Search Results

Search found 40561 results on 1623 pages for 'dynamic text'.

Page 39/1623 | < Previous Page | 35 36 37 38 39 40 41 42 43 44 45 46  | Next Page >

  • How to Enable Full-Text Index on Sql Server 2008 Table

    - by michaeldelorenzo
    Not sure what's happening with this, but here's my question. I have a Sql Server 2008 database that I need to be able to do full-text indexing/searching but when I try to setup my indices on the table, I get the following: I've tried running this stored procedure on my database and it's successful: EXEC sp_fulltext_database @action = 'enable' But I still get the above window and my full-text searches don't return any results when they should. What am I missing?

    Read the article

  • How to convert Xml files to Text Files 2

    - by John
    Hi all, I have around 8000 xml files that needs to be converted into text files. The text file must contain title, description and keywords of the xml file without the tags and removing other elements and attributes as well. In other words, i need to create 8000 text files containing the title,description and keywords of the xml file. I need codings for this to be done systematically. Any help would be greatly appreciated. Thanks in advance. Hey all thank you all so so much with your replies. Here's a sample of what my xml looks like: <?xml version="1.0"?> <metadata> <identifier>43productionsNightatthegraveyard</identifier> <title>Night at the graveyard</title> <collection>opensource_movies</collection> <mediatype>movies</mediatype> <resource>movies</resource> <upload_application appid="ccPublisher" version="2.2.1"/> <uploader>[email protected]</uploader> <description>una noche en el cementerio (terror)</description> <license>http://creativecommons.org/licenses/by-nc/3.0/</license> <title>Night at the graveyard</title> <format>Video</format> <adder>[email protected]</adder> <licenseurl>http://creativecommons.org/licenses/by-nc/3.0/</licenseurl> <year>2007</year> <keywords>Night,at,the,graveyard,43,productions</keywords> <holder>43 productions</holder> <publicdate>2007-04-11 19:52:28</publicdate> </metadata> And this would be the output: una noche en el cementerio (terror) Night at the graveyard Night,at,the,graveyard,43,productions This need to be saved with the same name but in text format. Thanks all so much if any more suggestions would be much appreciated.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Error while adding dynamic data to an existing web site - The method 'Skip' is only supported for so

    - by Vinay
    Hello All: I am creating an Asp.net web site which will support dynamic data. When I am creating a dynamic web site from Scratch (from template in VS) all is working fine. But when I am trying to add dynamic entity (.edmx) file and running the application I am getting following error "The method 'Skip' is only supported for sorted input in LINQ to Entities. The method 'OrderBy' must be called before the method 'Skip'. " Please help Thanks Vinay

    Read the article

  • abstract data type list. . .

    - by aldrin
    A LIST is an ordered collection of items where items may be inserted anywhere in the list. Implement a LIST using an array as follows: struct list { int *items; // pointer to the array int size; // actual size of the array int count; // number of items in the array }; typedef struct list *List; // pointer to the structure Implement the following functions: a) List newList(int size); - will create a new List and return its pointer. Allocate space for the structure, allocate space for the array, then initialize size and count, return the pointer. b) void isEmpty(List list); c) void display(List list); d) int contains(List list, int item); e) void remove(List list, int i) ; f) void insertAfter(List list,int item, int i); g) void addEnd(List list,int item) - add item at the end of the list – simply store the data at position count, then increment count. If the array is full, allocate an array twice as big as the original. count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 addEnd(list,40) will result to count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 40 h) void addFront(List list,int item) - shift all elements to the right so that the item can be placed at position 0, then increment count. Bonus: if the array is full, allocate an array twice as big as the original. count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 addFront(list,40) will result to count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 i) void removeFront(List list) - shift all elements to the left and decrement count; count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 removeFront(list) will result to count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 j) void remove(List list,int item) - get the index of the item in the list and then shift all elements to the count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 remove(list,10) will result to count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 15 20 30

    Read the article

  • Dynamically loading Assemblies to reduce Runtime Dependencies

    - by Rick Strahl
    I've been working on a request to the West Wind Application Configuration library to add JSON support. The config library is a very easy to use code-first approach to configuration: You create a class that holds the configuration data that inherits from a base configuration class, and then assign a persistence provider at runtime that determines where and how the configuration data is store. Currently the library supports .NET Configuration stores (web.config/app.config), XML files, SQL records and string storage.About once a week somebody asks me about JSON support and I've deflected this question for the longest time because frankly I think that JSON as a configuration store doesn't really buy a heck of a lot over XML. Both formats require the user to perform some fixup of the plain configuration data - in XML into XML tags, with JSON using JSON delimiters for properties and property formatting rules. Sure JSON is a little less verbose and maybe a little easier to read if you have hierarchical data, but overall the differences are pretty minor in my opinion. And yet - the requests keep rolling in.Hard Link Issues in a Component LibraryAnother reason I've been hesitant is that I really didn't want to pull in a dependency on an external JSON library - in this case JSON.NET - into the core library. If you're not using JSON.NET elsewhere I don't want a user to have to require a hard dependency on JSON.NET unless they want to use the JSON feature. JSON.NET is also sensitive to versions and doesn't play nice with multiple versions when hard linked. For example, when you have a reference to V4.4 in your project but the host application has a reference to version 4.5 you can run into assembly load problems. NuGet's Update-Package can solve some of this *if* you can recompile, but that's not ideal for a component that's supposed to be just plug and play. This is no criticism of JSON.NET - this really applies to any dependency that might change.  So hard linking the DLL can be problematic for a number reasons, but the primary reason is to not force loading of JSON.NET unless you actually need it when you use the JSON configuration features of the library.Enter Dynamic LoadingSo rather than adding an assembly reference to the project, I decided that it would be better to dynamically load the DLL at runtime and then use dynamic typing to access various classes. This allows me to run without a hard assembly reference and allows more flexibility with version number differences now and in the future.But there are also a couple of downsides:No assembly reference means only dynamic access - no compiler type checking or IntellisenseRequirement for the host application to have reference to JSON.NET or else get runtime errorsThe former is minor, but the latter can be problematic. Runtime errors are always painful, but in this case I'm willing to live with this. If you want to use JSON configuration settings JSON.NET needs to be loaded in the project. If this is a Web project, it'll likely be there already.So there are a few things that are needed to make this work:Dynamically create an instance and optionally attempt to load an Assembly (if not loaded)Load types into dynamic variablesUse Reflection for a few tasks like statics/enumsThe dynamic keyword in C# makes the formerly most difficult Reflection part - method calls and property assignments - fairly painless. But as cool as dynamic is it doesn't handle all aspects of Reflection. Specifically it doesn't deal with object activation, truly dynamic (string based) member activation or accessing of non instance members, so there's still a little bit of work left to do with Reflection.Dynamic Object InstantiationThe first step in getting the process rolling is to instantiate the type you need to work with. This might be a two step process - loading the instance from a string value, since we don't have a hard type reference and potentially having to load the assembly. Although the host project might have a reference to JSON.NET, that instance might have not been loaded yet since it hasn't been accessed yet. In ASP.NET this won't be a problem, since ASP.NET preloads all referenced assemblies on AppDomain startup, but in other executable project, assemblies are just in time loaded only when they are accessed.Instantiating a type is a two step process: Finding the type reference and then activating it. Here's the generic code out of my ReflectionUtils library I use for this:/// <summary> /// Creates an instance of a type based on a string. Assumes that the type's /// </summary> /// <param name="typeName">Common name of the type</param> /// <param name="args">Any constructor parameters</param> /// <returns></returns> public static object CreateInstanceFromString(string typeName, params object[] args) { object instance = null; Type type = null; try { type = GetTypeFromName(typeName); if (type == null) return null; instance = Activator.CreateInstance(type, args); } catch { return null; } return instance; } /// <summary> /// Helper routine that looks up a type name and tries to retrieve the /// full type reference in the actively executing assemblies. /// </summary> /// <param name="typeName"></param> /// <returns></returns> public static Type GetTypeFromName(string typeName) { Type type = null; // Let default name binding find it type = Type.GetType(typeName, false); if (type != null) return type; // look through assembly list var assemblies = AppDomain.CurrentDomain.GetAssemblies(); // try to find manually foreach (Assembly asm in assemblies) { type = asm.GetType(typeName, false); if (type != null) break; } return type; } To use this for loading JSON.NET I have a small factory function that instantiates JSON.NET and sets a bunch of configuration settings on the generated object. The startup code also looks for failure and tries loading up the assembly when it fails since that's the main reason the load would fail. Finally it also caches the loaded instance for reuse (according to James the JSON.NET instance is thread safe and quite a bit faster when cached). Here's what the factory function looks like in JsonSerializationUtils:/// <summary> /// Dynamically creates an instance of JSON.NET /// </summary> /// <param name="throwExceptions">If true throws exceptions otherwise returns null</param> /// <returns>Dynamic JsonSerializer instance</returns> public static dynamic CreateJsonNet(bool throwExceptions = true) { if (JsonNet != null) return JsonNet; lock (SyncLock) { if (JsonNet != null) return JsonNet; // Try to create instance dynamic json = ReflectionUtils.CreateInstanceFromString("Newtonsoft.Json.JsonSerializer"); if (json == null) { try { var ass = AppDomain.CurrentDomain.Load("Newtonsoft.Json"); json = ReflectionUtils.CreateInstanceFromString("Newtonsoft.Json.JsonSerializer"); } catch (Exception ex) { if (throwExceptions) throw; return null; } } if (json == null) return null; json.ReferenceLoopHandling = (dynamic) ReflectionUtils.GetStaticProperty("Newtonsoft.Json.ReferenceLoopHandling", "Ignore"); // Enums as strings in JSON dynamic enumConverter = ReflectionUtils.CreateInstanceFromString("Newtonsoft.Json.Converters.StringEnumConverter"); json.Converters.Add(enumConverter); JsonNet = json; } return JsonNet; }This code's purpose is to return a fully configured JsonSerializer instance. As you can see the code tries to create an instance and when it fails tries to load the assembly, and then re-tries loading.Once the instance is loaded some configuration occurs on it. Specifically I set the ReferenceLoopHandling option to not blow up immediately when circular references are encountered. There are a host of other small config setting that might be useful to set, but the default seem to be good enough in recent versions. Note that I'm setting ReferenceLoopHandling which requires an Enum value to be set. There's no real easy way (short of using the cardinal numeric value) to set a property or pass parameters from static values or enums. This means I still need to use Reflection to make this work. I'm using the same ReflectionUtils class I previously used to handle this for me. The function looks up the type and then uses Type.InvokeMember() to read the static property.Another feature I need is have Enum values serialized as strings rather than numeric values which is the default. To do this I can use the StringEnumConverter to convert enums to strings by adding it to the Converters collection.As you can see there's still a bit of Reflection to be done even in C# 4+ with dynamic, but with a few helpers this process is relatively painless.Doing the actual JSON ConversionFinally I need to actually do my JSON conversions. For the Utility class I need serialization that works for both strings and files so I created four methods that handle these tasks two each for serialization and deserialization for string and file.Here's what the File Serialization looks like:/// <summary> /// Serializes an object instance to a JSON file. /// </summary> /// <param name="value">the value to serialize</param> /// <param name="fileName">Full path to the file to write out with JSON.</param> /// <param name="throwExceptions">Determines whether exceptions are thrown or false is returned</param> /// <param name="formatJsonOutput">if true pretty-formats the JSON with line breaks</param> /// <returns>true or false</returns> public static bool SerializeToFile(object value, string fileName, bool throwExceptions = false, bool formatJsonOutput = false) { dynamic writer = null; FileStream fs = null; try { Type type = value.GetType(); var json = CreateJsonNet(throwExceptions); if (json == null) return false; fs = new FileStream(fileName, FileMode.Create); var sw = new StreamWriter(fs, Encoding.UTF8); writer = Activator.CreateInstance(JsonTextWriterType, sw); if (formatJsonOutput) writer.Formatting = (dynamic)Enum.Parse(FormattingType, "Indented"); writer.QuoteChar = '"'; json.Serialize(writer, value); } catch (Exception ex) { Debug.WriteLine("JsonSerializer Serialize error: " + ex.Message); if (throwExceptions) throw; return false; } finally { if (writer != null) writer.Close(); if (fs != null) fs.Close(); } return true; }You can see more of the dynamic invocation in this code. First I grab the dynamic JsonSerializer instance using the CreateJsonNet() method shown earlier which returns a dynamic. I then create a JsonTextWriter and configure a couple of enum settings on it, and then call Serialize() on the serializer instance with the JsonTextWriter that writes the output to disk. Although this code is dynamic it's still fairly short and readable.For full circle operation here's the DeserializeFromFile() version:/// <summary> /// Deserializes an object from file and returns a reference. /// </summary> /// <param name="fileName">name of the file to serialize to</param> /// <param name="objectType">The Type of the object. Use typeof(yourobject class)</param> /// <param name="binarySerialization">determines whether we use Xml or Binary serialization</param> /// <param name="throwExceptions">determines whether failure will throw rather than return null on failure</param> /// <returns>Instance of the deserialized object or null. Must be cast to your object type</returns> public static object DeserializeFromFile(string fileName, Type objectType, bool throwExceptions = false) { dynamic json = CreateJsonNet(throwExceptions); if (json == null) return null; object result = null; dynamic reader = null; FileStream fs = null; try { fs = new FileStream(fileName, FileMode.Open, FileAccess.Read); var sr = new StreamReader(fs, Encoding.UTF8); reader = Activator.CreateInstance(JsonTextReaderType, sr); result = json.Deserialize(reader, objectType); reader.Close(); } catch (Exception ex) { Debug.WriteLine("JsonNetSerialization Deserialization Error: " + ex.Message); if (throwExceptions) throw; return null; } finally { if (reader != null) reader.Close(); if (fs != null) fs.Close(); } return result; }This code is a little more compact since there are no prettifying options to set. Here JsonTextReader is created dynamically and it receives the output from the Deserialize() operation on the serializer.You can take a look at the full JsonSerializationUtils.cs file on GitHub to see the rest of the operations, but the string operations are very similar - the code is fairly repetitive.These generic serialization utilities isolate the dynamic serialization logic that has to deal with the dynamic nature of JSON.NET, and any code that uses these functions is none the wiser that JSON.NET is dynamically loaded.Using the JsonSerializationUtils WrapperThe final consumer of the SerializationUtils wrapper is an actual ConfigurationProvider, that is responsible for handling reading and writing JSON values to and from files. The provider is simple a small wrapper around the SerializationUtils component and there's very little code to make this work now:The whole provider looks like this:/// <summary> /// Reads and Writes configuration settings in .NET config files and /// sections. Allows reading and writing to default or external files /// and specification of the configuration section that settings are /// applied to. /// </summary> public class JsonFileConfigurationProvider<TAppConfiguration> : ConfigurationProviderBase<TAppConfiguration> where TAppConfiguration: AppConfiguration, new() { /// <summary> /// Optional - the Configuration file where configuration settings are /// stored in. If not specified uses the default Configuration Manager /// and its default store. /// </summary> public string JsonConfigurationFile { get { return _JsonConfigurationFile; } set { _JsonConfigurationFile = value; } } private string _JsonConfigurationFile = string.Empty; public override bool Read(AppConfiguration config) { var newConfig = JsonSerializationUtils.DeserializeFromFile(JsonConfigurationFile, typeof(TAppConfiguration)) as TAppConfiguration; if (newConfig == null) { if(Write(config)) return true; return false; } DecryptFields(newConfig); DataUtils.CopyObjectData(newConfig, config, "Provider,ErrorMessage"); return true; } /// <summary> /// Return /// </summary> /// <typeparam name="TAppConfig"></typeparam> /// <returns></returns> public override TAppConfig Read<TAppConfig>() { var result = JsonSerializationUtils.DeserializeFromFile(JsonConfigurationFile, typeof(TAppConfig)) as TAppConfig; if (result != null) DecryptFields(result); return result; } /// <summary> /// Write configuration to XmlConfigurationFile location /// </summary> /// <param name="config"></param> /// <returns></returns> public override bool Write(AppConfiguration config) { EncryptFields(config); bool result = JsonSerializationUtils.SerializeToFile(config, JsonConfigurationFile,false,true); // Have to decrypt again to make sure the properties are readable afterwards DecryptFields(config); return result; } }This incidentally demonstrates how easy it is to create a new provider for the West Wind Application Configuration component. Simply implementing 3 methods will do in most cases.Note this code doesn't have any dynamic dependencies - all that's abstracted away in the JsonSerializationUtils(). From here on, serializing JSON is just a matter of calling the static methods on the SerializationUtils class.Already, there are several other places in some other tools where I use JSON serialization this is coming in very handy. With a couple of lines of code I was able to add JSON.NET support to an older AJAX library that I use replacing quite a bit of code that was previously in use. And for any other manual JSON operations (in a couple of apps I use JSON Serialization for 'blob' like document storage) this is also going to be handy.Performance?Some of you might be thinking that using dynamic and Reflection can't be good for performance. And you'd be right… In performing some informal testing it looks like the performance of the native code is nearly twice as fast as the dynamic code. Most of the slowness is attributable to type lookups. To test I created a native class that uses an actual reference to JSON.NET and performance was consistently around 85-90% faster with the referenced code. This will change though depending on the size of objects serialized - the larger the object the more processing time is spent inside the actual dynamically activated components and the less difference there will be. Dynamic code is always slower, but how much it really affects your application primarily depends on how frequently the dynamic code is called in relation to the non-dynamic code executing. In most situations where dynamic code is used 'to get the process rolling' as I do here the overhead is small enough to not matter.All that being said though - I serialized 10,000 objects in 80ms vs. 45ms so this is hardly slouchy performance. For the configuration component speed is not that important because both read and write operations typically happen once on first access and then every once in a while. But for other operations - say a serializer trying to handle AJAX requests on a Web Server one would be well served to create a hard dependency.Dynamic Loading - Worth it?Dynamic loading is not something you need to worry about but on occasion dynamic loading makes sense. But there's a price to be paid in added code  and a performance hit which depends on how frequently the dynamic code is accessed. But for some operations that are not pivotal to a component or application and are only used under certain circumstances dynamic loading can be beneficial to avoid having to ship extra files adding dependencies and loading down distributions. These days when you create new projects in Visual Studio with 30 assemblies before you even add your own code, trying to keep file counts under control seems like a good idea. It's not the kind of thing you do on a regular basis, but when needed it can be a useful option in your toolset… © Rick Strahl, West Wind Technologies, 2005-2013Posted in .NET  C#   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • How can I change the name of a dynamic assembly after it has been created?

    - by Samuel Jack
    Is there any way to change the name of a dynamic assembly after it has been created? I'm using a framework that uses dynamic methods, and it is creating a dynamic assembly with the same name as my main assembly (which causes problems with WPF when it tries to load resources). So I need to find a workaround, and I thought of trying to change the name of the dynamic assembly. I've tried using GetName() and then setting the Name property, but it appears that GetName returns a clone of the name because my change doesn't stick. What else can I try?

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • C++ Static array vs. Dynamic array?

    - by user69514
    What is the difference between a static array and a dynamic array in C++? I have to do an assignment for my class and it says not to use static arrays, only dynamic arrays. I've looked in the book and online, but I don't seem to understand. I thought static was created at compile time and dynamic at runtime, but I might be mistaken this with memory allocation. Can you explain to me the difference between static array and dynamic array in C++? Thnaks.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Abstract Data Type: Any1 can help me this? thanks..

    - by Aga Hibaya
    Objectives: Implement the Abstract Data Type (ADT) List using dynamically allocated arrays and structures. Description A LIST is an ordered collection of items where items may be inserted anywhere in the list. Implement a LIST using an array as follows: struct list { int *items; // pointer to the array int size; // actual size of the array int count; // number of items in the array }; typedef struct list *List; // pointer to the structure Implement the following functions: a) List newList(int size); - will create a new List and return its pointer. Allocate space for the structure, allocate space for the array, then initialize size and count, return the pointer. b) void isEmpty(List list); c) void display(List list); d) int contains(List list, int item); e) void remove(List list, int i) ; f) void insertAfter(List list,int item, int i); g) void addEnd(List list,int item) - add item at the end of the list – simply store the data at position count, then increment count. If the array is full, allocate an array twice as big as the original. count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 addEnd(list,40) will result to count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 40 h) void addFront(List list,int item) - shift all elements to the right so that the item can be placed at position 0, then increment count. Bonus: if the array is full, allocate an array twice as big as the original. count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 addFront(list,40) will result to count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 i) void removeFront(List list) - shift all elements to the left and decrement count; count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 removeFront(list) will result to count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 5 10 15 20 30 j) void remove(List list,int item) - get the index of the item in the list and then shift all elements to the count = 6 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 10 15 20 30 remove(list,10) will result to count = 5 size = 10 0 1 2 3 4 5 6 7 8 9 40 5 15 20 30 Remarks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 35 36 37 38 39 40 41 42 43 44 45 46  | Next Page >