Search Results

Search found 115 results on 5 pages for 'bufferedinputstream'.

Page 4/5 | < Previous Page | 1 2 3 4 5  | Next Page >

  • Java: Detecting image format, resize (scale) and save as JPEG

    - by BoDiE2003
    This is the code I have, it actually works, not perfectly but it does, the problem is that the resized thumbnails are not pasting on the white Drawn rectangle, breaking the images aspect ratio, here is the code, could someone suggest me a fix for it, please? Thank you import java.awt.Color; import java.awt.Graphics2D; import java.awt.Image; import java.awt.RenderingHints; import java.awt.geom.Rectangle2D; import java.awt.image.BufferedImage; import java.io.BufferedInputStream; import java.io.ByteArrayInputStream; import java.io.ByteArrayOutputStream; import java.io.IOException; import java.io.InputStream; import javax.imageio.ImageIO; import org.apache.commons.logging.Log; import org.apache.commons.logging.LogFactory; public class ImageScalerImageIoImpl implements ImageScaler { private static final String OUTPUT_FORMAT_ID = "jpeg"; // Re-scaling image public byte[] scaleImage(byte[] originalImage, int targetWidth, int targetHeight) { try { InputStream imageStream = new BufferedInputStream( new ByteArrayInputStream(originalImage)); Image image = (Image) ImageIO.read(imageStream); int thumbWidth = targetWidth; int thumbHeight = targetHeight; // Make sure the aspect ratio is maintained, so the image is not skewed double thumbRatio = (double)thumbWidth / (double)thumbHeight; int imageWidth = image.getWidth(null); int imageHeight = image.getHeight(null); double imageRatio = (double)imageWidth / (double)imageHeight; if (thumbRatio < imageRatio) { thumbHeight = (int)(thumbWidth / imageRatio); } else { thumbWidth = (int)(thumbHeight * imageRatio); } // Draw the scaled image BufferedImage thumbImage = new BufferedImage(thumbWidth, thumbHeight, BufferedImage.TYPE_INT_RGB); System.out.println("Thumb width Buffered: " + thumbWidth + " || Thumb height Buffered: " + thumbHeight); Graphics2D graphics2D = thumbImage.createGraphics(); // Use of BILNEAR filtering to enable smooth scaling graphics2D.setRenderingHint(RenderingHints.KEY_INTERPOLATION, RenderingHints.VALUE_INTERPOLATION_BILINEAR); // graphics2D.drawImage(image, 0, 0, thumbWidth, thumbHeight, null); // White Background graphics2D.setPaint(Color.WHITE); graphics2D.fill(new Rectangle2D.Double(0, 0, targetWidth, targetHeight)); graphics2D.fillRect(0, 0, targetWidth, targetHeight); System.out.println("Target width: " + targetWidth + " || Target height: " + targetHeight); // insert the resized thumbnail between X and Y of the image graphics2D.drawImage(image, 0, 0, thumbWidth, thumbHeight, null); System.out.println("Thumb width: " + thumbWidth + " || Thumb height: " + thumbHeight); // Write the scaled image to the outputstream ByteArrayOutputStream out = new ByteArrayOutputStream(); ImageIO.write(thumbImage, OUTPUT_FORMAT_ID, out); return out.toByteArray(); } catch (IOException ioe) { throw new ImageResizingException(ioe); } } }

    Read the article

  • Java: Detecting image formate - resize (scale) and save as JPEG

    - by BoDiE2003
    This is the code I have, it actually works, not perfectly but it does, the problem is that the resized thumbnails are not pasting on the white Drawn rectangle, breaking the images aspect ratio, here is the code, could someone suggest me a fix for it, please? Thank you import java.awt.Color; import java.awt.Graphics2D; import java.awt.Image; import java.awt.RenderingHints; import java.awt.geom.Rectangle2D; import java.awt.image.BufferedImage; import java.io.BufferedInputStream; import java.io.ByteArrayInputStream; import java.io.ByteArrayOutputStream; import java.io.IOException; import java.io.InputStream; import javax.imageio.ImageIO; import org.apache.commons.logging.Log; import org.apache.commons.logging.LogFactory; public class ImageScalerImageIoImpl implements ImageScaler { private static final String OUTPUT_FORMAT_ID = "jpeg"; // Re-scaling image public byte[] scaleImage(byte[] originalImage, int targetWidth, int targetHeight) { try { InputStream imageStream = new BufferedInputStream( new ByteArrayInputStream(originalImage)); Image image = (Image) ImageIO.read(imageStream); int thumbWidth = targetWidth; int thumbHeight = targetHeight; // Make sure the aspect ratio is maintained, so the image is not skewed double thumbRatio = (double)thumbWidth / (double)thumbHeight; int imageWidth = image.getWidth(null); int imageHeight = image.getHeight(null); double imageRatio = (double)imageWidth / (double)imageHeight; if (thumbRatio < imageRatio) { thumbHeight = (int)(thumbWidth / imageRatio); } else { thumbWidth = (int)(thumbHeight * imageRatio); } // Draw the scaled image BufferedImage thumbImage = new BufferedImage(thumbWidth, thumbHeight, BufferedImage.TYPE_INT_RGB); System.out.println("Thumb width Buffered: " + thumbWidth + " || Thumb height Buffered: " + thumbHeight); Graphics2D graphics2D = thumbImage.createGraphics(); // Use of BILNEAR filtering to enable smooth scaling graphics2D.setRenderingHint(RenderingHints.KEY_INTERPOLATION, RenderingHints.VALUE_INTERPOLATION_BILINEAR); // graphics2D.drawImage(image, 0, 0, thumbWidth, thumbHeight, null); // White Background graphics2D.setPaint(Color.WHITE); graphics2D.fill(new Rectangle2D.Double(0, 0, targetWidth, targetHeight)); graphics2D.fillRect(0, 0, targetWidth, targetHeight); System.out.println("Target width: " + targetWidth + " || Target height: " + targetHeight); // insert the resized thumbnail between X and Y of the image graphics2D.drawImage(image, 0, 0, thumbWidth, thumbHeight, null); System.out.println("Thumb width: " + thumbWidth + " || Thumb height: " + thumbHeight); // Write the scaled image to the outputstream ByteArrayOutputStream out = new ByteArrayOutputStream(); ImageIO.write(thumbImage, OUTPUT_FORMAT_ID, out); return out.toByteArray(); } catch (IOException ioe) { throw new ImageResizingException(ioe); } } }

