Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 417/1731 | < Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >

  • please help me in this query

    - by testkhan
    I have three tables (user, friends, posts) and two users (user1 and user2). When user1 adds user2 as friend then user1 can see the posts of user2 just like on Facebook. But only the posts after the date when user1 added user2 as friend. My query is like this: $sql = mysql_query("SELECT * FROM posts p JOIN friends f ON p.currentuserid = f.friendid AND p.time >= f.friend_since OR p.currentuserid='user1id' WHERE f.myid='user1id' ORDER BY p.postid DESC LIMIT 20"); it is working all the way fine but with a little problem.....!! it displays user2, user3 (all the users as friends of user1) posts for single time but shows user1 posts multiple.......i.e user2. hi user1. userssfsfsfsfsdf user1. userssfsfsfsfsdf user3. dddddddd user1. sdfsdsdfsdsfsf user1. sdfsdsdfsdsfsf but i in database it is single entry/post why it is happening........!! How can I fix it?

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Must all Concurrent Data Store (CDB) locks be explicitly released when closing a Berkeley DB?

    - by Steve Emmerson
    I have an application that comprises multiple processes each accessing a single Berkeley DB Concurrent Data Store (CDB) database. Each process is single-threaded and does no explicit locking of the database. When each process terminates normally, it calls DB-close() and DB_ENV-close(). When all processes have terminated, there should be no locks on the database. Episodically, however, the database behaves as if some process was holding a write-lock on it even though all processes have terminated normally. Does each process need to explicitly release all locks before calling DB_ENV-close()? If so, how does the process obtain the "locker" parameter for the call to DB_ENV-loc_vec()?

    Read the article

  • Rails relation select

    - by Dimitar Vouldjeff
    Hi, I have the following models: class User < ActiveRecord::Base has_many :results, :dependent => :destroy has_many :participants, :dependent => :destroy has_many :courses, :through => :participants end class Course < ActiveRecord::Base has_many :tests, :dependent => :destroy has_many :participants, :dependent => :destroy has_many :users, :through => :participants end class Result < ActiveRecord::Base belongs_to :test belongs_to :user end class Test < ActiveRecord::Base belongs_to :course has_many :results, :dependent => :destroy end The Idea is that a user has_and_belongs_to_many courses, the course has_many tests, and every test has_and_belongs_to_many users (results). So what is the best query to select every Result from a single Course (not test), and also the query to select every Result from a single Course, but from one user. Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to decide on going into management?

    - by Rob Wells
    I read the transcript of a speech by Richard Hamming included as a part of this SO question and the speech had a quote that got me thinking about when someone should move into development. When your vision of what you want to do is what you can do single-handedly, then you should pursue it. The day your vision, what you think needs to be done, is bigger than what you can do single-handedly, then you have to move toward management. And the bigger the vision is, the farther in management you have to go. Any other suggestions as to how you can decide if you want to move away from the coal face and into management?

    Read the article

  • C# Lambda Problem

    - by Chris Klepeis
    Probably something simple, but as I'm new to lambda expressions, the problem evades me: m => m.contactID == contactID && m.primaryAddress == true && (m.addressTypeID == 2 || m.addressTypeID == 3) I tried to use that lambda expression but I receive an invalid operator. Is there a way to simplify this so that it would work? Edit: The equivolent sql query would be: SELECT * FROM Contact WHERE contactID = 3 AND primaryAddress = 1 AND (addressTypeID = 2 OR addressTypeID = 3) I have a repository function defined like so: public E Single(Expression<Func<E, bool>> where) { return objectSet.Single<E>(where); } I'm passing the lambda expression above into this function. Invalid operator error.

