Search Results

Search found 11410 results on 457 pages for 'till death developer'.

Page 422/457 | < Previous Page | 418 419 420 421 422 423 424 425 426 427 428 429  | Next Page >

• Subdomains, folders, internationalization, and hosting solutions

  - by justinbach

  I'm a web developer and I recently landed a gig to develop the US / international version of a site for a company that's big in Europe but hasn't done much expansion into the US yet. They've got an existing site at company.com, which should remain visible to European customers after the new site goes up, and an existing (not great) site at company.us, which I'm going to be redeveloping (the .us site will be taken down when my version goes up--keep reading for details). My solution needs to take into account the fact that there are going to be new, localized versions of the site in the fairly near future, so the framework I'm writing needs to be able to handle localizations fairly easily (dynamically load language packs, etc). The tricky thing is the European branch of the company manages the .com site hosting (IIS-based) and the DNS, while I'll be managing the US hosting (and future localizations), which will likely be apache-based. I've never been a big fan of the ".us" TLD--I think most US users are accustomed to visiting the .com--so the thought is that the European branch will detect the IP of inbound traffic and redirect all US-based addresses to us.example.com (or whatever the appropriate localized subdomain might be), which would point to the IP address of my host. I'd then serve the appropriate locale-specific content by pulling the subdomain from the $_SERVER superglobal (assuming PHP). I couldn't find any examples of international organizations that take a subdomain-based approach for localization, but I'm not sure I have any other options as a result of the unique hosting structure here (in that there's not a unified hosting solution for the European and US sites). In my experience, the US version of an international site would live at domain.com/us, not at us.domain.com, and I'd imagine that this has to do with SEO (subdomains are treated as separate sites, so improved rankings for the US site wouldn't help the Canadian version if subdomains are used to differentiate between them). My question is: is there a better approach to solving this problem than the one I'm taking? Ideally, I'd like to use a folder-based approach (see adidas.com as an example of what I'm talking about), but I'm not sure that's a possibility given that the US site (and other localizations) will not be hosted on the same server as the rest of the .com. Can you, in IIS, map a folder (e.g. domain.com/us) to a different IP address? What would you recommend? Thanks for your consideration.

  Read the article

• Exchange-Server Query

  - by Rudi Kershaw

  First, a little background. I've recently been taken on as a web and software developer for a small company, who has no other in-house IT support. They've been asking my opinion on lots of IT subjects that are quite far out of my comfort zone. I'm definitely not a network admin. Their IT consultancy contractor is pushing them to upgrade their dedicated exchange server, even though it seems like the one they currently have has a lot of life left in it and is running problem free. They say it's "coming to the natural end of it's life". They want to install a monster with a Xeon E5-2420, 32GB RAM, 2x 1TB HDDs, Windows Server 2012 and Microsoft Exchange 2010. They want to charge a small fortune for it. Basically, this system seems massively over the top seeing as it won't be doing anything else other than running as an exchange server for a company with less than 25 email accounts. My employers also have a file server system in-house that hosts three web apps, an SQL server, their local domain, print server and shared folders. That machine is using the same specs as the proposed new one, and it is barely using any of it's potential. I asked if Microsoft Exchange 2010 could be installed on their file server, but they said that MS Exchange can't run on the same system as an SQL server because for some reason they will eat up each others resources (even though the SQL server isn't touching 1% of the current system's CPU or RAM). My question is really, are they trying to rip my employers off? Could MS Exchange be installed on their other server (on a virtual instance or not), or does the old one even need replacing at all? Going with their current suggestion will cost the company in excess of £6k, and it seems entirely unnecessary. I apologies, because I know this is probably a little thin on details, but if I carry on I could end up writing a massive essay that no-one will want to read. I've been doing my research, but I'm not knowledgeable enough make any hard decisions. Let me know if you need any more details. Thank you for any help you can offer. Further Details: The new exchange would need to support Outlook Web App, 25 users, a few public mailboxes, and email exchange with Blackberries.