    Read the article

  • Getting huge lags when downloading files via Service

    - by Copa
    I have a Service which receives URLs to download. The Service than downloads these URLs and save them to a file on the SD Card. When I put more than 2 items in the download queue my device is unusable. It nearly freezes. Huge lags and so on. Any idea? Sourcecode: private static boolean downloading = false; private static ArrayList<DownloadItem> downloads = new ArrayList<DownloadItem>(); /** * called once when the service started */ public static void start() { Thread thread = new Thread(new Runnable() { @Override public void run() { while (true) { if (downloads.size() > 0 && !downloading) { downloading = true; DownloadItem item = downloads.get(0); downloadSingleFile(item.getUrl(), item.getFile()); } } } }); thread.start(); } public static void addDownload(DownloadItem item) { downloads.add(item); } private static void downloadSuccessfullFinished() { if (downloads.size() > 0) downloads.get(0).setDownloaded(true); downloadFinished(); } private static void downloadFinished() { // remove the first entry; it has been downloaded if (downloads.size() > 0) downloads.remove(0); downloading = false; } private static void downloadSingleFile(String url, File output) { final int maxBufferSize = 4096; HttpResponse response = null; try { response = new DefaultHttpClient().execute(new HttpGet(url)); if (response != null && response.getStatusLine().getStatusCode() == 200) { // request is ok InputStream is = response.getEntity().getContent(); BufferedInputStream bis = new BufferedInputStream(is); RandomAccessFile raf = new RandomAccessFile(output, "rw"); ByteArrayBuffer baf = new ByteArrayBuffer(maxBufferSize); long current = 0; long i = 0; // read and write 4096 bytes each time while ((current = bis.read()) != -1) { baf.append((byte) current); if (++i == maxBufferSize) { raf.write(baf.toByteArray()); baf = new ByteArrayBuffer(maxBufferSize); i = 0; } } if (i > 0) // write the last bytes to the file raf.write(baf.toByteArray()); baf.clear(); raf.close(); bis.close(); is.close(); // download finished get start next download downloadSuccessfullFinished(); return; } } catch (Exception e) { // not successfully downloaded downloadFinished(); return; } // not successfully downloaded downloadFinished(); return; }

    Read the article

  • What about buffering FileInputStream?

    - by Pregzt
    I have a piece of code that reads hell of a lot (hundreds of thousand) of relatively small files (couple of KB) from the local file system in a loop. For each file there is a java.io.FileInputStream created to read the content. The process its very slow and take ages. Do you think that wrapping the FIS into java.io.BufferedInputStream would make a significant difference?

    Read the article

  • Android fill ImageView from URL

    - by Luke Batley
    Hi i'm trying to add an image to an ImageView from a URL i have tried loading it as a bitmap but nothing is showing. so does anyone know what the best method to do this is or what i'm doing wrong? heres my code @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); //Check Preferences which sets UI setContentView(R.layout.singlenews); TextView headerText = (TextView) findViewById(R.id.header_text); headerText.setText("Latest News"); PostTask posttask; posttask = new PostTask(); posttask.execute(); } public void loadNews(){ newsStr = getIntent().getStringExtra("singleNews"); try { JSONObject obj = new JSONObject(newsStr); content = obj.getString("content"); title = obj.getString("title"); fullName = obj.getString("fullname"); created = obj.getString("created"); NewsImageURL = obj.getString("image_primary"); tagline = obj.getString("tagline"); meta = "posted by: " + fullName + " " + created; URL aURL = new URL("NewsImageURL"); URLConnection conn = aURL.openConnection(); conn.connect(); InputStream is = conn.getInputStream(); /* Buffered is always good for a performance plus. */ BufferedInputStream bis = new BufferedInputStream(is); /* Decode url-data to a bitmap. */ bm = BitmapFactory.decodeStream(bis); bis.close(); is.close(); /* Apply the Bitmap to the ImageView that will be returned. */ Log.v("lc", "content=" + content); Log.v("lc", "title=" + title); Log.v("lc", "fullname=" + fullName); Log.v("lc", "created=" + created); Log.v("lc", "NewsImage=" + NewsImageURL); Log.v("lc", "Meta=" + meta); Log.v("lc", "tagline=" + tagline); } catch (JSONException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } public class PostTask extends AsyncTask<Void, String, Boolean> { @Override protected Boolean doInBackground(Void... params) { boolean result = false; loadNews(); publishProgress("progress"); return result; } protected void onProgressUpdate(String... progress) { StringBuilder str = new StringBuilder(); for (int i = 1; i < progress.length; i++) { str.append(progress[i] + " "); } } @Override protected void onPostExecute(Boolean result) { super.onPostExecute(result); Log.v("BGThread", "begin fillin data"); fillData(); } } public void fillData(){ NewsView = LayoutInflater.from(getBaseContext()).inflate(R.layout.newsdetailact, null); TextView Title = (TextView) NewsView.findViewById(R.id.NewsTitle); Title.setText(title); TextView Tagline = (TextView) NewsView.findViewById(R.id.subtitle); Tagline.setText(tagline); TextView MetaData = (TextView) NewsView.findViewById(R.id.meta); MetaData.setText(meta); ImageView NewsImage = (ImageView)NewsView.findViewById(R.id.imageView2); NewsImage.setImageBitmap(bm); TextView MainContent = (TextView) NewsView.findViewById(R.id.maintext); MainContent.setText(content); Log.v("BGThread", "Filled results"); adapter = new MergeAdapter(); adapter.addView(NewsView); setListAdapter(adapter); } }

    Read the article

  • Java invalid stream header Problem

    - by David zsl
    Hi all, im writen a client-server app, and now i´m facing a problem that I dont know how to solve: This is the client: try { Socket socket = new Socket(ip, port); ObjectOutputStream ooos = new ObjectOutputStream(socket .getOutputStream()); SendMessage message = new SendMessage(); message.numDoc = value.numDoc; message.docFreq = value.docFreq; message.queryTerms = query; message.startIndex = startIndex; message.count = count; message.multiple = false; message.ips = null; message.ports = null; message.value = true; message.docFreq = value.docFreq; message.numDoc = value.numDoc; ooos.writeObject(message); ObjectInputStream ois = new ObjectInputStream(socket .getInputStream()); ComConstants mensajeRecibido; Object mensajeAux; String mensa = null; byte[] by = null; do { mensajeAux = ois.readObject(); if (mensajeAux instanceof ComConstants) { System.out.println("Thread by Thread has Search Results"); String test; ByteArrayOutputStream testo = new ByteArrayOutputStream(); mensajeRecibido = (ComConstants) mensajeAux; byte[] wag; testo.write( mensajeRecibido.fileContent, 0, mensajeRecibido.okBytes); wag = testo.toByteArray(); if (by == null) { by = wag; } else { int size = wag.length; System.arraycopy(wag, 0, by, 0, size); } } else { System.err.println("Mensaje no esperado " + mensajeAux.getClass().getName()); break; } } while (!mensajeRecibido.lastMessage); //ByteArrayInputStream bs = new ByteArrayInputStream(by.toByteArray()); // bytes es el byte[] ByteArrayInputStream bs = new ByteArrayInputStream(by); ObjectInputStream is = new ObjectInputStream(bs); QueryWithResult[] unObjetoSerializable = (QueryWithResult[])is.readObject(); is.close(); //AQUI TOCARIA METER EL QUICKSORT XmlConverter xce = new XmlConverter(unObjetoSerializable, startIndex, count); String serializedd = xce.runConverter(); tempFinal = serializedd; ois.close(); socket.close(); } catch (Exception e) { e.printStackTrace(); } i++; } And this is the sender: try { QueryWithResult[] outputLine; Operations op = new Operations(); boolean enviadoUltimo=false; ComConstants mensaje = new ComConstants(); mensaje.queryTerms = query; outputLine = op.processInput(query, value); //String c = new String(); //c = outputLine.toString(); //StringBuffer swa = sw.getBuffer(); ByteArrayOutputStream bs= new ByteArrayOutputStream(); ObjectOutputStream os = new ObjectOutputStream (bs); os.writeObject(outputLine); os.close(); byte[] mybytearray = bs.toByteArray(); ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(mybytearray); BufferedInputStream bis = new BufferedInputStream(byteArrayInputStream); int readed = bis.read(mensaje.fileContent,0,4000); while (readed > -1) { mensaje.okBytes = readed; if (readed < ComConstants.MAX_LENGTH) { mensaje.lastMessage = true; enviadoUltimo=true; } else mensaje.lastMessage = false; oos.writeObject(mensaje); if (mensaje.lastMessage) break; mensaje = new ComConstants(); mensaje.queryTerms = query; readed = bis.read(mensaje.fileContent); } if (enviadoUltimo==false) { mensaje.lastMessage=true; mensaje.okBytes=0; oos.writeObject(mensaje); } oos.close(); } catch (Exception e) { e.printStackTrace(); } } And this is the error log: Thread by Thread has Search Results java.io.StreamCorruptedException: invalid stream header: 20646520 at java.io.ObjectInputStream.readStreamHeader(Unknown Source) at java.io.ObjectInputStream.<init>(Unknown Source) at org.tockit.comunication.ServerThread.enviaFicheroMultiple(ServerThread.java:747) at org.tockit.comunication.ServerThread.run(ServerThread.java:129) at java.lang.Thread.run(Unknown Source) Where at org.tockit.comunication.ServerThread.enviaFicheroMultiple(ServerThread.java:747) is this line ObjectInputStream is = new ObjectInputStream(bs); on the 1st code just after while (!mensajeRecibido.lastMessage); Any ideas?

    Read the article

  • How to retrieve .properties?

    - by user1014523
    Im developing desktop java application using maven. I got a *.properties file that I need to retrive during execution (src/resources/application.properties). The only thing comes to my mind is to use: private Properties applicationProperties; applicationProperties.load(new BufferedInputStream(new FileInputStream("src/resources/application.properties"))); This would work if I run my application directly from IDE. I want to to keep outpout hierarchy clear, so I set maven to copy resources folder dircetly to target folder (which is a basedir for the output application). This way application.properties file won't load (since I have target/resources/application.properties but not target/src/resources/application.properties). What is the best way to manage resources so they work both when I debug from IDE and run builded jar file directly?

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • How do I get Java to use my multi-core processor?

    - by Rudiger
    I'm using a GZIPInputStream in my program, and I know that the performance would be helped if I could get Java running my program in parallel. In general, is there a command-line option for the standard VM to run on many cores? It's running on just one as it is. Thanks! Edit I'm running plain ol' Java SE 6 update 17 on Windows XP. Would putting the GZIPInputStream on a separate thread explicitly help? No! Do not put the GZIPInputStream on a separate thread! Do NOT multithread I/O! Edit 2 I suppose I/O is the bottleneck, as I'm reading and writing to the same disk... In general, though, is there a way to make GZIPInputStream faster? Or a replacement for GZIPInputStream that runs parallel? Edit 3 Code snippet I used: GZIPInputStream gzip = new GZIPInputStream(new FileInputStream(INPUT_FILENAME)); DataInputStream in = new DataInputStream(new BufferedInputStream(gzip));

    Read the article

  • Best practices retrieving XML/stream from HTTP in Android

    - by Jeffrey
    Hello everyone, what are the best practices parsing XML from an HTTP resource in Android? I've been using HttpURLConnection to retrieve an InputStream, wrapping it with a BufferedInputStream, and then using SAX to parse the buffered stream. For the most part it works, though I do receive error reports of SocketTimeoutException: The operation timed out or general parsing error. I believe it's due to the InputStream. Would using HttpClient instead of HttpURLConnection help? If yes, why? Should the stream be output to a file, having the file parsed instead of the stream? Any input or direction would be greatly appreciated. Thanks for your time.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Lackadaisical One-to-One between Char and Byte Streams

    - by Vaibhav Bajpai
    I expected to have a one-to-one correspondence between the character streams and byte streams in terms of how the classes are organized in their hierarchy. FilterReader and FilterWriter (character streams) correspond back to FilterInputStream and FilterOutputStream (byte stream) classes. However I noticed few changes as - BufferedInputStream extends FilterInputStream, but BufferedReader does NOT extend FilterReader. BufferedOutputStream and PrintStream both extend FilterOutputStream, but BufferedWriter and PrintWriter does NOT extend FilterWriter. FilterInputStream and FilterOutputStream are not abstract classes, but FilterReader and FilterWriter are. I am not sure if I am being too paranoid to point out such differences, but was just curious to know if there was design reasoning behind such decision.

    Read the article

  • Is java.util.Scanner that slow?

    - by Cristian Vrabie
    Hi guys, In a Android application I want to use Scanner class to read a list of floats from a text file (it's a list of vertex coordinates for OpenGL). Exact code is: Scanner in = new Scanner(new BufferedInputStream(getAssets().open("vertexes.off"))); final float[] vertexes = new float[nrVertexes]; for(int i=0;i<nrVertexFloats;i++){ vertexes[i] = in.nextFloat(); } It seems however that this is incredibly slow (it took 30 minutes to read 10,000 floats!) - as tested on the 2.1 emulator. What's going on? I don't remember Scanner to be that slow when I used it on the PC (truth be told I never read more than 100 values before). Or is it something else, like reading from an asset input stream? Thanks for the help!

    Read the article

  • android java.lang.OutOfMemoryError

    - by xiangdream
    hi, all, when i download large data from website, i got this error information: I/global (20094): Default buffer size used in BufferedInputStream constructor. It would be better to be explicit if an 8k buffer is required. D/dalvikvm(20094): GC freed 6153 objects / 3650840 bytes in 335ms I/dalvikvm-heap(20094): Forcing collection of SoftReferences for 3599051-byte al location D/dalvikvm(20094): GC freed 320 objects / 11400 bytes in 144ms E/dalvikvm-heap(20094): Out of memory on a 3599051-byte allocation. I/dalvikvm(20094): "Thread-9" prio=5 tid=17 RUNNABLE I/dalvikvm(20094): | group="main" sCount=0 dsCount=0 s=0 obj=0x439b9480 I/dalvikvm(20094): | sysTid=25762 nice=0 sched=0/0 handle=4065496 anyone can help me?

    Read the article

  • C# implementation of PushbackInputStream

    - by Mark Heath
    I need a C# implementation of Java's PushbackInputStream. I have made my own very basic one, but I wondered if there was a well tested and decently performing version already available somewhere. As it happens I always push back the same bytes I read so really it just needs to be able to reposition backwards, buffering up to a number of bytes I specify. (like Java's BufferedInputStream with the mark and reset methods). Update: I should add that I can't simply reposition the stream as CanSeek may be false. (e.g. when the input steam is a NetworkStream)

    Read the article

  • Line by line image swing

    - by user1046017
    I want to show an image as it is downloading, I have the URL, and I am trying to get the image parts like this: InputStream openStream = url.openStream(); DataInputStream dis = new DataInputStream(new BufferedInputStream(openStream)); ByteArrayOutputStream os = new ByteArrayOutputStream(); while ((s = dis.read(b)) != -1) { os.write(b , 0, s); support.firePropertyChange("stream", null, os); } This way, any listener get the stream and creates an image, this way: if("stream".equals(evt.getPropertyName())){ try { ByteArrayOutputStream stream = (ByteArrayOutputStream) evt.getNewValue(); byte[] byteArray = stream.toByteArray(); stream.flush(); Image createImage = Toolkit.getDefaultToolkit().createImage(byteArray); this.getContentPane().add(new JLabel(new ImageIcon(createImage))); } catch (IOException ex) { Logger.getLogger(ImageTest.class.getName()).log(Level.SEVERE, null, ex); } } However, I am getting a "Premature end of JPEG file sun.awt.image.ImageFormatException: JPEG datastream contains no image" error, the image is a JPG image format, is there any library or method known to make something similar?

    Read the article

  • Image loader cant load my live image url

    - by Bindhu
    In my application i need to load the images in list view, when using locale(ip ported url) then no problem all images are loading properly, But when using live url then the images are not loading, My image loader class: public class ImageLoader { MemoryCache memoryCache = new MemoryCache(); FileCache fileCache; private Map<ImageView, String> imageViews = Collections .synchronizedMap(new WeakHashMap<ImageView, String>()); ExecutorService executorService; public ImageLoader(Context context) { fileCache = new FileCache(context); executorService = Executors.newFixedThreadPool(5); } final int stub_id = R.drawable.appointeesample; public void DisplayImage(String url, ImageView imageView) { imageViews.put(imageView, url); Bitmap bitmap = memoryCache.get(url); if (bitmap != null) imageView.setImageBitmap(bitmap); else { Log.d("stub", "stub" + stub_id); queuePhoto(url, imageView); imageView.setImageResource(stub_id); } } private void queuePhoto(String url, ImageView imageView) { PhotoToLoad p = new PhotoToLoad(url, imageView); executorService.submit(new PhotosLoader(p)); } private Bitmap getBitmap(String url) { File f = fileCache.getFile(url); // from SD cache Bitmap b = decodeFile(f); if (b != null) return b; // from web try { Bitmap bitmap = null; URL imageUrl = new URL(url); HttpURLConnection conn = (HttpURLConnection) imageUrl .openConnection(); conn.setConnectTimeout(30000); conn.setReadTimeout(30000); conn.setInstanceFollowRedirects(true); InputStream is = conn.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is, 81960); BitmapFactory.Options opts = new BitmapFactory.Options(); opts.inJustDecodeBounds = true; OutputStream os = new FileOutputStream(f); Utils.CopyStream(bis, os); os.close(); bitmap = decodeFile(f); Log.d("bitmap", "Bit map" + bitmap); return bitmap; } catch (Exception ex) { ex.printStackTrace(); return null; } } // decodes image and scales it to reduce memory consumption private Bitmap decodeFile(File f) { try { try { BitmapFactory.Options o = new BitmapFactory.Options(); o.inJustDecodeBounds = true; BitmapFactory.decodeStream(new FileInputStream(f), null, o); final int REQUIRED_SIZE = 200; int scale = 1; while (o.outWidth / scale / 2 >= REQUIRED_SIZE && o.outHeight / scale / 2 >= REQUIRED_SIZE) scale *= 2; BitmapFactory.Options o2 = new BitmapFactory.Options(); o2.inSampleSize = scale; return BitmapFactory.decodeStream(new FileInputStream(f), null, o2); } catch (FileNotFoundException e) { } finally { System.gc(); } return null; } catch (Exception e) { } return null; } // Task for the queue private class PhotoToLoad { public String url; public ImageView imageView; public PhotoToLoad(String u, ImageView i) { url = u; imageView = i; } } class PhotosLoader implements Runnable { PhotoToLoad photoToLoad; PhotosLoader(PhotoToLoad photoToLoad) { this.photoToLoad = photoToLoad; } @Override public void run() { if (imageViewReused(photoToLoad)) return; Bitmap bmp = getBitmap(photoToLoad.url); memoryCache.put(photoToLoad.url, bmp); if (imageViewReused(photoToLoad)) return; BitmapDisplayer bd = new BitmapDisplayer(bmp, photoToLoad); Activity a = (Activity) photoToLoad.imageView.getContext(); a.runOnUiThread(bd); } } boolean imageViewReused(PhotoToLoad photoToLoad) { String tag = imageViews.get(photoToLoad.imageView); if (tag == null || !tag.equals(photoToLoad.url)) return true; return false; } // Used to display bitmap in the UI thread class BitmapDisplayer implements Runnable { Bitmap bitmap; PhotoToLoad photoToLoad; public BitmapDisplayer(Bitmap b, PhotoToLoad p) { bitmap = b; photoToLoad = p; } public void run() { if (imageViewReused(photoToLoad)) return; if (bitmap != null) photoToLoad.imageView.setImageBitmap(bitmap); else photoToLoad.imageView.setImageResource(stub_id); } } public void clearCache() { memoryCache.clear(); fileCache.clear(); } My Live Image url for Example: https://goappointed.com/images_upload/3330Torana_Logo.JPG I have referred google but no solution is working, Thanks a lot in advance.

    Read the article

  • Parse Exception: At line 1, column 0: no element found

    - by Jeffrey
    Hi everyone, I have a weird issue. I receive the following error that causes a force-close: org.apache.harmony.xml.ExpatParser$ParseException: At line 1, column 0: no element found at org.apache.harmony.xml.ExpatParser.parseFragment(ExpatParser.java:508) at org.apache.harmony.xml.ExpatParser.parseDocument(ExpatParser.java:467) at org.apache.harmony.xml.ExpatReader.parse(ExpatReader.java:329) at org.apache.harmony.xml.ExpatReader.parse(ExpatReader.java:286) After clicking the Force Close button, the Activity is recreated and the parsing completes without a hitch. I'm using the following code snippet inside doInBackground of an AsyncTask: URL serverAddress = new URL(url[0]); HTTPURLConnection connection = (HttpURLConnection) serverAddress.openConnection(); connection.setRequestMethod("GET"); connection.setDoOutput(true); connection.setReadTimeout(10000); connection.connect(); InputStream stream = connection.getInputStream(); SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); XMLReader xr = sp.getXMLReader(); xr.parse(new InputSource(stream)); // The line that throws the exception Why would the Activity force-close and then run without any problems immediately after? Would a BufferedInputStream be any different? I'm baffled. :( Thanks for your time everyone.

    Read the article

  • SPP Socket createRfcommSocketToServiceRecord will not connect

    - by philDev
    Hello, I want to use Android 2.1 to connect to an external Bluetooth device, wich is offering an SPP port to me. In this case it is an external GPS unit. When I'm trying to connect I can't connect an established socket while being in the "client" mode. Then if I try to set up a socket (being in the server role), to RECEIVE text from my PC everything works just fine. The Computer can connect as the client to the Socket on the Phone via SPP using the SSP UUID or some random UUID. So the Problem is not that I'm using the wrong UUID. But the other way around (e.g. calling connect on the established client socket) createRfcommSocketToServiceRecord(UUID uuid)) just doesn't work. Sadly I don't have the time to inspect the problem further. It would be greate If somebody could point me the right way. In the following part of the Logfile has to be the Problem. Greets PhilDev P.S. I'm going to be present during the Office hours. Here the log file: 03-21 03:10:52.020: DEBUG/BluetoothSocket.cpp(4643): initSocketFromFdNative 03-21 03:10:52.025: DEBUG/BluetoothSocket(4643): connect 03-21 03:10:52.025: DEBUG/BluetoothSocket(4643): doSdp 03-21 03:10:52.050: DEBUG/ADAPTER(2132): create_device(01:00:00:7F:B5:B3) 03-21 03:10:52.050: DEBUG/ADAPTER(2132): adapter_create_device(01:00:00:7F:B5:B3) 03-21 03:10:52.055: DEBUG/DEVICE(2132): Creating device [address = 01:00:00:7F:B5:B3] /org/bluez/2132/hci0/dev_01_00_00_7F_B5_B3 [name = ] 03-21 03:10:52.055: DEBUG/DEVICE(2132): btd_device_ref(0x10c18): ref=1 03-21 03:10:52.065: INFO/BluetoothEventLoop.cpp(1914): event_filter: Received signal org.bluez.Adapter:DeviceCreated from /org/bluez/2132/hci0 03-21 03:10:52.065: INFO/BluetoothService.cpp(1914): ... Object Path = /org/bluez/2132/hci0/dev_01_00_00_7F_B5_B3 03-21 03:10:52.065: INFO/BluetoothService.cpp(1914): ... Pattern = 00001101-0000-1000-8000-00805f9b34fb, strlen = 36 03-21 03:10:52.070: DEBUG/DEVICE(2132): *************DiscoverServices******** 03-21 03:10:52.070: INFO/DTUN_HCID(2132): dtun_client_get_remote_svc_channel: starting discovery on (uuid16=0x0011) 03-21 03:10:52.070: INFO/DTUN_HCID(2132): bdaddr=01:00:00:7F:B5:B3 03-21 03:10:52.070: INFO/DTUN_CLNT(2132): Client calling DTUN_METHOD_DM_GET_REMOTE_SERVICE_CHANNEL (id 4) 03-21 03:10:52.070: INFO/(2106): DTUN_ReceiveCtrlMsg: [DTUN] Received message [BTLIF_DTUN_METHOD_CALL] 4354 03-21 03:10:52.070: INFO/(2106): handle_method_call: handle_method_call :: received DTUN_METHOD_DM_GET_REMOTE_SERVICE_CHANNEL (id 4), len 134 03-21 03:10:52.075: ERROR/BTLD(2106): ****************search UUID = 1101*********** 03-21 03:10:52.075: INFO//system/bin/btld(2103): btapp_dm_GetRemoteServiceChannel() 03-21 03:10:52.120: DEBUG/BluetoothService(1914): updateDeviceServiceChannelCache(01:00:00:7F:B5:B3) 03-21 03:10:52.120: DEBUG/BluetoothEventLoop(1914): ClassValue: null for remote device: 01:00:00:7F:B5:B3 is null 03-21 03:10:52.120: INFO/BluetoothEventLoop.cpp(1914): event_filter: Received signal org.bluez.Adapter:PropertyChanged from /org/bluez/2132/hci0 03-21 03:10:52.305: WARN/BTLD(2106): bta_dm_check_av:0 03-21 03:10:56.395: DEBUG/WifiService(1914): ACTION_BATTERY_CHANGED pluggedType: 2 03-21 03:10:57.440: WARN/BTLD(2106): SDP - Rcvd conn cnf with error: 0x4 CID 0x43 03-21 03:10:57.440: INFO/BTL-IFS(2106): send_ctrl_msg: [BTL_IFS CTRL] send BTLIF_DTUN_SIGNAL_EVT (CTRL) 13 pbytes (hdl 10) 03-21 03:10:57.445: INFO/DTUN_CLNT(2132): dtun-rx signal [DTUN_SIG_DM_RMT_SERVICE_CHANNEL] (id 42) len 15 03-21 03:10:57.445: INFO/DTUN_HCID(2132): dtun_dm_sig_rmt_service_channel: success=1, service=00000000 03-21 03:10:57.445: ERROR/DTUN_HCID(2132): discovery unsuccessful! package de.phil_dev.android.BT; import java.io.BufferedInputStream; import java.io.IOException; import java.io.InputStream; import java.io.OutputStream; import java.util.UUID; import android.app.Activity; import android.bluetooth.BluetoothAdapter; import android.bluetooth.BluetoothClass; import android.bluetooth.BluetoothDevice; import android.bluetooth.BluetoothServerSocket; import android.bluetooth.BluetoothSocket; import android.content.Intent; import android.os.Bundle; import android.util.Log; import android.widget.Toast; public class ThinBTClient extends Activity { private static final String TAG = "THINBTCLIENT"; private static final boolean D = true; private BluetoothAdapter mBluetoothAdapter = null; private BluetoothSocket btSocket = null; private BufferedInputStream inStream = null; private BluetoothServerSocket myServerSocket; private ConnectThread myConnection; private ServerThread myServer; // Well known SPP UUID (will *probably* map to // RFCOMM channel 1 (default) if not in use); // see comments in onResume(). private static final UUID MY_UUID = UUID .fromString("00001101-0000-1000-8000-00805F9B34FB"); // .fromString("94f39d29-7d6d-437d-973b-fba39e49d4ee"); // ==> hardcode your slaves MAC address here <== // PC // private static String address = "00:09:DD:50:86:A0"; // GPS private static String address = "00:0B:0D:8E:D4:33"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); if (D) Log.e(TAG, "+++ ON CREATE +++"); mBluetoothAdapter = BluetoothAdapter.getDefaultAdapter(); if (mBluetoothAdapter == null) { Toast.makeText(this, "Bluetooth is not available.", Toast.LENGTH_LONG).show(); finish(); return; } if (!mBluetoothAdapter.isEnabled()) { Toast.makeText(this, "Please enable your BT and re-run this program.", Toast.LENGTH_LONG).show(); finish(); return; } if (D) Log.e(TAG, "+++ DONE IN ON CREATE, GOT LOCAL BT ADAPTER +++"); } @Override public void onStart() { super.onStart(); if (D) Log.e(TAG, "++ ON START ++"); } @Override public void onResume() { super.onResume(); if (D) { Log.e(TAG, "+ ON RESUME +"); Log.e(TAG, "+ ABOUT TO ATTEMPT CLIENT CONNECT +"); } // Make the phone discoverable // When this returns, it will 'know' about the server, // via it's MAC address. // mBluetoothAdapter.startDiscovery(); BluetoothDevice device = mBluetoothAdapter.getRemoteDevice(address); Log.e(TAG, device.getName() + " connected"); // myServer = new ServerThread(); // myServer.start(); myConnection = new ConnectThread(device); myConnection.start(); } @Override public void onPause() { super.onPause(); if (D) Log.e(TAG, "- ON PAUSE -"); try { btSocket.close(); } catch (IOException e2) { Log.e(TAG, "ON PAUSE: Unable to close socket.", e2); } } @Override public void onStop() { super.onStop(); if (D) Log.e(TAG, "-- ON STOP --"); } @Override public void onDestroy() { super.onDestroy(); if (D) Log.e(TAG, "--- ON DESTROY ---"); } private class ServerThread extends Thread { private final BluetoothServerSocket myServSocket; public ServerThread() { BluetoothServerSocket tmp = null; // create listening socket try { tmp = mBluetoothAdapter .listenUsingRfcommWithServiceRecord( "myServer", MY_UUID); } catch (IOException e) { Log.e(TAG, "Server establishing failed"); } myServSocket = tmp; } public void run() { Log.e(TAG, "Beginn waiting for connection"); BluetoothSocket connectSocket = null; InputStream inStream = null; byte[] buffer = new byte[1024]; int bytes; while (true) { try { connectSocket = myServSocket.accept(); } catch (IOException e) { Log.e(TAG, "Connection failed"); break; } Log.e(TAG, "ALL THE WAY AROUND"); try { connectSocket = connectSocket.getRemoteDevice() .createRfcommSocketToServiceRecord(MY_UUID); connectSocket.connect(); } catch (IOException e1) { Log.e(TAG, "DIDNT WORK"); } // handle Connection try { inStream = connectSocket.getInputStream(); while (true) { try { bytes = inStream.read(buffer); Log.e(TAG, "Received: " + buffer.toString()); } catch (IOException e3) { Log.e(TAG, "disconnected"); break; } } } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); break; } } } void cancel() { } } private class ConnectThread extends Thread { private final BluetoothSocket mySocket; private final BluetoothDevice myDevice; public ConnectThread(BluetoothDevice device) { myDevice = device; BluetoothSocket tmp = null; try { tmp = device.createRfcommSocketToServiceRecord(MY_UUID); } catch (IOException e) { Log.e(TAG, "CONNECTION IN THREAD DIDNT WORK"); } mySocket = tmp; } public void run() { Log.e(TAG, "STARTING TO CONNECT THE SOCKET"); setName("My Connection Thread"); InputStream inStream = null; boolean run = false; //mBluetoothAdapter.cancelDiscovery(); try { mySocket.connect(); run = true; } catch (IOException e) { run = false; Log.e(TAG, this.getName() + ": CONN DIDNT WORK, Try closing socket"); try { mySocket.close(); } catch (IOException e1) { Log.e(TAG, this.getName() + ": COULD CLOSE SOCKET", e1); this.destroy(); } } synchronized (ThinBTClient.this) { myConnection = null; } byte[] buffer = new byte[1024]; int bytes; // handle Connection try { inStream = mySocket.getInputStream(); while (run) { try { bytes = inStream.read(buffer); Log.e(TAG, "Received: " + buffer.toString()); } catch (IOException e3) { Log.e(TAG, "disconnected"); } } } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } // starting connected thread (handling there in and output } public void cancel() { try { mySocket.close(); } catch (IOException e) { Log.e(TAG, this.getName() + " SOCKET NOT CLOSED"); } } } }

    Read the article

  • Retrieve data from .dat file.

    - by Zach
    We have an application which requires us to read data from a file (.dat) dynamically using deserialization. We are actually getting first object and it throws null pointer exception when we are accessing other objects using a "for" loop. File file=null; FileOutputStream fos=null; BufferedOutputStream bos=null; ObjectOutputStream oos=null; try{ file=new File("account4.dat"); fos=new FileOutputStream(file,true); bos=new BufferedOutputStream(fos); oos=new ObjectOutputStream(bos); oos.writeObject(m); System.out.println("object serialized"); amlist=new MemberAccountList(); oos.close(); } catch(Exception ex){ ex.printStackTrace(); } Reading objects: try{ MemberAccount m1; file=new File("account4.dat");//add your code here fis=new FileInputStream(file); bis=new BufferedInputStream(fis); ois=new ObjectInputStream(bis); System.out.println(ois.readObject()); while(ois.readObject()!=null){ m1=(MemberAccount)ois.readObject(); System.out.println(m1.toString()); }/mList.addElement(m1); // Here we have the issue throwing null pointer exception Enumeration elist=mList.elements(); while(elist.hasMoreElements()){ obj=elist.nextElement(); System.out.println(obj.toString()); }/ } catch(ClassNotFoundException e){ } catch(EOFException e){ System.out.println("end"); } catch(Exception ex){ ex.printStackTrace(); }

    Read the article

  • Displaying music list using custom lists instead of array adapters

    - by Rahul Varma
    Hi, I have displayed the music list in a list view. The list is obtained from a website. I have done this using Arraylist. Now, i want to iterate the same program using custom lists and custom adapters instead of array list. The code i have written using array lists is... public class MusicListActivity extends Activity { MediaPlayer mp; File mediaFile; TextView tv; TextView albumtext; TextView artisttext; ArrayList<String> al=new ArrayList<String>(); //ArrayList<String> al=new ArrayList<String>(); ArrayList<String> node=new ArrayList<String>(); ArrayList<String> filepath=new ArrayList<String>(); ArrayList<String> imgal=new ArrayList<String>(); ArrayList<String> album=new ArrayList<String>(); ArrayList<String> artist=new ArrayList<String>(); ListView lv; Object[] webImgListObject; String[] stringArray; XMLRPCClient client; String loginsess; HashMap<?, ?> siteConn = null; //ImageView im; Bitmap img; String s; int d; int j; StreamingMediaPlayer sm; int start=0; Intent i; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); lv=(ListView)findViewById(R.id.list1); al=getIntent().getStringArrayListExtra("titles"); //node=getIntent().getStringArrayListExtra("nodeid"); filepath=getIntent().getStringArrayListExtra("apath"); imgal=getIntent().getStringArrayListExtra("imgpath"); album=getIntent().getStringArrayListExtra("album"); artist=getIntent().getStringArrayListExtra("artist"); // ArrayAdapter<String> aa=new ArrayAdapter<String>(this,R.layout.row,R.id.text2,al); //lv.setAdapter(aa); try{ lv.setAdapter( new styleadapter(this,R.layout.row, R.id.text2,al)); }catch(Throwable e) { Log.e("openaudio error",""+e.toString()); goBlooey(e); } lv.setOnItemClickListener(new OnItemClickListener(){ @Override public void onItemClick(AdapterView<?> arg0, View arg1, int arg2, long arg3){ j=1; try{ d=arg2; String filep=filepath.get(d); String tit=al.get(d); String image=imgal.get(d); String singer=artist.get(d); String movie=album.get(d); sendpath(filep,tit,image,singer,movie); // getpath(n); }catch(Throwable t) { goBlooey(t); } } }); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); if(j==0) {i=new Intent(this,gorinkadashboard.class); startActivity(i);} } @Override protected void onResume() { // TODO Auto-generated method stub super.onResume(); j=0; } @Override public boolean onKeyDown(int keyCode, KeyEvent event) { if (keyCode==KeyEvent.KEYCODE_SEARCH) { Log.i("go","go"); return true; } return(super.onKeyDown(keyCode, event)); } public void sendpath(String n,String nn,String image,String singer,String movie) { Intent ii=new Intent(this,MusicPlayerActivity.class); ii.putExtra("path",n); ii.putExtra("titletxt",nn); //ii.putStringArrayListExtra("playpath",filepath); ii.putExtra("pos",d); ii.putExtra("image",image); ii.putStringArrayListExtra("imagepath",imgal); ii.putStringArrayListExtra("filepath", filepath); ii.putStringArrayListExtra("imgal", imgal); ii.putExtra("movie" ,movie ); ii.putExtra("singer",singer); ii.putStringArrayListExtra("album", album); ii.putStringArrayListExtra("artist",artist); ii.putStringArrayListExtra("tittlearray",al); startActivity(ii); } class styleadapter extends ArrayAdapter<String> { Context context=null; public styleadapter(Context context, int resource, int textViewResourceId, List<String> objects) { super(context, resource, textViewResourceId, objects); this.context=context; } @Override public View getView(int position, View convertView, ViewGroup parent) { final int i=position; LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tv=(TextView)v.findViewById(R.id.text2); albumtext=(TextView)v.findViewById(R.id.text3); artisttext=(TextView)v.findViewById(R.id.text1); tv.setText(al.get(i)); albumtext.setText(album.get(i)); artisttext.setText(artist.get(i)); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal.get(i); // displyimg(s,v); // new imageloader(s,im); String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } } public class imageloader implements Runnable{ private String ss; //private View v; //private View v2; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; //this.v2=v2; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { // URL url = new URL(ss); // URLConnection conn = url.openConnection(); // conn.connect(); HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); // BufferedInputStream bis = new BufferedInputStream(is); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); // bis.close(); is.close(); im.setImageBitmap(bm); // im.forceLayout(); // v2.postInvalidate(); // v2.requestLayout(); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); //goBlooey(t); // throw new RuntimeException(t); } } } private void goBlooey(Throwable t) { AlertDialog.Builder builder=new AlertDialog.Builder(this); builder .setTitle("Exception!") .setMessage(t.toString()) .setPositiveButton("OK", null) .show(); } } I have created the SongList.java, SongsAdapter.java and also SongsAdapterView.java. Their code is... public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class SongsAdapter extends BaseAdapter{ private Context context; private List<SongsList> listSongs; public SongsAdapter(Context context, List<SongsList> listPhonebook){ this.context = context; this.listSongs = listSongs; } public int getCount() { return listSongs.size(); } public Object getItem(int position) { return listSongs.get(position); } public long getItemId(int position) { return position; } public View getView(int position, View view, ViewGroup viewGroup) { SongsList entry = listSongs.get(position); return new SongsAdapterView(context,entry); } } public SongsAdapterView(Context context, SongsList entry) { super(context); this.setOrientation(VERTICAL); this.setTag(entry); // TODO Auto-generated constructor stub View v = inflate(context, R.layout.row, null); TextView tvTitle = (TextView)v.findViewById(R.id.text2); tvTitle.setText(entry.gettitleName()); TextView tvMovie = (TextView)v.findViewById(R.id.text3); tvTitle.setText(entry.getmovieName()); TextView tvSinger = (TextView)v.findViewById(R.id.text1); tvTitle.setText(entry.getsingerName()); addView(v); } } Can anyone please tell me how to display the list using custom lists and custom adapters using the code above???

    Read the article

  • How to read data from file(.dat) in append mode

    - by govardhan
    We have an application which requires us to read data from a file (.dat) dynamically using deserialization. We are actually getting first object and it throws null pointer exception and "java.io.StreamCorruptedException:invalid type code:AC" when we are accessing other objects using a "for" loop. File file=null; FileOutputStream fos=null; BufferedOutputStream bos=null; ObjectOutputStream oos=null; try{ file=new File("account4.dat"); fos=new FileOutputStream(file,true); bos=new BufferedOutputStream(fos); oos=new ObjectOutputStream(bos); oos.writeObject(m); System.out.println("object serialized"); amlist=new MemberAccountList(); oos.close(); } catch(Exception ex){ ex.printStackTrace(); } Reading objects: try{ MemberAccount m1; file=new File("account4.dat");//add your code here fis=new FileInputStream(file); bis=new BufferedInputStream(fis); ois=new ObjectInputStream(bis); System.out.println(ois.readObject()); **while(ois.readObject()!=null){ m1=(MemberAccount)ois.readObject(); System.out.println(m1.toString()); }/*mList.addElement(m1);** // Here we have the issue throwing null pointer exception Enumeration elist=mList.elements(); while(elist.hasMoreElements()){ obj=elist.nextElement(); System.out.println(obj.toString()); }*/ } catch(ClassNotFoundException e){ } catch(EOFException e){ System.out.println("end"); } catch(Exception ex){ ex.printStackTrace(); }

    Read the article

  • Java iteration reading & parsing

    - by Patrick Lorio
    I have a log file that I am reading to a string public static String Read (String path) throws IOException { StringBuilder sb = new StringBuilder(); InputStream in = new BufferedInputStream(new FileInputStream(path)); int r; while ((r = in.read()) != -1) { sb.append(r); } return sb.toString(); } Then I have a parser that iterates over the entire string once void Parse () { String con = Read("log.txt"); for (int i = 0; i < con.length; i++) { /* parsing action */ } } This is hugely a waste of cpu cycles. I loop over all the content in Read. Then I loop over all the content in Parse. I could just place the /* parsing action */ under the while loop in the Read method, which would be find but I don't want to copy the same code all over the place. How can I parse the file in one iteration over the contents and still have separate methods for parsing and reading? In C# I understand there is some sort of yield return thing, but I'm locked with Java. What are my options in Java?

    Read the article

  • Graphing the pitch (frequency) of a sound

    - by Coronatus
    I want to plot the pitch of a sound into a graph. Currently I can plot the amplitude. The graph below is created by the data returned by getUnscaledAmplitude(): AudioInputStream audioInputStream = AudioSystem.getAudioInputStream(new BufferedInputStream(new FileInputStream(file))); byte[] bytes = new byte[(int) (audioInputStream.getFrameLength()) * (audioInputStream.getFormat().getFrameSize())]; audioInputStream.read(bytes); // Get amplitude values for each audio channel in an array. graphData = type.getUnscaledAmplitude(bytes, this); public int[][] getUnscaledAmplitude(byte[] eightBitByteArray, AudioInfo audioInfo) { int[][] toReturn = new int[audioInfo.getNumberOfChannels()][eightBitByteArray.length / (2 * audioInfo. getNumberOfChannels())]; int index = 0; for (int audioByte = 0; audioByte < eightBitByteArray.length;) { for (int channel = 0; channel < audioInfo.getNumberOfChannels(); channel++) { // Do the byte to sample conversion. int low = (int) eightBitByteArray[audioByte]; audioByte++; int high = (int) eightBitByteArray[audioByte]; audioByte++; int sample = (high << 8) + (low & 0x00ff); if (sample < audioInfo.sampleMin) { audioInfo.sampleMin = sample; } else if (sample > audioInfo.sampleMax) { audioInfo.sampleMax = sample; } toReturn[channel][index] = sample; } index++; } return toReturn; } But I need to show the audio's pitch, not amplitude. Fast Fourier transform appears to get the pitch, but it needs to know more variables than the raw bytes I have, and is very complex and mathematical. Is there a way I can do this?

    Read the article

  • Improving I/O performance in C++ programs[external merge sort]

    - by Ajay
    I am currently working on a project involving external merge-sort using replacement-selection and k-way merge. I have implemented the project in C++[runs on linux]. Its very simple and right now deals with only fixed sized records. For reading & writing I use (i/o)fstream classes. After executing the program for few iterations, I noticed that I/O read blocks for requests of size more than 4K(typical block size). Infact giving buffer sizes greater than 4K causes performance to decrease. The output operations does not seem to need buffering, linux seemed to take care of buffering output. So I issue a write(record) instead of maintaining special buffer of writes and then flushing them out at once using write(records[]). But the performance of the application does not seem to be great. How could I improve the performance? Should I maintain special I/O threads to take care of reading blocks or are there existing C++ classes providing this abstraction already?(Something like BufferedInputStream in java)

    Read the article

< Previous Page | 1 2 3 4 5  | Next Page >