    Read the article

  • acts_as_solr returns all rows in the database when using the model as search query

    - by chris Chan
    In our application we're using acts_as_solr for search. Everything seems to be running smoothly except for the fact that using the model name as the search query returns every single row in the table. For example, let's say we have a users table. We specify acts_as_solr in our model to search the fields first name, last name and handle acts_as_solr :fields = [:handle, :lname, :fname]. When you use "user" as the search term it returns every single user in the system, or every row in the database as a result. Has anyone else run into this?

    Read the article

  • Create fulltext index on a VIEW

    - by kylex
    Is it possible to create a full text index on a VIEW? If so, given two columns column1 and column2 on a VIEW, what is the SQL to get this done? The reason I'd like to do this is I have two very large tables, where I need to do a FULLTEXT search of a single column on each table and combine the results. The results need to be ordered as a single unit. Suggestions? EDIT: This was my attempt at creating a UNION and ordering by each statements scoring. (SELECT a_name AS name, MATCH(a_name) AGAINST('$keyword') as ascore FROM a WHERE MATCH a_name AGAINST('$keyword')) UNION (SELECT s_name AS name,MATCH(s_name) AGAINST('$keyword') as sscore FROM s WHERE MATCH s_name AGAINST('$keyword')) ORDER BY (ascore + sscore) ASC sscore was not recognized.

    Read the article

  • What is .htaccess RewriteRule best practice?

    - by Pablo
    Is it better to have a single RewriteRule with a bunch of RegEx or multiples Rules with fewer RegEx for the server to query? Will there be any performance differences? Heres is an example a single rule with almost all RegEx groups as optional: RewriteRule ^gallery/?([\w]+)?/?([\w]+)?/?([\d]+)?/?([\w]+)/?$ /gallery.php?$1=$2&start=$3&by=$4 [NC] Here are some of the rules lists that would replace the one above: RewriteRule ^gallery/category/([\w]+)/$ /gallery.php?category=$1& [NC] RewriteRule ^gallery/category/([\w]+)/([\d]+)/$ /gallery.php?category=$1&start=$2 [NC] RewriteRule ^gallery/category/([\w]+)/([\d]+)/([\w]+)/$ /gallery.php?category=$1&start=$2&by=$3 [NC] ... RewriteRule ^gallery/tag/([\w]+)/$ /gallery.php?category=$1& [NC] RewriteRule ^gallery/tag/([\w]+)/([\d]+)/$ /gallery.php?category=$1&start=$2 [NC] RewriteRule ^gallery/tag/([\w]+)/([\d]+)/([\w]+)/$ /gallery.php?category=$1&start=$2&by=$3 [NC] ... I'll be glad to hear your options or personal experiences.

    Read the article

  • Most efficient algorithm for mesh-level, optimal occlusion culling?

    - by Fredriku73
    I am new to culling. On a first glance, it seems that most occlusion culling algorithms are object-level, not examining single meshes, which would be practical for game rendering. What I am looking for is an algorithm that culls all meshes within a single object that are occluded for a given viewpoint, with high accuracy. It needs to be at least O(n log n), a naive mesh-by-mesh comparison (O(n^2)) is too slow. I notice that the Blender GUI identifies the occluded meshes for you in real-time, even if you work with large objects of 10,000+ meshes. What algorithm is used there, pray tell?

    Read the article

  • merging arrays of hashes

    - by Ben
    I have two arrays of hashes. Array1 => [{attribute_1 = A, attribute_2 = B}, {attribute_1 = A, attribute_2 = B}] Array2 => [{attribute_3 = C, attribute_2 = D}, {attribute_3 = C, attribute_4 = D}] Each hash in the array is holding attributes for an object. In the above example, there are two objects that I'm working with. There are two attributes in each array for each object How do I merge the two arrays? I am trying to get a single array (there is no way to get a single array from the start because I have to make two different API calls to get these attributes). DesiredArray => [{attribute_1 = A, attribute_2 = B, attribute_3 = C, attribute_2 = D}, {attribute_1 = A, attribute_2 = B, attribute_3 = C, attribute_2 = D}] I've tried a couple things, including the iteration methods and the merge method, but I've been unable to get the array I need.

