Search Results

Search found 10861 results on 435 pages for 'firefox ex'.

Page 417/435 | < Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >

  • Why aren't min-width and max-width working as I expect?

    - by Nathan Long
    I'm trying to adjust a CSS page layout using min-width and max-width. To simplify the problem, I made this test page. I'm trying it out in the latest versions of Firefox and Chrome with the same results. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Testing min-width and max-width</title> <style type="text/css"> div{float: left; max-width: 400px; min-width: 200px;} div.a{background: orange;} div.b{background: gray;} </style> </head> <body> <div class="a"> (Giant block of filler text here) </div> <div class="b"> (Giant block of filler text here) </div> </body> </html> Here's what I expect to happen: With the browser maximized, the divs sit side by side, each 400px wide: their maximum width Shrink the browser window, and they both shrink to 200px: their minimum width Further shrinking the browser has no effect on them Here's what actually happens, starting at step 2: Shrink the browser window, and as soon as they can't sit side-by-side at their max width, the second div drops below the first Further shrinking the browser makes them get narrower and narrower, as small as I can make the window So here's are my questions: What does max-width mean if the element will sooner hop down in the layout than go lower than its maximum width? What does min-width mean if the element will happily get narrower than that if the browser window keeps shrinking? Is there any way to achieve what I want: have these elements sit side-by-side, happily shrinking until they reach 200px each, and only then adjust the layout so that the second one drops down? And of course... What am I doing wrong?

    Read the article

  • JQUERY Ajax form, page refreshs & isn't supposed to in Safari, doesn't refresh in FF (works fine)

    - by nobosh
    I'm working on a AJAX form which lives in a JQUERY UI Dialog. It works great in FireFox, but for some reason, in safari it refreshes the page to: /? Please let me know if somethings wrong here? Thanks <div class="modal-container"> <form onsubmit="" action="" id="list-dialog-form" name="list-dialog-form"> <div id="modal-wrapper"> <br><br> <div class="modal-inputbar"> <span style="width: 100px;" class="inputbar-label"> <label>Edit List Name:</label> </span> <span style="width: 200px;" class="inputbar-input"> <input type="text" style="padding-right: 25px;" autocomplete="off" maxlength="140" id="listname" value="Untitled"> </span> </div> </div> <div id="modal-submit" class="modal-submit"> <span class="left delete-wrap"> <span onclick="deleteThisList(15);" class="delete"> </span> </span> <span style="line-height: 2em;" class="right"> <input type="hidden" value="15" id="tasklistID"> <input type="submit" value="update" id="dialogcloser"> <input type="button" onclick="$('#listeditdialog').dialog('close');" value="close" id="dialogcloser"> </span> </div> </form> </div> // Handles Updating the List Title $("#list-dialog-form").submit(function(){ // Ajax Spinner $("#listname").css("background", "url('/images/ajax-loader.gif') no-repeat scroll 98% center #FFF"); $.ajax({ url: '/ajax/listname-update/index.cfm', data: ({listname: $("#listname").val().trim(), tasklistID: $("#tasklistID").val()}), dataType: 'json', type: 'post', success: function( result ) { // Update the name in the top, project list $("#list-" + $("#tasklistID").val()).find('a').html($("#listname").val().trim()); $("#list-" + $("#tasklistID").val()).effect('highlight', {color: '#BDC1C7'}, 500); //Remove the Ajax Spinner $("#listname").css("background", "#FFF"); $("#listname").effect('highlight', {color: '#BDC1C7'}, 500); //close the dialog $('#listeditdialog').dialog('close'); } }); return false; });

    Read the article

  • Why does this JSON.parse code not work?

    - by SuZi
    I am trying to pass json encoded values from a php script to a, GnuBookTest.js, javascript file that initiates a Bookreader object and use the values i have passed in via the variable i named "result". The php script is sending the values like: <div id="bookreader"> <div id="BookReader" style="left:10px; right:10px; top:30px; bottom:30px;">x</div> <script type="text/javascript">var result = {"istack":"zi94sm65\/BUCY\/BUCY200707170530PM","leafCount":"14","wArr":"[893,893,893,893,893,893,893,893,893,893,893,893,893,893]","hArr":"[1155,1155,1155,1155,1155,1155,1155,1155,1155,1155,1155,1155,1155,1155]","leafArr":"[0,1,2,3,4,5,6,7,8,9,10,11,12,13]","sd":"[\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\",\"RIGHT\",\"LEFT\"]"}</script> <script type="text/javascript" src="http://localhost:8080/application/js/GnuBookTest.js"></script> </div> </div> and in the GnuBookTest.js file i am trying to use the values like: br = new BookReader(); // Return the width of a given page. br.getPageWidth = function(index) { return this.pageW[index]; } // Return the height of a given page. br.getPageHeight = function(index) { return this.pageH[index]; } br.pageW = JSON.parse(result.wArr); br.pageH = JSON.parse(result.hArr); br.leafMap = JSON.parse(result.leafArr); //istack is an url fragment for location of image files var istack = result.istack; . . . Using JSON.parse as i have written it above loads the Bookreader and uses my values correctly in a few web-browsers: Firefox, IE8, and desktop-Safari; but does not work at all in mac-Chrome, mobile-Safari, plus older versions of IE. Mobile safari keeps giving me a reference error msg: can't find variable: JSON. The other browsers just do not load the Bookreader and show the "x" instead, like they did not get the values from the php script. Where is the problem?

    Read the article

  • HTML wrapper div over embedded flash object cannot be "clickable" by jQuery

    - by Michael Mao
    Hi all: I've been trying to do as the client requested : redirect to campaign page then to destination page once a customer clicks on the top banner in swf format. You can check what's been done at :http://ausdcf.org If you are using Firefox, Chrome or Safari, I suspect you can reach the destination page. However, if you are using IE or Opera, I doubt it. I think to cause of such a weird problem is: The swf ojbects don't have a link to url, SO I have to hack the theme template file like this : <div id="header">'; /* * A quick and dirty way to put some swf into PHP, and rotate among them ... */ //available banners $banners = array( 'http://localhost/smf/flash/banner_fertalign_1.swf', 'http://localhost/smf/flash/banner_fertalign_2.swf', 'http://localhost/smf/flash/banner_fertalign_3.swf' ); //get random banner srand((double) microtime() * 1000000); $rand = rand(0,count($banners)-1); echo '<div id="top_banner_clickable">'; echo '<div id="top_banner_wrapper">'; echo '<object width="400" height="60">'; echo '<param name="wmode" value="transparent">'; echo '<embed wmode="transparent" src="'.$banners[$rand].'" '; echo 'width="400" height="60" type="application/x-shockwave-flash"'; echo 'pluginspage="http://www.macromedia.com/shockwave/download/index.cgi?P1_Prod_Version=ShockwaveFlash" />'; echo '</object>'; echo '</div>'; echo '</div>'; And the related jQuery code is like this: /* master.js */ $(document).ready(function() { $("#top_banner_clickable").click(function() { window.location ="http://ausdcf.org/campaign/"; }); }); I absolutely know nothing about Flash or embedded objects. I guess that's the cause of this problem. Plus, I don't know why it works with some browsers but not all... I even tried to add a z-index to the wrapper div in css like this: #top_banner_clickable { z-index : 100; } No this wouldn't do, either... Is there a way to go around this issue? Many thanks in advance.

    Read the article

  • ArgumentError: Error #1063: Argument count mismatch on com.flashden::MenuItem(). Expected 1, got 0.

    - by Suzanne
    I keep getting the below error only in firefox ArgumentError: Error #1063: Argument count mismatch on com.flashden::MenuItem(). Expected 1, got 0. at flash.display::Sprite/constructChildren() at flash.display::Sprite() at flash.display::MovieClip() at com.flashden::Preview() Below is my menu script: package com.flashden { import flash.display.MovieClip; import flash.text.; import flash.events.MouseEvent; import flash.events.; import flash.net.URLRequest; import flash.display.Loader; public class MenuItem extends MovieClip { private var scope; public var closedX :Number public static const OPEN_MENU = "openMenu"; function callLink(event:MouseEvent):void { public function MenuItem(scope) { // set scope to talk back to -------------------------------// this.scope = scope; // disable all items not to be clickable -------------------// txt_label.mouseEnabled = false; menuItemShine.mouseEnabled = false; menuItemArrow.mouseEnabled = false; // make background clip the item to be clicked (button) ----// menuItemBG.buttonMode = true; // add click event listener to the header background -------// menuItemBG.addEventListener(MouseEvent.CLICK, clickHandler); } private function clickHandler (e:MouseEvent) { scope.openMenuItem(this); } public function loadContent (contentURL:String) { var loader:Loader = new Loader(); configureListeners(loader.contentLoaderInfo); var request:URLRequest = new URLRequest(contentURL); loader.load(request); // place x position of content at the bottom of the header so the top is not cut off ----// loader.x = 35; // we add the content at level 1, because the background clip is at level 0 ----// addChildAt(loader, 0); } private function configureListeners(dispatcher:IEventDispatcher):void { dispatcher.addEventListener(Event.COMPLETE, completeHandler); dispatcher.addEventListener(HTTPStatusEvent.HTTP_STATUS, httpStatusHandler); dispatcher.addEventListener(Event.INIT, initHandler); dispatcher.addEventListener(IOErrorEvent.IO_ERROR, ioErrorHandler); dispatcher.addEventListener(Event.OPEN, openHandler); dispatcher.addEventListener(ProgressEvent.PROGRESS, progressHandler); dispatcher.addEventListener(Event.UNLOAD, unLoadHandler); } private function completeHandler(event:Event):void { //trace("completeHandler: " + event); // remove loader animation ----------------// removeChild(getChildByName("mc_preloader")); } private function httpStatusHandler(event:HTTPStatusEvent):void { // trace("httpStatusHandler: " + event); } private function initHandler(event:Event):void { //trace("initHandler: " + event); } private function ioErrorHandler(event:IOErrorEvent):void { //trace("ioErrorHandler: " + event); } private function openHandler(event:Event):void { //trace("openHandler: " + event); } private function progressHandler(event:ProgressEvent):void { //trace("progressHandler: bytesLoaded=" + event.bytesLoaded + " bytesTotal=" + event.bytesTotal); } private function unLoadHandler(event:Event):void { //trace("unLoadHandler: " + event); } } } Any idea why this is happening?

    Read the article

  • How to use Wordpress' http.php in external projects?

    - by NJTechGuy
    I am trying to parse data from a pipe-delimited text file hosted on another server which in turn will be inserted in a database. My host (1and1) disabled allow_url_fopen in php.ini I guess. Error message : Warning: fopen() [function.fopen]: URL file-access is disabled in the server configuration in Code : <? // make sure curl is installed if (function_exists('curl_init')) { // initialize a new curl resource $ch = curl_init(); // set the url to fetch curl_setopt($ch, CURLOPT_URL, 'http://abc.com/data/output.txt'); // don't give me the headers just the content curl_setopt($ch, CURLOPT_HEADER, 0); // return the value instead of printing the response to browser curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1); // use a user agent to mimic a browser curl_setopt($ch, CURLOPT_USERAGENT, 'Mozilla/5.0 (Windows; U; Windows NT 5.1; en-US; rv:1.7.5) Gecko/20041107 Firefox/1.0'); $content = curl_exec($ch); // remember to always close the session and free all resources curl_close($ch); } else { // curl library is not installed so we better use something else } //$contents = fread ($fd,filesize ($filename)); //fclose ($fd); $delimiter = "|"; $splitcontents = explode($delimiter, $contents); $counter = ""; ?> <font color="blue" face="arial" size="4">Complete File Contents</font> <hr> <? echo $contents; ?> <br><br> <font color="blue" face="arial" size="4">Split File Contents</font> <hr> <? foreach ( $splitcontents as $color ) { $counter = $counter+1; echo "<b>Split $counter: </b> $colorn<br>"; } ?> Wordpress has this cool http.php file. Is there a better way of doing it? If not, how do I use http.php for this task? Thank you guys..

    Read the article

  • XPointers in SVG

    - by Nycto
    I've been trying to get XPointer URIs working in an SVG file, but haven't had any luck so far. After trying something more complicated and failing, I simplified it down to just referencing an ID. However, this still fails. The spec seems pretty clear about this implementation: http://www.w3.org/TR/SVG/struct.html#URIReference I found an example online of what should be a working XPointer reference within an svg document. Here is the Original. Here is the version I copied out: <?xml version="1.0" standalone="no"?> <!DOCTYPE svg PUBLIC "-//W3C//DTD SVG 1.1//EN" "http://www.w3.org/Graphics/SVG/1.1/DTD/svg11.dtd"> <svg width="500" height="200" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink"> <defs> <rect id="simpleRect" width="100px" height="75px"/> </defs> <use xlink:href="#simpleRect" x="50" y="50" style="fill:red"/> <use xlink:href="#xpointer(id('simpleRect'))" x="250" y="50" style="fill:yellow"/> </svg> This should display two rectangles... one red and one yellow. I tried rendering with Firefox 3.6 and Inkscape 0.47. No success. Only the Red rectangle shows. What am I missing? Thanks for any help you can offer

    Read the article

  • Issue while trying to give a floating effect to a footer bar in IE

    - by Shailesh
    Hi, I'm trying to put a footer bar at the bottom of the browser no matter what the length of the content is. The footer bar should always be visible to the user and should be on the top layer. Following is my code: <html> <head> <style type="text/css"> #wrapper { width: 910px; margin: 0 auto; padding: 0px 20px 50px 20px; text-align: left; } #footer-wrapper { -moz-background-clip:border; -moz-background-inline-policy:continuous; -moz-background-origin:padding; bottom:0; clear:both; font-size:11px !important; left:0; position:fixed; white-space:nowrap; width:100%; z-index:8000; } </style> <script> var counter = 0; function addContent(ctr) { document.getElementById(ctr).innerHTML=document.getElementById (ctr).innerHTML+" dynaContent"+counter; counter++; } </script> </head> <body> <div> <div><input type="button" onclick="addContent('wrapper')" value="Add dynaContent" /></div> <div id="wrapper" style="color:#FFFFFF; background-color: #111111;"> STATIC TEXT - HEADER-WRAPPER </div> <div style="color:#FFFFFF;background-color: #555555;">STATIC TEXT - FOOTER-WRAPPER</div> </div> </body> </html> It's working fine in Mozilla Firefox and giving the intended results, but, in IE, the footer bar always sticks just under the header. Please help. Thanks in advance, Shailesh.

    Read the article

  • Injecting jQuery into a page fails when using Google AJAX Libraries API

    - by jakemcgraw
    I'd like to inject jQuery into a page using the Google AJAX Libraries API, I've come up with the following solution: http://my-domain.com/inject-jquery.js: ;((function(){ // Call this function once jQuery is available var func = function() { jQuery("body").prepend('<div>jQuery Rocks!</div>'); }; // Detect if page is already using jQuery if (!window.jQuery) { var done = false; var head = document.getElementsByTagName('head')[0]; var script = document.createElement("script"); script.src = "http://www.google.com/jsapi"; script.onload = script.onreadystatechange = function(){ // Once Google AJAX Libraries API is loaded ... if (!done && (!this.readyState || this.readyState == "loaded" || this.readyState == "complete")) { done = true; // ... load jQuery ... window.google.load("jquery", "1", {callback:function(){ jQuery.noConflict(); // ... jQuery available, fire function. func(); }}); // Prevent IE memory leaking script.onload = script.onreadystatechange = null; head.removeChild(script); } } // Load Google AJAX Libraries API head.appendChild(script); // Page already using jQuery, fire function } else { func(); } })()); The script would then be included in a page on a separate domain: http://some-other-domain.com/page.html: <html> <head> <title>This is my page</title> </head> <body> <h1>This is my page.</h1> <script src="http://my-domain.com/inject-jquery.js"></script> </body> </html> In Firefox 3 I get the following error: Module: 'jquery' must be loaded before DOM onLoad! jsapi (line 16) The error appears to be specific to the Google AJAX Libraries API, as I've seen others use a jQuery bookmarklet to inject jQuery into the current page. My question: Is there a method for injecting the Google AJAX Libraries API / jQuery into a page regardless of the onload/onready state?

    Read the article

  • Issues loading Jquery (Galleria) script from inside an i-frame (beginner javascript?)

    - by 103188530284789248582
    Hello, first of all - I'm not entirely new to javascript, but am not fluent in it as I am with html and css, and am especially new to jQuery... so please excuse me if this questions seems easy or obvious, but after days of google I still have no solution to the problem... using jQuery 1.4.2.min, jQuery-ui-1.8.1 .... the site in question: http://homecapture.ca/sets/project_index.html The scenario: I have a tabbed menu generated from an unordered list, when a menu item is clicked it reveals an iframe which links to the page containing an image gallery. I am using jQuery UI tabs for the tabbed menu, and the galleries to which I'm linking are jQuery Galleria pages, automatically generated with Jalbum. The problem: The galleria plug-in only works normally from inside of the containing iframe in Chrome, has inconsistent behaviour in IE8 (seems to work in my local copy, but won't load properly online), and is not loaded properly in Firefox. Instead of displaying a thumbnail area and the first large image, the Galleria page shows the first thumbnail only, then when it is clicked the image it links to, but if you right-click and go Back, the iframe content shows up as a properly rendered Galleria page. Jalbum generates more script in the < head of the page in addition to linking to jquery and the galleria plug-in. All of it seems to be in charge of the gallery navigation , and I have relocated it to the < body of the page, in an effort to make it load after the parent page scripts, and together with the gallery content. At this point I am not sure what else I could do to solve the problem, without digging around in all or some of the library and pluging .js files (which I am not knowledgeable enough to do without some pointers). Has anyone dealt with a similar issue? I'm seeing some solutions for manipulating iframe content from a parent page with jQuery on here, is that what I should be researching instead? Thanks in advance for all the help! ps. I tried posting some code, but it seems I do not have enough 'reputation' for things to work right on here either :)

    Read the article

  • Loop append div and repeat

    - by Diego Vieira
    I have this code <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> But i want generate dynamically, how i do that? Ex.: i have 4 rounds, this would be the generated code <div class="round-4-top"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> <div class="round-4-bottom"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> I try using TagBuilder in MVC C# but I can not do. What should happen is, if you are 3 rounds, adding he should go inside each div is like the example above. Any idea how can I develop it?

    Read the article

  • JavaScript + Maths: Image zoom with CSS3 Transforms, How to set Origin? (with example)

    - by Sunday Ironfoot
    My Math skills really suck! I'm trying to implement an image zoom effect, a bit like how the Zoom works with Google Maps, but with a grid of fix position images. I've uploaded an example of what I have so far here: http://www.dominicpettifer.co.uk/Files/MosaicZoom.html (uses CSS3 transforms so only works with Firefox, Opera, Chrome or Safari) Use your mouse wheel to zoom in/out. The HTML source is basically an outer div with an inner-div, and that inner-div contains 16 images arranged using absolute position. It's going to be a Photo Mosaic basically. I've got the zoom bit working using CSS3 transforms: $(this).find('div').css('-moz-transform', 'scale(' + scale + ')'); ...however, I'm relying on the mouse X/Y position on the outer div to zoom in on where the mouse cursor is, similar to how Google Maps functions. The problem is that if you zoom right in on an image, move the cursor to the bottom/left corner and zoom again, instead of zooming to the bottom/left corner of the image, it zooms to the bottom/left of the entire mosaic. This has the effect of appearing to jump about the mosaic as you zoom in closer while moving the mouse around, even slightly. That's basically the problem, I want the zoom to work exactly like Google Maps where it zooms exactly to where your mouse cursor position is, but I can't get my head around the Maths to calculate the transform-origin: X/Y values correctly. Please help, been stuck on this for 3 days now. Here is the full code listing for the mouse wheel event: var scale = 1; $("#mosaicContainer").mousewheel(function(e, delta) { if (delta > 0) { scale += 1; } else { scale -= 1; } scale = scale < 1 ? 1 : (scale > 40 ? 40 : scale); var x = e.pageX - $(this).offset().left; var y = e.pageY - $(this).offset().top; $(this).find('div').css('-moz-transform', 'scale(' + scale + ')') .css('-moz-transform-origin', x + 'px ' + y + 'px'); return false; });

    Read the article

  • How do you set the ZIndex on a TabItem?

    - by CC Inc
    I am wanting my TabItems to be positioned in between a border to achieve a "binder" affect, like this: However, I cannot seem to achieve this affect using ZIndex with my borders and each TabItem item. Currently, I get this result: Using this code: <Border CornerRadius="40,40,0,0" Background="Orange" Margin="8,31,2,21" Grid.RowSpan="4" Panel.ZIndex="-3" ></Border> <Border CornerRadius="40,40,0,0" Background="Red" Margin="6,29,4,23" Grid.RowSpan="4" Panel.ZIndex="-1"></Border> <Border CornerRadius="40,40,0,0" Background="Yellow" Margin="3,26,7,26" Grid.RowSpan="4" Panel.ZIndex="1"></Border> <Border CornerRadius="40,40,0,0" Background="DarkRed" Margin="1,23,9,29" Grid.RowSpan="4" Panel.ZIndex="3"></Border> <Border CornerRadius="40,40,0,0" Background="OrangeRed" Margin="-2,19,12,33" Grid.RowSpan="4" Name="border1" Panel.ZIndex="5"></Border> <TabControl Name="tabControl1" TabStripPlacement="Bottom" Background="Transparent" Margin="-2,32,15,6" Grid.RowSpan="4" BorderThickness="0"> <TabItem Name="tabItem1" Margin="0,0,0,1" Panel.ZIndex="4"> <TabItem.Header> <TextBlock> Main</TextBlock> </TabItem.Header> </TabItem> <TabItem Name="tabItem2" Panel.ZIndex="5"> <TabItem.Header> <TextBlock Height="13" Width="91"> Internet Explorer</TextBlock> </TabItem.Header> </TabItem> <TabItem Name="tabItem3" Panel.ZIndex="0"> <TabItem.Header> <TextBlock> Firefox</TextBlock> </TabItem.Header> </TabItem> <TabItem Name="tabItem4" Panel.ZIndex="-2"> <TabItem.Header> <TextBlock> Chrome</TextBlock> </TabItem.Header> </TabItem> <TabItem Name="tabItem5" Panel.ZIndex="-4"> <TabItem.Header> <TextBlock> Opera</TextBlock> </TabItem.Header> </TabItem> </TabControl> However, this does not achieve the desired affect. How can I do this in WPF? Is TabControl the best choice?

    Read the article

  • Css simple style dont work on IE but yes in any other browser

    - by DomingoSL
    Hello guys, i have a simple css file called Titulos.css who contain this: h1 { font: 50px Tahoma, Helvetica, Arial, Sans-Serif; text-align: center; color: #111; text-shadow: 0px 2px 3px #555; } h2 { font: 14px Tahoma, Helvetica, Arial, Sans-Serif; text-align: center; color: #CCC; text-shadow: 0px 1px 2px #555; } h3 { font: 10px Tahoma, Helvetica, Arial, Sans-Serif; text-align: center; color: #CCC; } b1 { font: 16px Tahoma, Helvetica, Arial, Sans-Serif; color: #DDD; } b2 { font: 10px Tahoma, Helvetica, Arial, Sans-Serif; color: #F9F7ED; } .caja { width: 690px; height: 40px; background-color: transparent; border: 0px solid #000000; font-size:x-large; color: #222; font-family: 'Trebuchet MS', 'Lucida Sans Unicode', 'Lucida Grande', 'Lucida Sans', Arial, sans-serif; font-weight: bold;" size="299"; } .style1 { text-align: right; } And a page who call this file like: <link rel="stylesheet" type="text/css" href="LIB/titulos.css" /> Later in this page im trying to use some of the styles like: <div id="todo" align="center" > <div id="cabeza" style="width:850px;height:100px"> </div> <div id="contenido" style="width:850px;height:420px;background-image: url(IMG/cuadro.png)" > <div id="titulo" style="width:765px;height:75px;padding-top: 18px;margin: auto;text-align: left;"> <b1>Bienvenido <b><?php echo($username); ?></b></b1><br> <?php $check = mysql_query("SELECT * FROM sms WHERE ref = '".$username."' ORDER BY fecha DESC LIMIT 0, 1") or die(mysql_error()); while($info = mysql_fetch_array( $check )) { echo("<b1> Tu ultimo mensaje enviado fue: </b1><b2>" . $info['texto'] . " enviado el " . $info['fecha'] . "</b2>"); That only a part of the code of course, the think is, Firefox and Chrome display the code above like this: that as you can see have the styles applied. But when i see the code from IE 8 (even 7 or 6) this is what you see: So, what do you think?

    Read the article

  • javascript simple object creation test: opera leaks?

    - by joe
    Hi, I am trying to figure out certain memory leak conditions in javascript on a few browsers. Currently I'm only testing FF 3.6, Opera 10.10, and Safari 4.0.3. I've started with a fairly simple test, and can confirm no memory leaks in Firefox and Safari. But Opera just takes memory and never gives it back. What gives? Here's the test: <html> <head> <script type="text/javascript"> window.onload = init; //window.onunload = cleanup; var a=[]; function init() { var d = document.createElement('div'); d.innerHTML = "page loading..."; document.body.appendChild(d); for (var i=0; i<400000; i++) { a[i] = new Obj("xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx"); } d.innerHTML = "PAGE LOADED"; } function cleanup() { for (var i=0; i<400000; i++) { a[i] = null; } } function Obj(msg) { this.msg=msg; } </script> </head> <body> </body> </html> I shouldn't need the cleanup() call on window.unload, but tried that also. No luck. As you can see this is simple JS, no circular DOM links, no closures. I monitor the memory usage using 'top' on Mac 10.4.11. Memory usage spikes up on page load, as expected. In FF and Safari reloading the page does not use any further memory, and all memory is returned when the window (tab) is closed. In Opera, memory spikes on load, and seems to also spike further on each reload (but not always...). But regardless of reload, memory never goes back down below the initial load spike. I had hoped this was a no-brainer test that all browsers would pass, so I could move on to more "interesting" conditions. Am I doing something wrong here? Or is this a known Opera issue? Thanks! -joe

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • AJAX response not valid in C++ but Apache

    - by fehergeri
    I want to make a server written in C++ to power my game. I learned the basics of sockets and wrote a basic chat program that worked well. Now I want to create an HTTP server like Apache, but only for the AJAX request-response part. I think just for the beginning i copied one Apache response text, and i sent the exact response with the C++ server program. The problem that is that the browser (Firefox) connnects to the apache and everything works fine, except all of the requests get a correct response. But if i send this with the C++ client, then FireBug tells me that the response status is OK (200) but there is no actual response text. (How is this possible?) This response-text is exactly the same what apache sends. I made a bit-bit comparison and they were the same. The php file wich is the original response <?php echo "AS";echo rand(0,9); ?> And the origional source code: Socket.h http://pastebin.com/bW9qxtrR Socket.cpp http://pastebin.com/S3c8RFM7 main.cpp http://pastebin.com/ckExuXsR index.html http://pastebin.com/mcfEEqPP < this is the requester file. ajax.js http://pastebin.com/uXJe9hVC benchmark.js http://pastebin.com/djSYtKg9 jQuery is not needed. The main.cpp there is lot of trash code like main3 and main4 functions, these do not affect the result. I know that the response stuff in the C++ code is not really good because the connection closing is not the best; I will fix that later now I want to send a success response first. UPDATE: now i tested today a lot again and i find out there is no problem with the socket. I used the fiddler program to capture the the good answer and to capture the bad. They were the same. After this i turned off my socket application, and forced fiddler to auto respond, and the answer from the 'bad' answer still bat. So after that i replaced the bad with the good and nothing happedned. The bad answer with the good text still bad on the :8888 port but the other on the original :80 port was good, but they were absolutly the same and the same program sended it (fiddler) i think there is something missing if the response is not on the same server address (even not the same port). UPDATE: oh my god! i cant send ajax request to a remote server. now i know this.

    Read the article

  • problem in saving drag&drop object in database

    - by Mac Taylor
    hey guys i made a script inspired by wordpress widgets'page to drag&drop blocks of my sites but problem is in saving the position after droping this is jquery code , i used to do the above target : <script type="text/javascript" >$(function(){ $('.widget') .each(function(){ $(this).hover(function(){ $(this).find('h4').addClass('collapse'); }, function(){ $(this).find('h4').removeClass('collapse'); }) .find('h4').hover(function(){ $(this).find('.in-widget-title').css('visibility', 'visible'); }, function(){ $(this).find('.in-widget-title').css('visibility', 'hidden'); }) .click(function(){ $(this).siblings('.widget-inside').toggle(); //Save state on change of collapse state of panel updateWidgetData(); }) .end() .find('.in-widget-title').css('visibility', 'hidden'); }); $('.column').sortable({ connectWith: '.column', handle: 'h4', cursor: 'move', placeholder: 'placeholder', forcePlaceholderSize: true, opacity: 0.4, start: function(event, ui){ //Firefox, Safari/Chrome fire click event after drag is complete, fix for that if($.browser.mozilla || $.browser.safari) $(ui.item).find('.widget-inside').toggle(); }, stop: function(event, ui){ ui.item.css({'top':'0','left':'0'}); //Opera fix if(!$.browser.mozilla && !$.browser.safari) updateWidgetData(); } }) .disableSelection(); }); function updateWidgetData(){ var items=[]; $('.column').each(function(){ var columnId=$(this).attr('id'); $('.widget', this).each(function(i){ var collapsed=0; if($(this).find('.widget-inside').css('display')=="none") collapsed=1; //Create Item object for current panel var item={ id: $(this).attr('id'), collapsed: collapsed, order : i, column: columnId }; //Push item object into items array items.push(item); }); }); //Assign items array to sortorder JSON variable var sortorder={ items: items }; //Pass sortorder variable to server using ajax to save state $.post('updatePanels.php', 'data='+$.toJSON(sortorder), function(response){ if(response=="success") $("#console").html('<div class="success">Saved</div>').hide().fadeIn(1000); setTimeout(function(){ $('#console').fadeOut(1000); }, 2000); }); } </script> and a simple php file but problem is its not sending data to target php file is there anything wrong with my code ?

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • Trying to style the first tbody different than others without introducing another class.

