Search Results

Search found 91614 results on 3665 pages for 'new developer'.

Page 400/3665 | < Previous Page | 396 397 398 399 400 401 402 403 404 405 406 407  | Next Page >

  • How do you insert 9 MB file into a Blob Field Using Oracle.DataAccess?

    - by discwiz
    Trying to insert a large audio file into an Oracle 10g database and keep getting this error: ORA-01460: unimplemented or unreasonable conversion requested The byte array length of the audio file is 2702577. The procedure works with smaller array lengths, but not the larger ones. Here is my code and Thanks! Dim oracleConnection As New OracleClient.OracleConnection Dim Cmd As New OracleClient.OracleCommand Dim oracleDataAdapter As New OracleDataAdapter oracleConnection.ConnectionString = System.Configuration.ConfigurationManager.AppSettings("MasterConnectionODT") Cmd.Connection = oracleConnection Cmd.CommandText = "Audio.ADD_AUDIO" Cmd.CommandType = CommandType.StoredProcedure Dim aParam As New OracleClient.OracleParameter aParam.ParameterName = "I_FACILITY_ID_C" aParam.OracleType = OracleType.Char aParam.Value = FacID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_TARP_ID_N" aParam.OracleType = OracleType.Number aParam.Value = TarpID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_AUDIO_BLOB" aParam.OracleType = OracleType.Blob aParam.Value = Audio aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) Using oracleConnection oracleConnection.Open() Cmd.ExecuteNonQuery() End Using

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • How to bind a List to a WPF treeview using Xaml?

    - by Joan Venge
    I don't know how to bind a List of Drink to a WPF TreeView. struct Drink { public string Name { get; private set; } public int Popularity { get; private set; } public Drink ( string name, int popularity ) : this ( ) { this.Name = name; this.Popularity = popularity; } } List<Drink> coldDrinks = new List<Drink> ( ){ new Drink ( "Water", 1 ), new Drink ( "Fanta", 2 ), new Drink ( "Sprite", 3 ), new Drink ( "Coke", 4 ), new Drink ( "Milk", 5 ) }; } } I have searched the web, for instance saw here. But what's this even mean: ItemsSource="{x:Static local:TreeTest.BoatList}" x:? static? local? How do you specify a collection in your code in the xaml?

    Read the article

  • Empty namespace using Linq Xml

    - by porum
    I'm trying to create a sitemap using Linq to Xml, but am getting an empty namespace attribute, which I would like to get rid of. e.g. XNamespace ns = "http://www.sitemaps.org/schemas/sitemap/0.9"; XDocument xdoc = new XDocument(new XDeclaration("1.0", "utf-8", "true"), new XElement(ns + "urlset", new XElement("url", new XElement("loc", "http://www.example.com/page"), new XElement("lastmod", "2008-09-14")))); The result is ... <urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"> <url xmlns=""> <loc>http://www.example.com/page</loc> <lastmod>2008-09-14</lastmod> </url> </urlset> I would rather not have the xmlns="" on the url element. I can strip it out using Replace on the final xdoc.ToString(), but is there a more correct way?

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

  • Compare values for audit trail

    - by kagaku
    I'm attempting to develop an audit trail/tracking solution for an existing database written in PLSQL/PHP - however I'm still unsure as of yet on an easy (to implement and maintain) solution for tracking changes to fields/values. For instance, the project tracking portion of the DB APP tracks over 200 fields and ideally I'd like a nice way to show a history of changes, such as: 5/10/2010 - Project 435232 updated by John Doe Changed Project Name (Old: Test Project; New: Super Test Project) Changed Submission Date (Old: 5/10/2010; New: 5/11/2010) Changed Description (Old: This is an example!; New: This is a test example) Essentially for each field (db column) it would output a new line to show the old/new values. So far my current idea is saving the current version of the data to a temporary table, updating the primary table with the new data then loading each row into an array and doing an array compare to determine the differences. This seems a bit convoluted, and if there is an easier method I'd love to know it. Any ideas or suggestions are much appreciated!

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • windows phone deserialization json

    - by user2042227
    I have a weird issue. so I am making a few calls in my app to a webservice, which replies with data. However I am using a token based login system, so the first time the user enters the app I get a token from the webservice to login for that specific user and that token returns only that users details. The problem I am having is when the user changes I need to make the calls again, to get the new user's details, but using visual studio's breakpoint debugging, it shows the new user's token making the call however the problem is when the json is getting deserialized, it is as if it still reads the old data and deserializes that, when I exit my app with the new user it works fine, so its as if it is reading cached values, but I have no idea how to clear it? I am sure the new calls are being made and the problem lies with the deserializing, but I have tried clearing the values before deserializing them again, however nothing works. am I missing something with the json deserializer, how van I clear its cached values? here I make the call and set it not to cache so it makes a new call everytime: client.Headers[HttpRequestHeader.CacheControl] = "no-cache"; var token_details = await client.DownloadStringTaskAsync(uri); and here I deserialize the result, it is at this section the old data gets shown, so the raw json being shown inside "token_details" is correct, only once I deserialize the token_details, it shows the wrong data. deserialized = JsonConvert.DeserializeObject(token_details); and the class I am deserializing into is a simple class nothing special happening here, I have even tried making the constructor so that it clears the values each time it gets called. public class test { public string status { get; set; } public string name{ get; set; } public string birthday{ get; set; } public string errorDes{ get; set; } public test() { status = ""; name= ""; birthday= ""; errorDes= ""; } } uri's before making the calls: {https://whatever.co.za/token/?code=BEBCg==&id=WP7&junk=121edcd5-ad4d-4185-bef0-22a4d27f2d0c} - old call "UBCg==" - old reply {https://whatever.co.za/token/?code=ABCg==&id=WP7&junk=56cc2285-a5b8-401e-be21-fec8259de6dd} - new call "UBCg==" - new response which is the same response as old call as you can see i did attach a new GUID everytime i make the call, but then the new uri is read before making the downloadstringtaskasync method call, but it returns with the old data

    Read the article

  • Strange results - I obtain same value for all keys

    - by Pietro Luciani
    I have a problem with mapreduce. Giving as input a list of song ("Songname"#"UserID"#"boolean") i must have as result a song list in which is specified how many time different useres listen them... so a output ("Songname","timelistening"). I used hashtable to allow only one couple . With short files it works well but when I put as input a list about 1000000 of records it returns me the same value (20) for all records. This is my mapper: public static class CanzoniMapper extends Mapper<Object, Text, Text, IntWritable>{ private IntWritable userID = new IntWritable(0); private Text song = new Text(); public void map(Object key, Text value, Context context) throws IOException, InterruptedException { /*StringTokenizer itr = new StringTokenizer(value.toString()); while (itr.hasMoreTokens()) { word.set(itr.nextToken()); context.write(word, one); }*/ String[] caratteri = value.toString().split("#"); if(caratteri[2].equals("1")){ song.set(caratteri[0]); userID.set(Integer.parseInt(caratteri[1])); context.write(song,userID); } } } This is my reducer: public static class CanzoniReducer extends Reducer<Text,IntWritable,Text,IntWritable> { private IntWritable result = new IntWritable(); public void reduce(Text key, Iterable<IntWritable> values, Context context) throws IOException, InterruptedException { Hashtable<IntWritable,Text> doppioni = new Hashtable<IntWritable,Text>(); for (IntWritable val : values) { doppioni.put(val,key); } result.set(doppioni.size()); //doppioni.clear(); context.write(key,result); } } and main: Configuration conf = new Configuration(); Job job = new Job(conf, "word count"); job.setJarByClass(Canzoni.class); job.setMapperClass(CanzoniMapper.class); //job.setCombinerClass(CanzoniReducer.class); //job.setNumReduceTasks(2); job.setReducerClass(CanzoniReducer.class); job.setOutputKeyClass(Text.class); job.setOutputValueClass(IntWritable.class); FileInputFormat.addInputPath(job, new Path(args[0])); FileOutputFormat.setOutputPath(job, new Path(args[1])); System.exit(job.waitForCompletion(true) ? 0 : 1); Any idea???

    Read the article

  • Remove .net ContextMenuStrip Padding

    - by Frosty840
    Hi, When creating a ContextMenuStrip, there is a huge amount of padding around the contained controls. For example: Me.myMenu = New ContextMenuStrip 'unset all obvious padding settings' Me.myMenu.ShowCheckMargin = False Me.myMenu.ShowImageMargin = False Me.myMenu.Margin = New System.Windows.Forms.Padding(0) Me.myMenu.Padding = New System.Windows.Forms.Padding(0) Dim addButton As New Button addButton.Size = New Size(60, 60) addButton.Text = "Button" Dim addControlHost As New ToolStripControlHost(addButton) Me.myMenu.Items.Add(addcontrolhost) Me.ContextMenuStrip = Me.myMenu This, ideally, would cause a 60x60 button to pop up at the cursor location. What actually pops up is this: The button is there, as expected, but despite there being no margin, no padding, and having set both Show*Margin settings to False, there is a massive border around the Button. I'm probably missing something blindingly obvious, but how can I get rid of all the white bordering, especially that huge right-hand margin?

    Read the article

  • Google Site Data fetching

    - by inTagger
    Hail! I want to fetch image from NOT PUBLIC Google Site's page. I'm using WebClient for this purposes. var uri = new Uri("http://sites.google.com/a/MYDOMAIN.COM/SITENAME/" + "_/rsrc/1234567890/MYIMAGE.jpg"); string fileName = "d:\\!temp\\MYIMAGE.jpg"; if (File.Exists(fileName)) File.Delete(fileName); using (var webClient = new WebClient()) { var networkCredential = new NetworkCredential("USERNAME", "PASSWORD"); var credentialCache = new CredentialCache { {new Uri("sites.google.com"), "Basic", networkCredential}, {new Uri("www.google.com"), "Basic", networkCredential} }; webClient.Credentials = credentialCache; webClient.DownloadFile(uri, fileName); } It doesn't download image, but html file with login form is downloaded. If i open this link in browser it shows me login form then i enter username and password and then i can see the image. How i must use my credentials to download file with WebClient or HttpWebRequest?

    Read the article

  • How to print a JTable header in two lines?

    - by Eruls
    Program is to print a JTabel and used function is JTabel jt=new JTable(); MessageFormat headerFormat= new MessageFormat("My World Tomorrow"); MessageFormat footerFormat = new MessageFormat("Page {0}"); jt.Print(JTabel.Format,headerFormat,footerFormat); Query is: How to print the header in two lines that is My World Tomorrow Tired following solutions: new MessageFormat("My world \n Tomorrow"); new MessageFormat("My world \r\n Tomorrow"); new MessageFormat("My world" System.getProperty("line.separator")+"Tomorrow" ); Nothing works.

    Read the article

  • Advice needed: What tech expertise do I need to accomplish my goal?

    - by quaternion
    I have a business plan & money to hire a developer - the essentials involve simple online games for children (played via traditional computer over the internet) such that their scores are uploaded to a database that can be viewed via a nice portal. What I don't know is: what technologies I would want my developer to know (the only somewhat unusual requirement I have is that the games have relatively accurate timing of keypresses/mouse presses) how much I should expect to pay (in general, what is the appropriate range) how many hours a program of the complexity of a simple tower defense -type game should take to develop (to be clear, the idea is not to implement TD, but rather other games of similar complexity) whether I should go with capable acquaintances, some online kind of online web-dev bidding site, or just try to find a capable undergraduate at the local university who I can wow with his/her first big paycheck, how I should communicate the software's specifications to my hired developer... Is there a standard I should be using? whether I should hire a webdev consultant for a few hours to help me answer these questions, instead of asking stackoverflow Thanks for any advice!

    Read the article

  • Cannot find suitable formatter for custom class object

    - by Ganesha87
    I'm writing messages to a Message Queue in C# as follows: ObjectMsg objMsg = new ObjMsg(1,"ascii",20090807); Message m = new Message(); m.Formatter = new BinaryMessageFormatter(); m.body = objMsg; queue.Send(m); and I'm trying to read the messages as follows: Message m = new Message() m.Formatter = new BinaryMessageFormatter(); MessageQueue mq = new MessageQueue("./pqueue"); m = mq.Recieve(); ObjMsg msg = (ObjMsg )m.Body; However I'm getting an error message which says: "Cannot find a formatter capable of reading this message."

    Read the article

  • How to encrypt and save a binary stream after serialization and read it back?

    - by Anindya Chatterjee
    I am having some problems in using CryptoStream when I want to encrypt a binary stream after binary serialization and save it to a file. I am getting the following exception System.ArgumentException : Stream was not readable. Can anybody please show me how to encrypt a binary stream and save it to a file and deserialize it back correctly? The code is as follows: class Program { public static void Main(string[] args) { var b = new B {Name = "BB"}; WriteFile<B>(@"C:\test.bin", b, true); var bb = ReadFile<B>(@"C:\test.bin", true); Console.WriteLine(b.Name == bb.Name); Console.ReadLine(); } public static T ReadFile<T>(string file, bool decrypt) { T bObj = default(T); var _binaryFormatter = new BinaryFormatter(); Stream buffer = null; using (var stream = new FileStream(file, FileMode.OpenOrCreate)) { if(decrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Read); } buffer = cs; } else buffer = stream; try { bObj = (T) _binaryFormatter.Deserialize(buffer); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } return bObj; } public static void WriteFile<T>(string file, T bObj, bool encrypt) { var _binaryFormatter = new BinaryFormatter(); Stream buffer; using (var stream = new FileStream(file, FileMode.Create)) { try { if(encrypt) { const string strEncrypt = "*#4$%^.++q~!cfr0(_!#$@$!&#&#*&@(7cy9rn8r265&$@&*E^184t44tq2cr9o3r6329"; byte[] dv = {0x12, 0x34, 0x56, 0x78, 0x90, 0xAB, 0xCD, 0xEF}; CryptoStream cs; DESCryptoServiceProvider des = null; var byKey = Encoding.UTF8.GetBytes(strEncrypt.Substring(0, 8)); using (des = new DESCryptoServiceProvider()) { cs = new CryptoStream(stream, des.CreateEncryptor(byKey, dv), CryptoStreamMode.Write); buffer = cs; } } else buffer = stream; _binaryFormatter.Serialize(buffer, bObj); buffer.Flush(); } catch(SerializationException ex) { Console.WriteLine(ex.Message); } } } } [Serializable] public class B { public string Name {get; set;} } It throws the serialization exception as follows The input stream is not a valid binary format. The starting contents (in bytes) are: 3F-17-2E-20-80-56-A3-2A-46-63-22-C4-49-56-22-B4-DA ...

    Read the article

  • Xcode / Interface Builder - better workflow from designer to coder?

    - by tbarbe
    Were dealing with some pretty custom UI elements while building our OSX / Cocoa and iPhone / IPad apps. I was wondering if anyone has good recommendations or tricks for getting a better workflow between UI designers and coders while using Xcode / Interface Builder? It seems that many things require programmatic settings with UI editing in Cocoa... if you stray from the pre-built UI elements then you can't really easily drag-drop build a UI... instead we end up handing off a design doc ( photoshop/illustrator ) and then the poor developer has to deal with recreating this masterpiece in code or by using interface builder - usually a combination of both. This work flow is leading us to not so great results and we have to re-iterate around the UI elements to get them to work better. We love CSS and / or Flash designer to developer workflow where the UI could look exactly as it should and the hand off to developer was more seamless. Is there anyone out there who has some tricks - or insights into getting better workflow when using tools like Xcode / Interface Builder and doing Cocoa apps?

    Read the article

  • ASP .net Dropdown list not saving the selected value to database

    - by user326010
    Hi In the following code i want to save the value selected by user from drop downlist into database. but whatever value is selected by user, first value of dropdown lsit is saved to database View <% =Html.DropDownList("lstUsertype", (SelectList)ViewData["UserTypeID"])%> Controller public ActionResult CreateUser() { UmUser _UmUser = new UmUser(); UMRepository _UMRepository = new UMRepository(); EvoLetDataContext db = new EvoLetDataContext(); ViewData["UserTypeID"] = new SelectList(_UMRepository.FillUserTypes(), "UserTypeID", "UserType",2); return View(_UmUser); } [AcceptVerbs(HttpVerbs.Post)] public ActionResult CreateUser(UmUser _umUser) { //try //{ if (ModelState.IsValid) { //try //{ UserRepository _UserRepository = new UserRepository(); _UserRepository.Add(_umUser); _UserRepository.Save(); return RedirectToAction("Details", new { id = _umUser.UserID }); /*} catch { ModelState.AddModelErrors(_umUser.GetRuleViolations()); }*/ } return View(); //} /*catch { return View(); }*/ }

    Read the article

  • downloaded zip file returns zero has 0 bytes as size

    - by Yaw Reuben
    I have written a Java web application that allows a user to download files from a server. These files are quite large and so are zipped together before download. It works like this: 1. The user gets a list of files that match his/her criteria 2. If the user likes a file and wants to download he/she selects it by checking a checkbox 3. The user then clicks "download" 4. The files are then zipped and stored on a server 5. The user this then presented with a page which contains a link to the downloadable zip file 6. However on downloading the zip file the file that is downloaded is 0 bytes in size I have checked the remote server and the zip file is being created properly, all that is left is to serve the file the user somehow, can you see where I might be going wrong, or suggest a better way to serve the zip file. The code that creates the link is: <% String zipFileURL = (String) request.getAttribute("zipFileURL"); %> <p><a href="<% out.print(zipFileURL); %> ">Zip File Link</a></p> The code that creates the zipFileURL variable is: public static String zipFiles(ArrayList<String> fileList, String contextRootPath) { //time-stamping Date date = new Date(); Timestamp timeStamp = new Timestamp(date.getTime()); Iterator fileListIterator = fileList.iterator(); String zipFileURL = ""; try { String ZIP_LOC = contextRootPath + "WEB-INF" + SEP + "TempZipFiles" + SEP; BufferedInputStream origin = null; zipFileURL = ZIP_LOC + "FITS." + timeStamp.toString().replaceAll(":", ".").replaceAll(" ", ".") + ".zip"; FileOutputStream dest = new FileOutputStream(ZIP_LOC + "FITS." + timeStamp.toString().replaceAll(":", ".").replaceAll(" ", ".") + ".zip"); ZipOutputStream out = new ZipOutputStream(new BufferedOutputStream( dest)); // out.setMethod(ZipOutputStream.DEFLATED); byte data[] = new byte[BUFFER]; while(fileListIterator.hasNext()) { String fileName = (String) fileListIterator.next(); System.out.println("Adding: " + fileName); FileInputStream fi = new FileInputStream(fileName); origin = new BufferedInputStream(fi, BUFFER); ZipEntry entry = new ZipEntry(fileName); out.putNextEntry(entry); int count; while ((count = origin.read(data, 0, BUFFER)) != -1) { out.write(data, 0, count); } origin.close(); } out.close(); } catch (Exception e) { e.printStackTrace(); } return zipFileURL; }

    Read the article

  • Java: downloading issue using BufferedInputStream, BufferedOutputStream

    - by nkr1pt
    When downloading a rar file from the internet with the code below, the downloaded file is larger than it actually is. Not sure what causes this? bis = new BufferedInputStream(urlConn.getInputStream()); bos = new BufferedOutputStream(new FileOutputStream(outputFile)); eventBus.fireEvent(this, new DownloadStartedEvent(item)); int read; byte[] buffer = new byte[2048]; while ((read = bis.read(buffer)) != -1) { bos.write(buffer); } eventBus.fireEvent(this, new DownloadCompletedEvent(item));

    Read the article

  • How are DX and DY coordinates calculated in flash?

    - by Meganlee1984
    I'm trying to update a clients site and the original developer left almost no instructions. The code is all updated through XML. Here is a sample of the code enter code here<FOLDER NAME="COMMERCIAL"> <GALLERY NAME="LOCANDA VERDE: New York"> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda1.jpg" DX="60" DY="40" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="300" CAPTION="Some photo" WIDTH="450" SRC="locanda2.jpg" DX="160" DY="80" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda3.jpg" DX="80" DY="260" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda4.jpg" DX="120" DY="60" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="393" CAPTION="Some photo" WIDTH="500" SRC="locanda5.jpg" DX="180" DY="100" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="433" SRC="locanda6.jpg" DX="60" DY="140" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> <IMG HEIGHT="500" CAPTION="Some photo" WIDTH="393" SRC="locanda7.jpg" DX="100" DY="200" LINKTEXT="" LINKURL="" INFOTEXT="SOHO, NEW YORK"/> </GALLERY>`enter code here It relates to this page: http://meyerdavis.com/ Click Commercial Click Laconda Verde New York. The xml file pulls a jpg from 2 places, one is a thumb nail that are all 60 x 60 and then one is the bigger sized image. The issue that I'm having is that I can't figure out how the DX and DY coordinates are generated for each item. Any help would be much appreciated. ` Edit: Here's the code from the comment below. platformblock.expandspeed = 0.02; platformblock.h = 450 - platformblock.dy1; //platformblock.h = 402; platformblock.dy2 = 0; platformblock.onResize(); /**/ platformblock.onEnterFrame = function() { this.dy1 += (48 - this.dy1)*this.expandspeed; this.h = 450 - this.dy1; if(this.expandspeed<0.3) { this.expandspeed += 0.02; } if(Math.abs(this.dy1-48)<0.2) { this.dy1 = 48; } if(this.platform._height==402 && this.dy1==48){ this.h = null; this.onResize(); this.onEnterFrame = null; } } platformblock._resizeto(800, 402, _root.play, _root, 0.08); titleblockcontainer.play(); /**/ stop();

    Read the article

  • Jetty RewriteHandler and RewriteRegexRule

    - by Justin
    I'm trying to rewrite a URL for a servlet. The URL gets rewritten correctly, but the context doesn't match after that. Any idea how to get this to work? RewriteHandler rewriteHandler = new RewriteHandler(); rewriteHandler.setRewriteRequestURI(true); rewriteHandler.setRewritePathInfo(true); rewriteHandler.setOriginalPathAttribute("requestedPath"); RewriteRegexRule rewriteRegexRule = new RewriteRegexRule(); rewriteRegexRule.setRegex("/r/([^/]*).*"); rewriteRegexRule.setReplacement("/r?z=$1"); rewriteHandler.addRule(rewriteRegexRule); ContextHandlerCollection contextHandlerCollection = new ContextHandlerCollection(); Context servletContext = new Context(contextHandlerCollection, "/"); servletContext.addServlet(new ServletHolder(new RedirectServlet()), "/r"); So basically /r/asdf gets rewritten to /r?z=asdf. However, the rewritten /r?z=asdf is now not processed by the servlet. Also, /r?z=asdf does work if called directly.

    Read the article

  • Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

    - by SidC
    Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

    Read the article

  • [Java/Android] Multidimensional array to ListView.. how?

    - by Yverman
    I have a query result set which I like to edit first and then put it to my ListView. Without editing my data first, I could use SimpleCursorAdapter like that: ListAdapter adapter = new SimpleCursorAdapter( this, R.layout.list_item, mCursor, new String[] { "address", "city" }, new int[] { R.id.address, R.id.zip_city }); this.setListAdapter(adapter); But now, I put everything in a multidimensional array like that: if(mCursor.isFirst()) { //create a new array String[][] listData = new String[mCursor.getCount()][3]; int i = 0; do { listData[i] = new String[] { mCursor.getString(mCursor.getColumnIndex("address")), mCursor.getString(mCursor.getColumnIndex("zip")) + " " + mCursor.getString(mCursor.getColumnIndex("city")), calculateDistance(Double.parseDouble(mCursor.getString(mCursor.getColumnIndex("diff")))) }; i++; } while(mCursor.moveToNext()); } So my problem is now, I have no idea how to put this to my ListView. Could someone help me here? Sorry for my bad english and Java knowledge. :)

    Read the article

< Previous Page | 396 397 398 399 400 401 402 403 404 405 406 407  | Next Page >