Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 417/1731 | < Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >

  • What is .htaccess RewriteRule best practice?

    - by Pablo
    Is it better to have a single RewriteRule with a bunch of RegEx or multiples Rules with fewer RegEx for the server to query? Will there be any performance differences? Heres is an example a single rule with almost all RegEx groups as optional: RewriteRule ^gallery/?([\w]+)?/?([\w]+)?/?([\d]+)?/?([\w]+)/?$ /gallery.php?$1=$2&start=$3&by=$4 [NC] Here are some of the rules lists that would replace the one above: RewriteRule ^gallery/category/([\w]+)/$ /gallery.php?category=$1& [NC] RewriteRule ^gallery/category/([\w]+)/([\d]+)/$ /gallery.php?category=$1&start=$2 [NC] RewriteRule ^gallery/category/([\w]+)/([\d]+)/([\w]+)/$ /gallery.php?category=$1&start=$2&by=$3 [NC] ... RewriteRule ^gallery/tag/([\w]+)/$ /gallery.php?category=$1& [NC] RewriteRule ^gallery/tag/([\w]+)/([\d]+)/$ /gallery.php?category=$1&start=$2 [NC] RewriteRule ^gallery/tag/([\w]+)/([\d]+)/([\w]+)/$ /gallery.php?category=$1&start=$2&by=$3 [NC] ... I'll be glad to hear your options or personal experiences.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • please help me in this query

    - by testkhan
    I have three tables (user, friends, posts) and two users (user1 and user2). When user1 adds user2 as friend then user1 can see the posts of user2 just like on Facebook. But only the posts after the date when user1 added user2 as friend. My query is like this: $sql = mysql_query("SELECT * FROM posts p JOIN friends f ON p.currentuserid = f.friendid AND p.time >= f.friend_since OR p.currentuserid='user1id' WHERE f.myid='user1id' ORDER BY p.postid DESC LIMIT 20"); it is working all the way fine but with a little problem.....!! it displays user2, user3 (all the users as friends of user1) posts for single time but shows user1 posts multiple.......i.e user2. hi user1. userssfsfsfsfsdf user1. userssfsfsfsfsdf user3. dddddddd user1. sdfsdsdfsdsfsf user1. sdfsdsdfsdsfsf but i in database it is single entry/post why it is happening........!! How can I fix it?

    Read the article

  • Testing with Qt's QTestLib module

    - by ak
    Hi I started writing some tests with Qt's unit testing system. How do you usually organize the tests? It is one test class per one module class, or do you test the whole module with a single test class? Qt docs (or some podcast that I recently watched) suggested to follow the former strategy. I want to write tests for a module. The module provides only one class that is going to be used by the module user, but there is a lot of logic abstracted in other classes, which I would also like to test, besides testing the public class. The problem is that Qt's proposed way to run tests involved the QTEST_MAIN macro: QTEST_MAIN(TestClass) #include "test_class.moc" and eventually one test program is capable of testing just one test class. And it kinda sucks to create test projects for every single class in the module. Of course, one could take a look at the QTEST_MAIN macro, rewrite it, and run other test classes. But is there something, that works out of the box?

    Read the article

  • merging arrays of hashes

    - by Ben
    I have two arrays of hashes. Array1 => [{attribute_1 = A, attribute_2 = B}, {attribute_1 = A, attribute_2 = B}] Array2 => [{attribute_3 = C, attribute_2 = D}, {attribute_3 = C, attribute_4 = D}] Each hash in the array is holding attributes for an object. In the above example, there are two objects that I'm working with. There are two attributes in each array for each object How do I merge the two arrays? I am trying to get a single array (there is no way to get a single array from the start because I have to make two different API calls to get these attributes). DesiredArray => [{attribute_1 = A, attribute_2 = B, attribute_3 = C, attribute_2 = D}, {attribute_1 = A, attribute_2 = B, attribute_3 = C, attribute_2 = D}] I've tried a couple things, including the iteration methods and the merge method, but I've been unable to get the array I need.

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • AVG time spent on multiple rows SQL-server?

    - by seo20
    I have a table tblSequence with 3 cols in MS SQL: ID, IP, [Timestamp] Content could look like this: ID IP [Timestamp] -------------------------------------------------- 4347 62.107.95.103 2010-05-24 09:27:50.470 4346 62.107.95.103 2010-05-24 09:27:45.547 4345 62.107.95.103 2010-05-24 09:27:36.940 4344 62.107.95.103 2010-05-24 09:27:29.347 4343 62.107.95.103 2010-05-24 09:27:12.080 ID is unique, there can be n number of IP's. Would like to calculate the average time spent per IP. in a single row Know you can do something like this: SELECT CAST(AVG(CAST(MyTable.MyDateTimeFinish - MyTable.MyDateTimeStart AS float)) AS datetime) But how on earth do I find the first and last entry of my unique IP row so I can have a start and finish time? I'M stuck. Would like to calculate the average time spent per IP. in a single row

    Read the article

  • geom_tile heatmap with different high fill colours based on factor

    - by Michael
    I'm interested in building a heatmap with geom_tile in ggplot2 that uses a different gradient high color based on a factor. The plot below creates the plot where the individual tiles are colored blue or red based on the xy_type, but there is no gradient. ggplot() + geom_tile(data=mydata, aes(x=factor(myx), y=myy, fill=factor(xy_type))) + scale_fill_manual(values=c("blue", "red")) The plot below does not use the xy_type factor to choose the color, but I get a single group gradient based on the xy_avg_value. ggplot() + geom_tile(data=mydata, aes(x=factor(myx), y=myy, fill=xy_avg_value)) Is there a technique to blend these two plots? I can use a facet_grid(xy_type ~ .) to create separate plots of this data, with the gradient. As this is ultimately going to be a map (x~y coordinates), I'd like to find a way to display the different gradient together in a single geom_tile map.

    Read the article

  • acts_as_solr returns all rows in the database when using the model as search query

    - by chris Chan
    In our application we're using acts_as_solr for search. Everything seems to be running smoothly except for the fact that using the model name as the search query returns every single row in the table. For example, let's say we have a users table. We specify acts_as_solr in our model to search the fields first name, last name and handle acts_as_solr :fields = [:handle, :lname, :fname]. When you use "user" as the search term it returns every single user in the system, or every row in the database as a result. Has anyone else run into this?

    Read the article

  • MongoDB RSS Feed Entries, Embed the Entries in the Feed Object?

    - by Patrick Klingemann
    I am saving a reference to an RSS Feed in MongoDB, each Feed has an ever growing list of Entries. As I'm designing my schema, I'm concerned about this statement from the MongoDB Schema Design - Embed vs. Reference Documentation: If the amount of data to embed is huge (many megabytes), you may read the limit on size of a single object. This will surely happen if I understand the statement correctly. So the question is, I am correct to assume that I should not embed the Feed Entries within a Feed because I'll eventually reach the limit on size of a single object?

    Read the article

  • Preserve "long" spaces in PDFBox text extraction

    - by Thilo
    I am using PDFBox to extract text from PDF. The PDF has a tabular structure, which is quite simple and columns are also very widely spaced from each-other This works really well, except that all kinds of horizontal space gets converted into a single space character, so that I cannot tell columns apart anymore (space within words in a column looks just like space between columns). I appreciate that a general solution is very hard, but in this case the columns are really far apart so that having a simple differentiation between "long spaces" and "space between words" would be enough. Is there a way to tell PDFBox to turn horizontal whitespace of more then x inches into something other than a single space? A proportional approach (x inch become y spaces) would also work.

    Read the article

  • noindex, follow on list views?

    - by Fabrizio
    On one of our client's website we have lot's of list views with links to detail views. (Image a blog with the posts overview and the single pages). The detail views don't change, but the list views will change when new items come up. The pages displaying the list view don't contain any other valuable content. So my question is: Does it make sense to define meta "noindex, follow" on the list view pages (and of course "index, follow" on the detail views) to prevent search engines to point to the list views when the keyword is found in the title or teaser of the list view. By the time the visitor clicks on the list view search result it might have changed and the content is not visible anymore, whereas if he goes directly to the single view he will definitly find what he was searching for? Related question: The startpage also contains mainly a list view. Is it a bad idea to have the start page not indexed? Any SEO gurus here? :) Thanks, Fabrizio.

    Read the article

  • C# Lambda Problem

    - by Chris Klepeis
    Probably something simple, but as I'm new to lambda expressions, the problem evades me: m => m.contactID == contactID && m.primaryAddress == true && (m.addressTypeID == 2 || m.addressTypeID == 3) I tried to use that lambda expression but I receive an invalid operator. Is there a way to simplify this so that it would work? Edit: The equivolent sql query would be: SELECT * FROM Contact WHERE contactID = 3 AND primaryAddress = 1 AND (addressTypeID = 2 OR addressTypeID = 3) I have a repository function defined like so: public E Single(Expression<Func<E, bool>> where) { return objectSet.Single<E>(where); } I'm passing the lambda expression above into this function. Invalid operator error.

    Read the article

  • Most efficient algorithm for mesh-level, optimal occlusion culling?

    - by Fredriku73
    I am new to culling. On a first glance, it seems that most occlusion culling algorithms are object-level, not examining single meshes, which would be practical for game rendering. What I am looking for is an algorithm that culls all meshes within a single object that are occluded for a given viewpoint, with high accuracy. It needs to be at least O(n log n), a naive mesh-by-mesh comparison (O(n^2)) is too slow. I notice that the Blender GUI identifies the occluded meshes for you in real-time, even if you work with large objects of 10,000+ meshes. What algorithm is used there, pray tell?

    Read the article

  • AuthLogic perishable_token resets on every request

    - by go minimal
    In my User model I have: acts_as_authentic do |c| c.perishable_token_valid_for = 30.minutes end In my Application Controller I have the standard boilerplate code: def current_user_session return @current_user_session if defined?(@current_user_session) @current_user_session = UserSession.find end def current_user return @current_user if defined?(@current_user) @current_user = current_user_session && current_user_session.record end Now in my view I need to see if a user is logged in: <% if current_user %> Sign Out <% else %> Sign In <% end %> On every single request, current_user is being called, and that causes a SELECT call to be made to the database to find the user, then an UPDATE call that updates the last_request_at and perishable_token even though I set perishable_token_valid_for = 30.minutes. Does anyone have a better way to see if a user is logged in without causing a SELECT and UPDATE on every single page of my app. Does anyone know why the perishable token keeps updating even if I set it to be valid for 30 minutes???

    Read the article

  • Which is best Postfix Log analyzer?

    - by Anto Binish Kaspar
    Which is best Postfix Log analyzer? We are looking for good log analyzer for postfix. We need to analyze the following How many mails queued ? How many mails not delivered ? Why mails are not delivered ? And is it possible to view the subject for the all mail status instead of message id? I mean to review the status of the single mail. We are using Sawmill analyzer now. But the management is not satisfied with the report from the sawmaill, since its missing single message status and subject.

    Read the article

  • SelfReferenceProperty vs. ListProperty Google App Engine

    - by John
    Hi All, I am experimenting with the Google App Engine and have a question. For the sake of simplicity, let's say my app is modeling a computer network (a fairly large corporate network with 10,000 nodes). I am trying to model my Node class as follows: class Node(db.Model): name = db.StringProperty() neighbors = db.SelfReferenceProperty() Let's suppose, for a minute, that I cannot use a ListProperty(). Based on my experiments to date, I can assign only a single entity to 'neighbors' - and I cannot use the "virtual" collection (node_set) to access the list of Node neighbors. So... my questions are: Does SelfReferenceProperty limit you to a single entity that you can reference? If I instead use a ListProperty, I believe I am limited to 5,000 keys, which I need to exceed. Thoughts? Thanks, John

    Read the article

  • Create fulltext index on a VIEW

    - by kylex
    Is it possible to create a full text index on a VIEW? If so, given two columns column1 and column2 on a VIEW, what is the SQL to get this done? The reason I'd like to do this is I have two very large tables, where I need to do a FULLTEXT search of a single column on each table and combine the results. The results need to be ordered as a single unit. Suggestions? EDIT: This was my attempt at creating a UNION and ordering by each statements scoring. (SELECT a_name AS name, MATCH(a_name) AGAINST('$keyword') as ascore FROM a WHERE MATCH a_name AGAINST('$keyword')) UNION (SELECT s_name AS name,MATCH(s_name) AGAINST('$keyword') as sscore FROM s WHERE MATCH s_name AGAINST('$keyword')) ORDER BY (ascore + sscore) ASC sscore was not recognized.

    Read the article

  • How do I setup a Criteria in nHibernate to query against multiple values

    - by AWC
    I want to query for a set of results based on the contents of a list, I've managed to do this for a single instance of the class Foo, but I'm unsure how I would do this for a IList<Foo>. So for a single instance of the class Foo, this works: public ICriteria CreateCriteria(IList<Foo> foo) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); } But how do I do this when the method parameter is a list of Foo? public ICriteria CreateCriteria(IList<Foo> foos) { return session .CreateCriteria<Component>() .CreateCriteria("Versions") .CreateCriteria("PublishedEvents") .Add(Restrictions.And(Restrictions.InsensitiveLike("Name", foo.Name, MatchMode.Anywhere), Restrictions.InsensitiveLike("Type", foo.Type, MatchMode.Anywhere))) .SetCacheable(true); }

    Read the article

  • Rails relation select

    - by Dimitar Vouldjeff
    Hi, I have the following models: class User < ActiveRecord::Base has_many :results, :dependent => :destroy has_many :participants, :dependent => :destroy has_many :courses, :through => :participants end class Course < ActiveRecord::Base has_many :tests, :dependent => :destroy has_many :participants, :dependent => :destroy has_many :users, :through => :participants end class Result < ActiveRecord::Base belongs_to :test belongs_to :user end class Test < ActiveRecord::Base belongs_to :course has_many :results, :dependent => :destroy end The Idea is that a user has_and_belongs_to_many courses, the course has_many tests, and every test has_and_belongs_to_many users (results). So what is the best query to select every Result from a single Course (not test), and also the query to select every Result from a single Course, but from one user. Thanks!

    Read the article

  • abstract class MouseAdapter vs. interface

    - by Stefano Borini
    I noted this (it's a java.awt.event class). public abstract class MouseAdapter implements MouseListener, MouseWheelListener, MouseMotionListener { .... } Then you are clearly forced to extend from this adapter public class MouseAdapterImpl extends MouseAdapter {} the class is abstract and implements no methods. Is this a strategy to combine different interfaces into a single "basically interface" ? I assume in java it's not possible to combine different interfaces into a single one without using this approach. In other words, it's not possible to do something like this in java public interface MouseAdapterIface extends MouseListener, MouseWheelListener, MouseMotionListener { } and then eventually public class MouseAdapterImpl implements MouseAdapterIface {} Is my understanding of the point correct ? what about C# ?

    Read the article

  • How to decide on going into management?

    - by Rob Wells
    I read the transcript of a speech by Richard Hamming included as a part of this SO question and the speech had a quote that got me thinking about when someone should move into development. When your vision of what you want to do is what you can do single-handedly, then you should pursue it. The day your vision, what you think needs to be done, is bigger than what you can do single-handedly, then you have to move toward management. And the bigger the vision is, the farther in management you have to go. Any other suggestions as to how you can decide if you want to move away from the coal face and into management?

    Read the article

  • Trying to understand MVC Models, Advice?

    - by Tyler
    I am writing my own MVC for the purpose of learning it. I have pretty much everything "down-pat" and my main stuff written besides models due to some trouble understanding them and lack of viable examples. Now, I've been told a model should reprecent a single row, someone told me, your model class should on update/insert and delete rows, anything that involves fetching a single or multiple rows - a "finder" class should be used. So... a) what is a finder class, b) how do I implement it in a useage example, c) Is what I've been told about models correct or is there a better way than "finders"? Advice is much appricated :)

    Read the article

  • WLI domain with 3 servers - issues on JPD process startup

    - by XpiritO
    Hi there. I'm currently working on a clustered WLI environment which comprehends 3 servers: 1 admin server ("AdminServer") and 2 managed servers ("mn1" and "mn2") grouped as a cluster, as follows: Architecture diagram: http://img72.imageshack.us/img72/4112/clusterdiagram.jpg I've developed a JPD process to execute some scheduled tasks, invoked using a Message Broker. I've deployed this project into a single-server WLI domain (with AdminServer only) and it works as expected: the JPD process is invoked (I've configured a Timer Event Generator instance to start it up). Message broker: http://img532.imageshack.us/img532/1443/wlimessagebroker.jpg Timer event generator: http://img408.imageshack.us/img408/7358/wlitimereventgenerator.jpg In order to achieve fail-over and load-balancing capabilities, I'm currently trying to deploy this JPD process into this clustered WLI environment. Although, I'm having some issues with this, as I cannot get it to work properly, even if it still works. Here is a screenshot of the "WLI Process Instance Monitor" (with AdminServer and mn1 instances up and running): http://img710.imageshack.us/img710/8477/wliprocessinstancemonit.jpg According to this screen the process seems to be running, as it shows in this instance monitor screen. However, I don't see any output coming out neither at AdminServer console or mn1 console. In single-server domain it was visible output from JPD process "timeout" callback method, wich implementation is shown below: @com.bea.wli.control.broker.MessageBroker.StaticSubscription(xquery = "", filterValueMatch = "", channelName = "/SamplePrefix/Samples/SampleStringChannel", messageBody = "{x0}") public void subscription(java.lang.String x0) { String toReturn=""; try { Context myCtx = new InitialContext(); MBeanHome mbeanHome = (MBeanHome)myCtx.lookup("weblogic.management.home.localhome"); toReturn=mbeanHome.getMBeanServer().getServerName(); System.out.println("**** executed at **** " + System.currentTimeMillis() + " by: " + toReturn); } catch (Exception e) { System.out.println("Exception!"); e.printStackTrace(); } } (...) @org.apache.beehive.controls.api.events.EventHandler(field = "myT", eventSet = com.bea.control.WliTimerControl.Callback.class, eventName = "onTimeout") public void myT_onTimeout(long time, java.io.Serializable data) { // #START: CODE GENERATED - PROTECTED SECTION - you can safely add code above this comment in this method. #// // input transform System.out.println("**** published at **** " + System.currentTimeMillis()); publishControl.publish("aaaa"); // parameter assignment // #END : CODE GENERATED - PROTECTED SECTION - you can safely add code below this comment in this method. #// } and here is the output visible at "AdminServer" console in single-server domain testing: **** published at **** 1273238090713 **** executed at **** 1273238132123 by: AdminServer **** published at **** 1273238152462 **** executed at **** 1273238152562 by: AdminServer (...) What may be wrong with my clustered configuration? Am I missing something to accomplish clustered deployment? Thanks in advance for your help.

    Read the article

< Previous Page | 413 414 415 416 417 418 419 420 421 422 423 424  | Next Page >