    - by mwiik
    I have a table with multiple tbody's, each of which has a classed row, and I want it so that the classed row in the first tbody has style differences, but am unable to get tbody:first-child to work in any browser. Perhaps I am missing something, or maybe there is a workaround. Ideally, I would like to provide the programmers with a single tbody section they can use as a template, but will otherwise have to add a class to the first tbody, making for an extra test in the programming. The html is straightforward: <tbody class="subGroup"> <tr class="subGroupHeader"> <th colspan="8">All Grades: Special Education</th> <td class="grid" colspan="2"><!-- contains AMO line --></td> <td><!-- right 100 --></td> </tr> <tr>...</tr> <!-- several more rows of data --> </tbody> There are several tbody's per table. I want to style the th and td's within tr.subGroupHeader in the very first tbody differently than the rest. Just to illustrate, I want to add a border-top to the tr.subGroupHeader cells. The tr.subGroupHeader will be styled with a border-top, such as: table.databargraph.continued tr.subGroupHeader th, table.databargraph.continued tr.subGroupHeader td { border-top: 6px solid red; } For the first tbody, I am trying: table.databargraph.continued tbody:first-child tr.subGroupHeader th { border-top: 6px solid blue ; } However, this doesn't seem to work in any browser (I've tested in Safari, Opera, Firefox, and PrinceXML, all on my Mac) Curiously, the usually excellent Xyle Scope tool indicates that the blue border should be taking precedence, though it obviously is not. See the screenshot at http://s3.amazonaws.com/ember/kUD8DHrz06xowTBK3qpB2biPJrLWTZCP_o.png This screenshot shows (top left) the American Indian th is selected, and (bottom right), shows (via black instead of gray text for the css declaration), that, indeed, the blue border should be given precedence. Yet the border is red. I may be missing something fundamental, like pseudo-classes not working for tbodys at all... This really only needs to work in PrinceXML, and maybe Safari so I can see what I'm doing with webkit-based css tools. Note I did try a selector like tr.subGroupHeader:first-child, but such tr's apparently consider the tbody the parent (as I would suspect), thus made every border blue. Thanks...

    Read the article

  • Problem with jQuery accordion and cookies

    - by rayne
    I have a jQuery accordion from this site and edited for my purposes, but the accordion only works in Firefox (not Safari or Chrome) and the cookies aren't being set correctly. This is the jQuery: function initMenus() { $('#sidebar .letter_index').hide(); $.each($('#sidebar .letter_index'), function() { var cookie = $.cookie(this.id); if (cookie === null || String(cookie).length < 1) { $('#sidebar .letter_index:first').show(); } else { $('#' + this.id + ' .' + cookie).next().show(); } }); $('#sidebar .letter_head').click(function() { var checkElement = $(this).next(); var parent = this.parentNode.parentNode.id; if ((checkElement.is('.letter_index')) && (!checkElement.is(':visible'))) { $('#' + parent + ' .letter_index:visible').slideUp('normal'); if ((String(parent).length > 0) && (String(this.className).length > 0)) { // not working - wie ändert man das this.class so das die class abc oder def gesetzt wird anstatt this?! $.cookie(parent, this.className); } checkElement.slideDown('normal'); return false; } } ); } $(document).ready(function() {initMenus();}); This is how my HTML looks (sample item): <div id="sidebar"> <h2 class="letter_head"><a href="#" class="ABC">ABC</h2> <ul class="letter_index"> <li>Abc</li> <li>Bcd</li> </ul> </div> I can't find the problem why the script won't work in Safari and Chrome. I also don't know how to tell it to use the class of the a inside the h2 as the cookie value. (Currently the cookie is set as $.cookie(parent, this.className);, which produces cookies with the name container (the div above #sidebar) and the value letter_head. It needs to be something like 'sidebar' and 'ABC', 'DEF' and so on. Thanks in advance!

    Read the article

  • How do I display a jquery dialog box before the entire page is loaded?

    - by obarshay
    On my site a number of operations can take a long time to complete. When I know a page will take a while to load, I would like to display a progress indicator while the page is loading. Ideally I would like to say something along the lines of: $("#dialog").show("progress.php"); and have that overlay on top of the page that is being loaded (disappearing after the operation is completed). Coding the progress bar and displaying progress is not an issue, the issue is getting a progress indicator to pop up WHILE the page is being loaded. I have been trying to use JQuery's dialogs for this but they only appear after the page is already loaded. This has to be a common problem but I am not familiar enough with JavaScript to know the best way to do this. Here's simple example to illustrate the problem. The code below fails to display the dialog box before the 20 second pause is up. I have tried in Chrome and Firefox. In fact I don't even see the "Please Wait..." text. Here's the code I am using: <html> <head> <link type="text/css" href="http://jqueryui.com/latest/themes/base/ui.all.css" rel="stylesheet" /> <script type="text/javascript" src="http://jqueryui.com/latest/jquery-1.3.2.js"></script> <script type="text/javascript" src="http://jqueryui.com/latest/ui/ui.core.js"></script> <script type="text/javascript" src="http://jqueryui.com/latest/ui/ui.dialog.js"></script> </head> <body> <div id="please-wait">My Dialog</div> <script type="text/javascript"> $("#please-wait").dialog(); </script> <?php flush(); echo "Waiting..."; sleep(20); ?> </body> </html>

    Read the article

  • PHP miniwebsever file download

    - by snikolov
    $httpsock = @socket_create_listen("9090"); if (!$httpsock) { print "Socket creation failed!\n"; exit; } while (1) { $client = socket_accept($httpsock); $input = trim(socket_read ($client, 4096)); $input = explode(" ", $input); $input = $input[1]; $fileinfo = pathinfo($input); switch ($fileinfo['extension']) { default: $mime = "text/html"; } if ($input == "/") { $input = "index.html"; } $input = ".$input"; if (file_exists($input) && is_readable($input)) { echo "Serving $input\n"; $contents = file_get_contents($input); $output = "HTTP/1.0 200 OK\r\nServer: APatchyServer\r\nConnection: close\r\nContent-Type: $mime\r\n\r\n$contents"; } else { //$contents = "The file you requested doesn't exist. Sorry!"; //$output = "HTTP/1.0 404 OBJECT NOT FOUND\r\nServer: BabyHTTP\r\nConnection: close\r\nContent-Type: text/html\r\n\r\n$contents"; function openfile() { $filename = "a.pl"; $file = fopen($filename, 'r'); $filesize = filesize($filename); $buffer = fread($file, $filesize); $array = array("Output"=$buffer,"filesize"=$filesize,"filename"=$filename); return $array; } $send = openfile(); $file = $send['filename']; $filesize = $send['filesize']; $output = 'HTTP/1.0 200 OK\r\n'; $output .= "Content-type: application/octet-stream\r\n"; $output .= 'Content-Disposition: attachment; filename="'.$file.'"\r\n'; $output .= "Content-Length:$filesize\r\n"; $output .= "Accept-Ranges: bytes\r\n"; $output .= "Cache-Control: private\n\n"; $output .= $send['Output']; $output .= "Content-Transfer-Encoding: binary"; $output .= "Connection: Keep-Alive\r\n"; } socket_write($client, $output); socket_close ($client); } socket_close ($httpsock); Hello, I am snikolov i am creating a miniwebserver with php and i would like to know how i can send the client a file to download with his browser such as firefox or internet explore i am sending a file to the user to download via sockets, but the cleint is not getting the filename and the information to download can you please help me here,if i declare the file again i get this error in my server Fatal error: Cannot redeclare openfile() (previously declared in C:\User s\fsfdsf\sfdsfsdf\httpd.php:31) in C:\Users\hfghfgh\hfghg\httpd.php on li ne 29, if its possible, i would like to know if the webserver can show much banwdidth the user request via sockets, perl has the same option as php but its more hardcore than php i dont understand much about perl, i even saw that a miniwebserver can show much the client user pulls from the server would it be possible that you can assist me with this coding, i much aprreciate it thank you guys.

    Read the article

  • UTF-8 GET using Indy 10.5.8.0 and Delphi XE2

    - by Bogdan Botezatu
    I'm writing my first Unicode application with Delphi XE2 and I've stumbled upon an issue with GET requests to an Unicode URL. Shortly put, it's a routine in a MP3 tagging application that takes a track title and an artist and queries Last.FM for the corresponding album, track no and genre. I have the following code: function GetMP3Info(artist, track: string) : TMP3Data //<---(This is a record) var TrackTitle, ArtistTitle : WideString; webquery : WideString; [....] WebQuery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getcorrection&api_key=' + apikey + '&artist=' + artist + '&track=' + track); //[processing the result in the web query, getting the correction for the artist and title] // eg: for artist := Bucovina and track := Mestecanis, the corrected values are //ArtistTitle := Bucovina; // TrackTitle := Mestecani?; //Now here is the tricky part: webquery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=' + apikey + '&artist=' + unescape(ArtistTitle) + '&track=' + unescape(TrackTitle)); //the unescape function replaces spaces (' ') with '+' to comply with the last.fm requests [some more processing] end; The webquery looks in a TMemo just right (http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestecani?) Yet, when I try to send a GET() to the webquery using IdHTTP (with the ContentEncoding property set to 'UTF-8'), I see in Wireshark that the component is GET-ing the data to the ANSI value '/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni?' Here is the full headers for the GET requests and responses: GET /2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni? HTTP/1.1 Content-Encoding: UTF-8 Host: ws.audioscrobbler.com Accept: text/html, */* Accept-Encoding: identity User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.23) Gecko/20110920 Firefox/3.6.23 SearchToolbar/1.22011-10-16 20:20:07 HTTP/1.0 400 Bad Request Date: Tue, 09 Oct 2012 20:46:31 GMT Server: Apache/2.2.22 (Unix) X-Web-Node: www204 Access-Control-Allow-Origin: * Access-Control-Allow-Methods: POST, GET, OPTIONS Access-Control-Max-Age: 86400 Cache-Control: max-age=10 Expires: Tue, 09 Oct 2012 20:46:42 GMT Content-Length: 114 Connection: close Content-Type: text/xml; charset=utf-8; <?xml version="1.0" encoding="utf-8"?> <lfm status="failed"> <error code="6"> Track not found </error> </lfm> The question that puzzles me is am I overseeing anything related to setting the property of the tidhttp control? How can I stop the well-formated URL i'm composing in the application from getting wrongfully sent to the server? Thanks.

    Read the article

< Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >