Search Results

Search found 80 results on 4 pages for 'shishir garg'.

Page 4/4 | < Previous Page | 1 2 3 4 

  • HOw to create an array of images?

    - by user317149
    HI, I need to create an array of images,in which, every time i tap, a new image gets placed at "view". and at some particular duration of time, i need to clear that array of images, so that all the images gets cleared from the view. like on button click, i want to clear all the images which are on the view, through taps, should be clear at once. Hope i m clear with my question. looking for an quick reply. regards shishir

    Read the article

  • can we use timer in taps??

    - by user317149
    i m working on app,in which user taps to shoot bullets, i want user to restrict their taps, like he next tap or touch should be counted after 1 or 3 seconds, is their any snippet,i can use to rtestrict user for continiously tapoping/touch? quick reply is aleways appreciated/ regards shishir

    Read the article

  • SQL SERVER – Winners – Contest Win Joes 2 Pros Combo (USD 198)

    - by pinaldave
    Earlier this week we had contest ran over the blog where we are giving away USD 198 worth books of Joes 2 Pros. We had over 500+ responses during the five days of the contest. After removing duplicate and incorrect responses we had a total of 416 valid responses combined total 5 days. We got maximum correct answer on day 2 and minimum correct answer on day 5. Well, enough of the statistics. Let us go over the winners’ names. The winners have been selected randomly by one of the book editors of Joes 2 Pros. SQL Server Joes 2 Pros Learning Kit 5 Books Day 1 Winner USA: Philip Dacosta India: Sandeep Mittal Day 2 Winner USA: Michael Evans India: Satyanarayana Raju Pakalapati Day 3 Winner USA: Ratna Pulapaka India: Sandip Pani Day 4 Winner USA: Ramlal Raghavan India: Dattatrey Sindol Day 5 Winner USA: David Hall India: Mohit Garg I congratulate all the winners for their participation. All of you will receive emails from us. You will have to reply the email with your physical address. Once you receive an email please reply within 3 days so we can ship the 5 book kits to you immediately. Bonus Winners Additionally, I had announced that every day I will select a winner from the readers who have left comments with their favorite blog post. Here are the winners with their favorite blog post. Day 1: Prasanna kumar.D [Favorite Post] Day 2: Ganesh narim [Favorite Post] Day 3: Sreelekha [Favorite Post] Day 4: P.Anish Shenoy [Favorite Post] Day 5: Rikhil [Favorite Post] All the bonus winners will receive my print book SQL Wait Stats if your shipping address is in India or Pluralsight Subscription if you are outside India. If you are not winner of the contest but still want to learn SQL Server you can get the book from here. Amazon | 1 | 2 | 3 | 4 | 5 | Flipkart | Indiaplaza Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Joes 2 Pros, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • OBJC_CLASS_$_MTSCRA", referenced from

    - by user1078841
    I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 1 2 3 4