    Read the article

  • jquery multiple dialoge boxes

    - by tismon
    Hi i am trying to put multiple dialog boxes in a single page. i had downloaded demo for a single dialog box and apply same effect to different "div"s.. but it came on the same position. how can i put diff. dialog boxes in diff positions ? i has set styles for 2nd and 3rd "div"s; but its not working.. somebody please help me.. regards tismon

    Read the article

  • AuthLogic perishable_token resets on every request

    - by go minimal
    In my User model I have: acts_as_authentic do |c| c.perishable_token_valid_for = 30.minutes end In my Application Controller I have the standard boilerplate code: def current_user_session return @current_user_session if defined?(@current_user_session) @current_user_session = UserSession.find end def current_user return @current_user if defined?(@current_user) @current_user = current_user_session && current_user_session.record end Now in my view I need to see if a user is logged in: <% if current_user %> Sign Out <% else %> Sign In <% end %> On every single request, current_user is being called, and that causes a SELECT call to be made to the database to find the user, then an UPDATE call that updates the last_request_at and perishable_token even though I set perishable_token_valid_for = 30.minutes. Does anyone have a better way to see if a user is logged in without causing a SELECT and UPDATE on every single page of my app. Does anyone know why the perishable token keeps updating even if I set it to be valid for 30 minutes???

    Read the article

  • MYOB Service Sales Import

    - by sjw
    I have developed an export file from our Job Management system that I want to be able to import into MYOB Accounting Plus v18.5. The file is generated without issue and I have included every single field to make it easy for upload (i.e. Match All matches every field) The problem I am having is no matter what I do, I cannot get the sales to import... Every time, no matter what I do or how I create the customer card comes back with: Error -190: Customer not found. Sale invoice not imported. I have tried matching using - co./Last Name, Card ID & Record ID and every time I get the same error. I have created a single customer with a simply Co./Last Name, Card ID & Record ID and still, when I try to import using these same fields exactly matched, I get the same error...

    Read the article

  • abstract class MouseAdapter vs. interface

    - by Stefano Borini
    I noted this (it's a java.awt.event class). public abstract class MouseAdapter implements MouseListener, MouseWheelListener, MouseMotionListener { .... } Then you are clearly forced to extend from this adapter public class MouseAdapterImpl extends MouseAdapter {} the class is abstract and implements no methods. Is this a strategy to combine different interfaces into a single "basically interface" ? I assume in java it's not possible to combine different interfaces into a single one without using this approach. In other words, it's not possible to do something like this in java public interface MouseAdapterIface extends MouseListener, MouseWheelListener, MouseMotionListener { } and then eventually public class MouseAdapterImpl implements MouseAdapterIface {} Is my understanding of the point correct ? what about C# ?

    Read the article

  • noindex, follow on list views?

    - by Fabrizio
    On one of our client's website we have lot's of list views with links to detail views. (Image a blog with the posts overview and the single pages). The detail views don't change, but the list views will change when new items come up. The pages displaying the list view don't contain any other valuable content. So my question is: Does it make sense to define meta "noindex, follow" on the list view pages (and of course "index, follow" on the detail views) to prevent search engines to point to the list views when the keyword is found in the title or teaser of the list view. By the time the visitor clicks on the list view search result it might have changed and the content is not visible anymore, whereas if he goes directly to the single view he will definitly find what he was searching for? Related question: The startpage also contains mainly a list view. Is it a bad idea to have the start page not indexed? Any SEO gurus here? :) Thanks, Fabrizio.

    Read the article

  • Trying to understand MVC Models, Advice?

    - by Tyler
    I am writing my own MVC for the purpose of learning it. I have pretty much everything "down-pat" and my main stuff written besides models due to some trouble understanding them and lack of viable examples. Now, I've been told a model should reprecent a single row, someone told me, your model class should on update/insert and delete rows, anything that involves fetching a single or multiple rows - a "finder" class should be used. So... a) what is a finder class, b) how do I implement it in a useage example, c) Is what I've been told about models correct or is there a better way than "finders"? Advice is much appricated :)

    Read the article

  • Which is best Postfix Log analyzer?

    - by Anto Binish Kaspar
    Which is best Postfix Log analyzer? We are looking for good log analyzer for postfix. We need to analyze the following How many mails queued ? How many mails not delivered ? Why mails are not delivered ? And is it possible to view the subject for the all mail status instead of message id? I mean to review the status of the single mail. We are using Sawmill analyzer now. But the management is not satisfied with the report from the sawmaill, since its missing single message status and subject.

    Read the article

  • AVG time spent on multiple rows SQL-server?

    - by seo20
    I have a table tblSequence with 3 cols in MS SQL: ID, IP, [Timestamp] Content could look like this: ID IP [Timestamp] -------------------------------------------------- 4347 62.107.95.103 2010-05-24 09:27:50.470 4346 62.107.95.103 2010-05-24 09:27:45.547 4345 62.107.95.103 2010-05-24 09:27:36.940 4344 62.107.95.103 2010-05-24 09:27:29.347 4343 62.107.95.103 2010-05-24 09:27:12.080 ID is unique, there can be n number of IP's. Would like to calculate the average time spent per IP. in a single row Know you can do something like this: SELECT CAST(AVG(CAST(MyTable.MyDateTimeFinish - MyTable.MyDateTimeStart AS float)) AS datetime) But how on earth do I find the first and last entry of my unique IP row so I can have a start and finish time? I'M stuck. Would like to calculate the average time spent per IP. in a single row

    Read the article

  • Stream classes ... design, pattern for creating views over streams

    - by ToxicAvenger
    A question regarding the design of stream classes - I need a pattern to create independent views over a single stream instance (in my case for reading). A view would be a consecutive part of the stream. The problem I have with the stream classes is that the state (reading or writing) is coupled with the underlying data/storage. So if I need to partition a stream into different segments (whether segments overlap or not doesn't matter), I cannot easily create views over the stream, the views would store start and end position. Because reading from a view - which would translate to reading from the underlying stream adjusted based on the start/end positions - would change the state of the underlying stream instance. So what I could do is take a read on a view instance, adjust the Position of the stream, read the chunks I need. But I cannot do that concurrently. Why is it designed in such a way, and what kind of pattern could I implement to create independet views over a single stream instance which would allow to read/write independently (and concurrently)?

    Read the article

  • SelfReferenceProperty vs. ListProperty Google App Engine

    - by John
    Hi All, I am experimenting with the Google App Engine and have a question. For the sake of simplicity, let's say my app is modeling a computer network (a fairly large corporate network with 10,000 nodes). I am trying to model my Node class as follows: class Node(db.Model): name = db.StringProperty() neighbors = db.SelfReferenceProperty() Let's suppose, for a minute, that I cannot use a ListProperty(). Based on my experiments to date, I can assign only a single entity to 'neighbors' - and I cannot use the "virtual" collection (node_set) to access the list of Node neighbors. So... my questions are: Does SelfReferenceProperty limit you to a single entity that you can reference? If I instead use a ListProperty, I believe I am limited to 5,000 keys, which I need to exceed. Thoughts? Thanks, John

    Read the article

  • How do I setup a Criteria in nHibernate to query against multiple values

    - by AWC
    I want to query for a set of results based on the contents of a list, I've managed to do this for a single instance of the class Foo, but I'm unsure how I would do this for a IList<Foo>. So for a single instance of the class Foo, this works: public ICriteria CreateCriteria(IList<Foo> foo) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); } But how do I do this when the method parameter is a list of Foo? public ICriteria CreateCriteria(IList<Foo> foos) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); }

    Read the article

< Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >