cmd_info->infile); printf("outfile=\"%s\"\n", cmd_info->outfile); printf("background=\"%d\"\n", cmd_info->background); } void get_cmd(char* str) { fgets(str, MAX_COMMAND_LENGTH, stdin); str[strlen(str)-1] = '\0'; //apaga o '\n' do fim } pid_t exec_simple(Command_Info *cmd_info) { pid_t pid = fork(); if (pid < 0) { perror("Fork Error"); return -1; } if (pid == 0) { execvp(cmd_info->arg[0], cmd_info->arg); perror(cmd_info->arg[0]); exit(1); } return pid; } int main(int argc, char* argv[]) { while (true) { char cmd_line[MAX_COMMAND_LENGTH]; Command_Info cmd_info; printf(">>> "); get_cmd(cmd_line); if ( (parse_cmd(cmd_line, &cmd_info) == -1) ) return -1; parse_cmd(cmd_line, &cmd_info); if (!strcmp(cmd_info.arg[0], "exit")) exit(0); pid_t pid = exec_simple(&cmd_info); waitpid(pid, NULL, 0); } return 0; } Thanks.

    Read the article

  • xml validation problem

    - by Hoax
    I'm having trouble validating a schema I created. "cvc-elt.1: Cannot find the declaration of element 'category'." xsd <?xml version="1.0" encoding="UTF-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="list"> <xs:complexType> <xs:sequence> <xs:element name="category" type="categoryType" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="categoryType"> <xs:sequence> <xs:element name="name" type="xs:string"/> <xs:element name="desc" type="xs:string"/> <xs:element name="icon" type="xs:base64Binary"/> <xs:element name="poi" type="poiType" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> <xs:complexType name="poiType"> <xs:sequence> <xs:element name="name" type="xs:string"/> <xs:element name="desc" type="xs:string"/> <xs:element name="longitude" type="xs:long"/> <xs:element name="latitude" type="xs:long"/> <xs:element name="url" type="xs:string" minOccurs="0" maxOccurs="unbounded"/> <xs:element name="image" type="xs:base64Binary" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> </xs:schema> xml <?xml version="1.0" encoding="UTF-8"?> <list SchemaLocation="sem.xsd"> <category> <name>Sehenswürdigkeiten</name> <desc>sehenswerte und berühmte Orte, die man gesehen haben muss</desc> <icon>...</icon> <poi> <name>Linzer Landhaus</name> <desc>Sitz des Oberösterreichsichen Landtags</desc> <url>http://www.linz.at/tourismus/7569.asp</url> <longitude>48.304107</longitude> <latitude>14.286025</latitude> <image>...</image> </poi> <poi> <name>Ars Electronica</name> <desc>Museum der digitalen Künste</desc> <url>http://www.aec.at</url> <longitude>48.309788</longitude> <latitude>14.284179</latitude> <image>...</image> <image>...</image> </poi> </category> <category>...</category> </list> any idea whats wrong? cheers hoax

    Read the article

  • Efficient representation of Hierarchies in Hibernate.

    - by Alison G
    I'm having some trouble representing an object hierarchy in Hibernate. I've searched around, and haven't managed to find any examples doing this or similar - you have my apologies if this is a common question. I have two types which I'd like to persist using Hibernate: Groups and Items. * Groups are identified uniquely by a combination of their name and their parent. * The groups are arranged in a number of trees, such that every Group has zero or one parent Group. * Each Item can be a member of zero or more Groups. Ideally, I'd like a bi-directional relationship allowing me to get: * all Groups that an Item is a member of * all Items that are a member of a particular Group or its descendants. I also need to be able to traverse the Group tree from the top in order to display it on the UI. The basic object structure would ideally look like this: class Group { ... /** @return all items in this group and its descendants */ Set<Item> getAllItems() { ... } /** @return all direct children of this group */ Set<Group> getChildren() { ... } ... } class Item { ... /** @return all groups that this Item is a direct member of */ Set<Group> getGroups() { ... } ... } Originally, I had just made a simple bi-directional many-to-many relationship between Items and Groups, such that fetching all items in a group hierarchy required recursion down the tree, and fetching groups for an Item was a simple getter, i.e.: class Group { ... private Set<Item> items; private Set<Group> children; ... /** @return all items in this group and its descendants */ Set<Item> getAllItems() { Set<Item> allItems = new HashSet<Item>(); allItems.addAll(this.items); for(Group child : this.getChildren()) { allItems.addAll(child.getAllItems()); } return allItems; } /** @return all direct children of this group */ Set<Group> getChildren() { return this.children; } ... } class Item { ... private Set<Group> groups; /** @return all groups that this Item is a direct member of */ Set<Group> getGroups() { return this.groups; } ... } However, this resulted in multiple database requests to fetch the Items in a Group with many descendants, or for retrieving the entire Group tree to display in the UI. This seems very inefficient, especially with deeper, larger group trees. Is there a better or standard way of representing this relationship in Hibernate? Am I doing anything obviously wrong or stupid? My only other thought so far was this: Replace the group's id, parent and name fields with a unique "path" String which specifies the whole ancestry of a group, e.g.: /rootGroup /rootGroup/aChild /rootGroup/aChild/aGrandChild The join table between Groups and Items would then contain group_path and item_id. This immediately solves the two issues I was suffering previously: 1. The entire group hierarchy can be fetched from the database in a single query and reconstructed in-memory. 2. To retrieve all Items in a group or its descendants, we can select from group_item where group_path='N' or group_path like 'N/%' However, this seems to defeat the point of using Hibernate. All thoughts welcome!

    Read the article

  • php sorting a seriously multidimensional array...

    - by BigDogsBarking
    I'm trying to sort a multidimensional object, and, after looking on php.net and around here, I get that I should write a function that I can then call via usort. I'm having some trouble with the syntax. I haven't ever written something this complicated before, and trying to figure it out feels like a mindbender... I'm working with the array posted at the end of this post. I want to filter out duplicate [n] values. But, and this is the tricky part for me, I want to keep the [n] value that has the smallest [d] value. So, if I have (and this example is simplified, the real array is at the end of this post): Array ( [7777] => Array ( [0] => Array ( [n] => '12345' [d] => 1 ) [1] => Array ( [n] => '67890' [d] => 4 ) ) [8888] => Array ( [2] => Array ( [n] => '12345' [d] => 10 ) [3] => Array ( [n] => '67890' [d] => 2 ) ) ) I want to filter out duplicate [n] values based on the [d] value, so that I wind up with this: Array ( [7777] => Array ( [0] => Array ( [n] => '12345' [d] => 1 ) ) [8888] => Array [3] => Array ( [n] => '67890' [d] => 2 ) ) ) I've tried writing different variations of the function cmp example posted on php.net, but I haven't been able to get any to work, and I think it's because I'm not altogether clear on how to traverse it using their example... I tried: function cmp($a, $b) { if($a['n'] == $b['n']) { if($a['d'] == $b['d']) { return 0; } } return ($a['n'] < $b['n']) ? -1 : 1; } But, that really did not work at all... Anyway, here's the real array I'm trying to work with... Help is greatly appreciated! Array ( [32112] => Array ( [0] => Array ( [n] => '02124' [d] => '0' ) [1] => Array ( [n] => '02124' [d] => '0.240101905123744' ) [2] => Array ( [n] => '11050' [d] => '0.441758632682761' ) [3] => Array ( [n] => '02186' [d] => '0.317514080260304' ) ) [43434] => Array ( [4] => Array ( [n] => '02124' [d] => '5.89936971664429e-05' ) [5] => Array ( [n] => '02124' [d] => '0.145859264792549' ) [6] => Array ( [n] => '11050' [d] => '0.327864593457739' ) [7] => Array ( [n] => '11050' [d] => '0.312135345168295' ) ) )

    Read the article

  • How to find source of 301/302 redirect loop? Heroku GoDaddy Zerigo

    - by user179288
    this should be a relatively simple problem but I'm having trouble.I hope this is the right forum to post on as I've seen people get booted off stack-overflow for this sort of thing. I've setup a web app on heroku (cedar stack) at my-web-app.herokuapp.com and I'm trying to direct my-domain.com and www.my-domain.com to it. As per instructions on the heroku documentation, I've set my-domain.com to redirect (forwarding) to www.my-domain.com and then set a C-Name from www.my-domain.com to my-web-app.herokuapp.com. But the C-Name doesn't seem to be working right and is sending back to my-domain.com, causing a loop and I can't work out why. I first configured these setting at GoDaddy.com where I registered the domain but then tried to avoid the problem by using Heroku's Zerigo DNS add-on, setting the nameservers on GoDaddy to the ones given for Zerigo. However the problem remains. Here is the output from dig for my-domain.com ("drop-circles.com"): ; <<>> DiG 9.3.2 <<>> any drop-circles.com ;; global options: printcmd ;; Got answer: ;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 671 ;; flags: qr rd ra; QUERY: 1, ANSWER: 8, AUTHORITY: 0, ADDITIONAL: 5 ;; QUESTION SECTION: ;drop-circles.com. IN ANY ;; ANSWER SECTION: drop-circles.com. 433 IN NS b.ns.zerigo.net. drop-circles.com. 433 IN NS d.ns.zerigo.net. drop-circles.com. 433 IN NS e.ns.zerigo.net. drop-circles.com. 433 IN NS a.ns.zerigo.net. drop-circles.com. 433 IN NS c.ns.zerigo.net. drop-circles.com. 433 IN SOA a.ns.zerigo.net. hostmaster.zerigo.com. 1372250760 10800 3600 604800 900 drop-circles.com. 433 IN A 64.27.57.29 drop-circles.com. 433 IN A 64.27.57.24 ;; ADDITIONAL SECTION: d.ns.zerigo.net. 68935 IN A 174.36.24.250 e.ns.zerigo.net. 69015 IN A 72.26.219.150 a.ns.zerigo.net. 72602 IN A 64.27.57.11 c.ns.zerigo.net. 69204 IN A 109.74.192.232 b.ns.zerigo.net. 70549 IN A 174.37.229.229 ;; Query time: 15 msec ;; SERVER: 194.168.4.100#53(194.168.4.100) ;; WHEN: Wed Jun 26 14:29:07 2013 ;; MSG SIZE rcvd: 293 Here is the output from dig for www.my-domain.com ("www.drop-circles.com"): ; <<>> DiG 9.3.2 <<>> any www.drop-circles.com ;; global options: printcmd ;; Got answer: ;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 1608 ;; flags: qr rd ra; QUERY: 1, ANSWER: 1, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;www.drop-circles.com. IN ANY ;; ANSWER SECTION: www.drop-circles.com. 407 IN CNAME drop-circles-website.herokuapp.com. ;; Query time: 19 msec ;; SERVER: 194.168.4.100#53(194.168.4.100) ;; WHEN: Wed Jun 26 14:29:15 2013 ;; MSG SIZE rcvd: 83 And from Fiddler if I use the inspector when I try either address I get a series of requests, with the my-domain.com ("drop-circles.com") looking like this: Request: GET http://drop-circles.com/ HTTP/1.1 Accept: text/html, application/xhtml+xml, */* Accept-Language: en-gb User-Agent: Opera/9.80 (Windows NT 5.1; U; Edition IBIS; Trident/5.0) Accept-Encoding: gzip, deflate Connection: Keep-Alive Host: drop-circles.com Response: HTTP/1.1 302 Found Server: nginx/0.8.54 Date: Wed, 26 Jun 2013 13:26:55 GMT Content-Type: text/html;charset=utf-8 Connection: keep-alive Status: 302 Found Location: http://www.drop-circles.com/ Content-Length: 113 <html><body>Redirecting to <a href="http://www.drop-circles.com/">http://www.drop-circles.com/</a></body></html> And the www.my-domain.com ("www.drop-circles.com") looking like this: Request: GET http://www.drop-circles.com/ HTTP/1.1 Accept: text/html, application/xhtml+xml, */* Accept-Language: en-gb User-Agent: Opera/9.80 (Windows NT 5.1; U; Edition IBIS; Trident/5.0) Accept-Encoding: gzip, deflate Connection: Keep-Alive Host: www.drop-circles.com Response: HTTP/1.1 301 Moved Permanently Content-Type: text/html Date: Wed, 26 Jun 2013 13:26:56 GMT Location: http://drop-circles.com/ Vary: Accept X-Powered-By: Express Content-Length: 104 Connection: keep-alive <p>Moved Permanently. Redirecting to <a href="http://drop-circles.com/">http://drop-circles.com/</a></p> Any and all help would be greatly appreciated. If it is not at all obvious from these readouts what it might be could someone at least tell me which company GoDaddy, Zerigo or Heroku should I go to for support since I don't really know enough to be able to say where the problem lies. Thank you.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 385 386 387 388 389 390 391 392 393 394 395 396  | Next Page >