  Read the article

• Linux Best Practices

  - by Zac

  I'm a life-long Windows developer switching over to Linux for the first time, and I'm starting off with Ubuntu to ease the learning curve. My new laptop will primarily be a development machine: 6GB RAM, 320 GB HD. I'd like there to be 2 non-root users: (a) Development, which will always be me, and (b) Guest, for anyone else. I assume the root user is added by default, like System Administrator in Windows. (1) I'd like to mount /home to its own partition, but how does this work if I have two user accounts (Development and Guest)? Are there 2 separate /home directories, or do they get shared? Is it possible to allocate more space for Development and only a tiny bit of space for Guest in GRUB2? How?!?! (2) I'm assuming that its okay that all of my development tools (Eclipse & plugins, SVN, JUnit, ant, etc.) and Java will end up getting installed in non-/home directories such as /usr and /opt, but that my Eclipse/SVN workspace will live under my /home directory on a separate partition... any problems, issues, concerns with that? (3) As far as partitioning schemes, nothing too complicated, but not plain Jane either: Boot Partition, 512 MB, in case I want to install other OSes Ubuntu & non-/home file system, 187.5 GB Swap Partition, 12 GB = RAM x 2 /home Partition, 120 GB I don't have any bulky media data (I don't have music or video libraries, this is a lean and mean dev machine) so having 320 GB is like winning the lottery and not knowing what to do with all this space. I figured I'd give a little extra space to the OS/FS partition since I'll be running JEE containers locally and doing a lot of file IO, logging and other memory-instensive operations. Any issues, problems, concerns, suggestions? (4) I was thinking about using ext4; seems to have good filestamping without any space ceiling for me to hit. Any other suggestions for a dev machine? (5) I read somewhere that you need to be careful when you install software as the root user, but I can't remember why. What general caveats do I need to be aware of when doing things (installing packages, making system configurations, etc.) as root vs "Development" user? Thanks!

  Read the article

• debugging JBoss 100% CPU usage

  - by Nate

  We are using JBoss to run two of our WARs. One is our web app, the other is our web service. The web app accesses a database on another machine and makes requests to the web service. The web service makes JMS requests to other machines, aggregates the data, and returns it. At our biggest client, about once a month the JBoss Java process takes 100% of all CPUs. The machine running JBoss has 8 CPUs. Our web app is still accessible during this time, however pages take about 3 minutes to load. Restarting JBoss restores everything to normal. The database machine and all the other machines are fine, only the machine running JBoss is affected. Memory usage is normal. Network utilization is normal. There are no suspect error messages in the JBoss logs. I have set up a test environment as close as possible to the client's production environment and I've done load testing with as much as 2x the number of concurrent users. I have not gotten my test environment to replicate the problem. Where do we go from here? How can we narrow down the problem? Currently the only plan we have is to wait until the problem occurs in production on its own, then do some debugging to determine the cause. So far people have just restarted JBoss when the problem occurred to minimize down time. Next time it happens they will get a developer to take a look. The question is, next time it happens, what can be done to determine the cause? We could setup a separate JBoss instance on the same box and install the web app separately from the web service. This way when the problem next occurs we will know which WAR has the problem (assuming it is our code). This doesn't narrow it down much though. Should I enable JMX remote? This way the next time the problem occurs I can connect with VisualVM and see which threads are taking the CPU and what the hell they are doing. However, is there a significant down side to enabling JMX remote in a production environment? Is there another way to see what threads are eating the CPU and to get a stacktrace to see what they are doing? Any other ideas? Thanks!

  Read the article

• Why is my concurrency capacity so low for my web app on a LAMP EC2 instance?

  - by AMF

  I come from a web developer background and have been humming along building my PHP app, using the CakePHP framework. The problem arose when I began the ab (Apache Bench) testing on the Amazon EC2 instance in which the app resides. I'm getting pretty horrendous average page load times, even though I'm running a c1.medium instance (2 cores, 2GB RAM), and I think I'm doing everything right. I would run: ab -n 200 -c 20 http://localhost/heavy-but-view-cached-page.php Here are the results: Concurrency Level: 20 Time taken for tests: 48.197 seconds Complete requests: 200 Failed requests: 0 Write errors: 0 Total transferred: 392111200 bytes HTML transferred: 392047600 bytes Requests per second: 4.15 [#/sec] (mean) Time per request: 4819.723 [ms] (mean) Time per request: 240.986 [ms] (mean, across all concurrent requests) Transfer rate: 7944.88 [Kbytes/sec] received While the ab test is running, I run VMStat, which shows that Swap stays at 0, CPU is constantly at 80-100% (although I'm not sure I can trust this on a VM), RAM utilization ramps up to about 1.6G (leaving 400M free). Load goes up to about 8 and site slows to a crawl. Here's what I think I'm doing right on the code side: In Chrome browser uncached pages typically load in 800-1000ms, and cached pages load in 300-500ms. Not stunning, but not terrible either. Thanks to view caching, there might be at most one DB query per page-load to write session data. So we can rule out a DB bottleneck. I have APC on. I am using Memcached to serve the view cache and other site caches. xhprof code profiler shows that cached pages take up 10MB-40MB in memory and 100ms - 1000ms in wall time. Pages that would be the worst offenders would look something like this in xhprof: Total Incl. Wall Time (microsec): 330,143 microsecs Total Incl. CPU (microsecs): 320,019 microsecs Total Incl. MemUse (bytes): 36,786,192 bytes Total Incl. PeakMemUse (bytes): 46,667,008 bytes Number of Function Calls: 5,195 My Apache config: KeepAlive On MaxKeepAliveRequests 100 KeepAliveTimeout 3 <IfModule mpm_prefork_module> StartServers 5 MinSpareServers 5 MaxSpareServers 10 MaxClients 120 MaxRequestsPerChild 1000 </IfModule> Is there something wrong with the server? Some gotcha with the EC2? Or is it my code? Some obvious setting I should look into? Too many DNS lookups? What am I missing? I really want to get to 1,000 concurrency capacity, but at this rate, it ain't gonna happen.

  Read the article

• Is the guideline: don't open email attachments or execute downloads or run plug-ins (Flash, Java) from untrusted sites enough to avert infection?

  - by therobyouknow

  I'd like to know if the following is enough to avert malware as I feel that the press and other advisory resources aren't always precisely clear on all the methods as to how PCs get infected. To my mind, the key step to getting infected is a conscious choice by the user to run an executable attachment from an email or download, but also viewing content that requires a plug-in (Flash, Java or something else). This conscious step breaks down into the following possibilities: don't open email attachments: certainly agree with this. But lets try to be clear: email comes in 2 parts -the text and the attachment. Just reading the email should not be risky, right? But opening (i.e. running) email attachments IS risky (malware can be present in the attachment) don't execute downloads (e.g. from sites linked from in suspect emails or otherwise): again certainly agree with this (malware can be present in the executable). Usually the user has to voluntary click to download, or at least click to run the executable. Question: has there ever been a case where a user has visited a site and a download has completed on its own and run on its own? don't run content requiring plug-ins: certainly agree: malware can be present in the executable. I vaguely recall cases with Flash but know of the Java-based vulnerabilities much better. Now, is the above enough? Note that I'm much more cautious than this. What I'm concerned about is that the media is not always very clear about how the malware infection occurs. They talk of "booby-trapped sites", "browser attacks" - HOW exactly? I'd presume the other threat would be malevolent use of Javascript to make an executable run on the user's machine. Would I be right and are there details I can read up on about this. Generally I like Javascript as a developer, please note. An accepted answer would fill in any holes I've missed here so we have a complete general view of what the threats are (even though the actual specific details of new threats vary, but the general vectors are known).

  Read the article

• NHibernate, and odd "Session is Closed!" errors

  - by Sekhat

  Note: Now that I've typed this out, I have to apologize for the super long question, however, I think all the code and information presented here is in some way relevant. Okay, I'm getting odd "Session Is Closed" errors, at random points in my ASP.NET webforms application. Today, however, it's finally happening in the same place over and over again. I am near certain that nothing is disposing or closing the session in my code, as the bits of code that use are well contained away from all other code as you'll see below. I'm also using ninject as my IOC, which may / may not be important. Okay, so, First my SessionFactoryProvider and SessionProvider classes: SessionFactoryProvider public class SessionFactoryProvider : IDisposable { ISessionFactory sessionFactory; public ISessionFactory GetSessionFactory() { if (sessionFactory == null) sessionFactory = Fluently.Configure() .Database( MsSqlConfiguration.MsSql2005.ConnectionString(p => p.FromConnectionStringWithKey("QoiSqlConnection"))) .Mappings(m => m.FluentMappings.AddFromAssemblyOf<JobMapping>()) .BuildSessionFactory(); return sessionFactory; } public void Dispose() { if (sessionFactory != null) sessionFactory.Dispose(); } } SessionProvider public class SessionProvider : IDisposable { ISessionFactory sessionFactory; ISession session; public SessionProvider(SessionFactoryProvider sessionFactoryProvider) { this.sessionFactory = sessionFactoryProvider.GetSessionFactory(); } public ISession GetCurrentSession() { if (session == null) session = sessionFactory.OpenSession(); return session; } public void Dispose() { if (session != null) { session.Dispose(); } } } These two classes are wired up with Ninject as so: NHibernateModule public class NHibernateModule : StandardModule { public override void Load() { Bind<SessionFactoryProvider>().ToSelf().Using<SingletonBehavior>(); Bind<SessionProvider>().ToSelf().Using<OnePerRequestBehavior>(); } } and as far as I can tell work as expected. Now my BaseDao<T> class: BaseDao public class BaseDao<T> : IDao<T> where T : EntityBase { private SessionProvider sessionManager; protected ISession session { get { return sessionManager.GetCurrentSession(); } } public BaseDao(SessionProvider sessionManager) { this.sessionManager = sessionManager; } public T GetBy(int id) { return session.Get<T>(id); } public void Save(T item) { using (var transaction = session.BeginTransaction()) { session.SaveOrUpdate(item); transaction.Commit(); } } public void Delete(T item) { using (var transaction = session.BeginTransaction()) { session.Delete(item); transaction.Commit(); } } public IList<T> GetAll() { return session.CreateCriteria<T>().List<T>(); } public IQueryable<T> Query() { return session.Linq<T>(); } } Which is bound in Ninject like so: DaoModule public class DaoModule : StandardModule { public override void Load() { Bind(typeof(IDao<>)).To(typeof(BaseDao<>)) .Using<OnePerRequestBehavior>(); } } Now the web request that is causing this is when I'm saving an object, it didn't occur till I made some model changes today, however the changes to my model has not changed the data access code in anyway. Though it changed a few NHibernate mappings (I can post these too if anyone is interested) From as far as I can tell, BaseDao<SomeClass>.Get is called then BaseDao<SomeOtherClass>.Get is called then BaseDao<TypeImTryingToSave>.Save is called. it's the third call at the line in Save() using (var transaction = session.BeginTransaction()) that fails with "Session is Closed!" or rather the exception: Session is closed! Object name: 'ISession'. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.ObjectDisposedException: Session is closed! Object name: 'ISession'. And indeed following through on the Debugger shows the third time the session is requested from the SessionProvider it is indeed closed and not connected. I have verified that Dispose on my SessionFactoryProvider and on my SessionProvider are called at the end of the request and not before the Save call is made on my Dao. So now I'm a little stuck. A few things pop to mind. Am I doing anything obviously wrong? Does NHibernate ever close sessions without me asking to? Any workarounds or ideas on what I might do? Thanks in advance

  Read the article

• starting with flex - please let me know if the direction is right (ActionScript vs MXML separation)

  - by Piotr

  Hi, I've just started learning flex using OReilly "Programming Flex 3.0". After completing three chapters and starting fourth (ActionScript), and not having enough patience to wait till completing chapter 22 I started to practice :) One bit that I have most worries about right now is the the dual coding mode (MXML vs ActionScript) Please have a look at my code below (it compiles via mxmlc design.mxml, second file 'code.as' should be in same directory) and advise if the separation I used between visual design and code is appropriate. Also - if some smart guy could show me how to recode same example with *.as being a class file [package?] it would be highly appreciated. I got lost with creating directory structure for package - and did not find it most intuitive, especially for small project that has two files like my example. Code: design.mxml <?xml version="1.0" encoding="utf-8"?> <mx:Application xmlns:mx="http://www.adobe.com/2006/mxml"> <mx:Script source="code.as"/> <mx:VBox> <mx:TextInput creationComplete="initializeCalculator()" id="txtScreen"/> <mx:HBox> <mx:Button click="click('7')" id="btn7" label="7"/> <mx:Button click="click('8')" id="btn8" label="8"/> <mx:Button click="click('9')" id="btn9" label="9"/> <mx:Button click="click('C')" id="btnClear" label="C"/> </mx:HBox> <mx:HBox> <mx:Button click="click('4')" id="btn4" label="4"/> <mx:Button click="click('5')" id="btn5" label="5"/> <mx:Button click="click('6')" id="btn6" label="6"/> <mx:Button click="click('/')" id="btnDivide" label="/"/> </mx:HBox> <mx:HBox> <mx:Button click="click('1')" id="btn1" label="1"/> <mx:Button click="click('2')" id="btn2" label="2"/> <mx:Button click="click('3')" id="btn3" label="3"/> <mx:Button click="click('*')" id="btnMultiply" label="*"/> </mx:HBox> <mx:HBox> <mx:Button click="click('0')" id="btn0" label="0"/> <mx:Button click="click('=')" id="btnEqual" label="="/> <mx:Button click="click('-')" id="btnMinus" label="-"/> <mx:Button click="click('+')" id="btnPlus" label="+"/> </mx:HBox> </mx:VBox> </mx:Application> code: code.as public var res:int = 0; public var previousOperator:String = ""; public var previousRes:int=0; public function initializeCalculator():void{ txtScreen.text = res.toString(); } public function click(code:String):void{ if (code=="1" || code=="2" || code=="3" || code=="4" || code=="5" || code=="6" || code=="7" || code=="8" || code=="9" || code=="0"){ res = res*10 + int(code); txtScreen.text = res.toString(); } else if (code=="C"){ res = 0; previousOperator =""; previousRes = 0; txtScreen.text = res.toString(); } else{ calculate(code); } } public function calculate(operator:String):void{ var tmpRes:int; if (previousOperator=="+"){ tmpRes = previousRes + res; } else if (previousOperator=="-"){ tmpRes = previousRes - res; } else if (previousOperator=="/"){ tmpRes = previousRes / res; } else if (previousOperator=="*"){ tmpRes = previousRes * res; } else{ tmpRes = res; } previousOperator = operator; previousRes = tmpRes; txtScreen.text = previousRes.toString(); res = 0; if (previousOperator=="=") { res = tmpRes; txtScreen.text=res.toString(); } } PS. If you have comments that this calculator does not calculate properly, they are also appreciated, yet most important are comments on best practices in Flex.

  Read the article

• SOLVED mwfeedparser integrating in my app gives EXC_BAD_ACCESS (code=1, address=0xa0040008)

  - by Pranoy C

  SOLVED- Got it! The problem was that since I am creating the DoParsingStuff *parseThisUrl object in the viewDidLoad method, it's scope was only within that method. So after the method finished, the object got deallocated. I changed it to an instance variable instead and now it works. It gives a different error but that it an entirely different issue. Issue was: I have been struggling with trying to integrate the mwfeedparser library in my app for parsing RSS and ATOM feeds. It throws a gives EXC_BAD_ACCESS error which I can't seem to troubleshoot. //My Class looks like - My interface looks like: #import <Foundation/Foundation.h> #import "MWFeedParser.h" #import "NSString+HTML.h" @protocol ParseCompleted <NSObject> -(void)parsedArray:(NSMutableArray *)parsedArray; @end @interface DoParsingStuff : NSObject<MWFeedParserDelegate> @property (nonatomic,strong) NSMutableArray *parsedItems; @property (nonatomic, strong) NSArray *itemsToDisplay; @property (nonatomic,strong) MWFeedParser *feedParser; @property (nonatomic,strong) NSURL *feedurl; @property (nonatomic,strong) id <ParseCompleted> delegate; -(id)initWithFeedURL:(NSURL *)url; @end //And Implementaion: #import "DoParsingStuff.h" @implementation DoParsingStuff @synthesize parsedItems = _parsedItems; @synthesize itemsToDisplay = _itemsToDisplay; @synthesize feedParser = _feedParser; @synthesize feedurl=_feedurl; @synthesize delegate = _delegate; -(id)initWithFeedURL:(NSURL *)url{ if(self = [super init]){ _feedurl=url; _feedParser = [[MWFeedParser alloc] initWithFeedURL:_feedurl]; _feedParser.delegate=self; _feedParser.feedParseType=ParseTypeFull; _feedParser.connectionType=ConnectionTypeAsynchronously; } return self; } -(void)doParsing{ BOOL y = [_feedParser parse]; } # pragma mark - # pragma mark MWFeedParserDelegate - (void)feedParserDidStart:(MWFeedParser *)parser { //Just tells what url is being parsed e.g. http://www.wired.com/reviews/feeds/latestProductsRss NSLog(@"Started Parsing: %@", parser.url); } - (void)feedParser:(MWFeedParser *)parser didParseFeedInfo:(MWFeedInfo *)info { //What is the Feed about e.g. "Product Reviews" NSLog(@"Parsed Feed Info: “%@”", info.title); //self.title = info.title; } - (void)feedParser:(MWFeedParser *)parser didParseFeedItem:(MWFeedItem *)item { //Prints current element's title e.g. “An Arthropod for Your iDevices” NSLog(@"Parsed Feed Item: “%@”", item.title); if (item) [_parsedItems addObject:item]; } - (void)feedParserDidFinish:(MWFeedParser *)parser {//This is where you can do your own stuff with the parsed items NSLog(@"Finished Parsing%@", (parser.stopped ? @" (Stopped)" : @"")); [_delegate parsedArray:_parsedItems]; //[self updateTableWithParsedItems]; } - (void)feedParser:(MWFeedParser *)parser didFailWithError:(NSError *)error { NSLog(@"Finished Parsing With Error: %@", error); if (_parsedItems.count == 0) { //self.title = @"Failed"; // Show failed message in title } else { // Failed but some items parsed, so show and inform of error UIAlertView *alert = [[UIAlertView alloc] initWithTitle:@"Parsing Incomplete" message:@"There was an error during the parsing of this feed. Not all of the feed items could parsed." delegate:nil cancelButtonTitle:@"Dismiss" otherButtonTitles:nil]; [alert show]; } //[self updateTableWithParsedItems]; } @end //I am calling this from my main viewcontroller as such: #import "DoParsingStuff.h" @interface ViewController : UIViewController <ParseCompleted> .... //And I have the following methods in my implementation: DoParsingStuff *parseThisUrl = [[DoParsingStuff alloc] initWithFeedURL:[NSURL URLWithString:@"http://www.theverge.com/rss/index.xml"]]; parseThisUrl.delegate=self; [parseThisUrl doParsing]; I have the method defined here as- -(void)parsedArray:(NSMutableArray *)parsedArray{ NSLog(@"%@",parsedArray); } //I stepped through breakpoints- When I try to go through the breakpoints, I see that everything goes fine till the very last [parseThisUrl doParsing]; in my delegate class. After that it starts showing me memory registers where I get lost. I think it could be due to arc as I have disabled arc on the mwfeedparser files but am using arc in the above classes. If you need the entire project for this, let me know. I tried it with NSZombies enabled and got a bit more info out of it: -[DoParsingStuff respondsToSelector:]: message sent to deallocated instance 0x6a52480 I am not using release/autorelease/retain etc. in this class...but it is being used in the mwfeedparser library.

  Read the article

• "Randomly" occurring errors...

  - by ClarkeyBoy

  Hi, My website has a setup whereby when the application starts a module called SiteContent is "created". This runs a clearup function which basically deletes any irrelevant data from the database, in case any has been left in there from previously run functions. The module has instances of Manager classes - namely RangeManager, CollectionManager, DesignManager. There are others but I will just use these as an example. Each Manager class contains an array of items - items may be of type Range, Collection or Design, whichever one is relevant. Data for each range is then read into an instance of Range, Collection or Design. I know this is basically duplicating data - not very efficient but its my final year project at the moment so I can always change it to use Linq or something similar later, when I am not pressured by the one month deadline. I have a form which, on clicking the Save button, saves data by calling SiteContent.RangeManager.Create(vars) or SiteContent.RangeManager.Update(Range As Range, vars) (or the equivalent for other manager classes, whichever one happens to be relevant). These functions call a stored procedure to insert or update in the relevant table. Classes Range, Collection and Design all have attributes such as Name, Description, Display and several others. When the Create or Update function is called, the Manager loops through all the other items to check if an item with the same name already exists. The Update function ensures that it does not compare the item being updated to itself. A custom exception (ItemAlreadyExistsException) is thrown if another item with the same name is found. For some weird reason, if I go into a Range, Collection or Design in edit mode, change something and try to update it, it occasionally doesnt update the item. When I say occasionally I mean every 3 - 4 page loads, sometimes more. I see absolutely no pattern in when or why it occurs. I have a try-catch statement which catches ItemAlreadyExistsException, and outputs "An item with this name already exists" when caught. Occasionally it will output this; other times it will not. Does anyone have any idea why this could happen? Maybe a mistake which someone has made and solved before? I used to have regular expressions in place that the names were compared to - I believe it was [a-zA-Z]{1, 100} (between 1 and 100 lower- or upper-case characters). For some reason the customer who I am developing the site for used to get errors saying its not in the correct format. Yet he could try the same text 5 minutes later and it would work fine. I am thinking this could well be the same problem, since both problems occur at random. Many thanks in advance. Regards, Richard Clarke Edit: After much time spent narrowing down the code, I have decided to wait till my brother, who has been a programmer for at least 8 years more than I have, to come down over Easter and get him to have a look at it. If he cant solve it then I will zip the files up and put them somewhere for people to access and have a go at. I narrowed it down literally to the minimum number of files possible, and it still occurs. It seems to be about every 10th time. Having said that, I force the manager classes to refresh every 10 page loads or 5 minutes (whichever one is sooner). I may look into this - this could be causing a problem. Basically each Manager contains an array of an object. This array is populated using data from the database. The Update function takes an instance of the item and the new values to be set for the object. If it happens to be a page load where the array is reset (ie the data is loaded freshly from the database) then the object instance with the same ID wont be the same instance as the one being passed in. This explains the fact that it throws an ItemAlreadyExistsException now and then. It all makes sense now the more I think about it. If I were to pass in the ID of the object to be altered, rather than the object itself, then it should work perfectly. I will answer the question if I solve it..

  Read the article

• GWT Query fails second time -only.

  - by Koran

  HI, I have a visualization function in GWT which calls for two instances of the same panels - two queries. Now, suppose one url is A and the other url is B. Here, I am facing an issue in that if A is called first, then both A and B works. If B is called first, then only B works, A - times out. If I call both times A, only the first time A works, second time it times out. If I call B twice, it works both times without a hitch. Even though the error comes at timed out, it actually is not timing out - in FF status bar, it shows till - transferring data from A, and then it gets stuck. This doesnt even show up in the first time query. The only difference between A and B is that B returns very fast, while A returns comparitively slow. The sample code is given below: public Panel(){ Runnable onLoadCallback = new Runnable() { public void run() { Query query = Query.create(dataUrl); query.setTimeout(60); query.send(new Callback() { public void onResponse(QueryResponse response) { if (response.isError()){ Window.alert(response.getMessage()); } } } } VisualizationUtils.loadVisualizationApi(onLoadCallback, PieChart.PACKAGE); } What could be the reason for this? I cannot think of any reason why this should happen? Why is this happening only for A and not for B? EDIT: More research. The query which works all the time (i.e. B is the example URL given in GWT visualization site: see comment [1]). So, I tried in my app engine to reproduce it - the following way s = "google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});"; response = HttpResponse(s, content_type="text/plain; charset=utf-8") response['Expires'] = time.strftime('%a, %d %b %Y %H:%M:%S GMT', time.gmtime()) return response Where s is the data when we run the query for B. I tried to add Expires etc too, since that seems to be the only header which has the difference, but now, the query fails all the time. For more info - I am now sending the difference between my server response vs the working server response. They seems to be pretty similar. HTTP/1.0 200 OK Content-Type: text/plain Date: Wed, 16 Jun 2010 11:07:12 GMT Server: Google Frontend Cache-Control: private, x-gzip-ok="" google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});Connection closed by foreign host. Mac$ telnet spreadsheets.google.com 80 Trying 209.85.231.100... Connected to spreadsheets.l.google.com. Escape character is '^]'. GET http://spreadsheets.google.com/tq?key=pWiorx-0l9mwIuwX5CbEALA&range=A1:B12&gid=0&headers=-1 HTTP/1.0 200 OK Content-Type: text/plain; charset=UTF-8 Date: Wed, 16 Jun 2010 11:07:58 GMT Expires: Wed, 16 Jun 2010 11:07:58 GMT Cache-Control: private, max-age=0 X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block Server: GSE google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});Connection closed by foreign host. Also, please note that App engine did not allow the Expires header to go through - can that be the reason? But if that is the reason, then it should not fail if B is sent first and then A. Comment [1] : http://spreadsheets.google.com/tq?key=pWiorx-0l9mwIuwX5CbEALA&range=A1:B12&gid=0&headers=-1

  Read the article

• Problem using Hibernate-Search

  - by KCore

  Hi, I am using hibernate search for my application. It is well configured and running perfectly till some time back, when it stopped working suddenly. The reason according to me being the number of my model (bean) classes. I have some 90 classes, which I add to my configuration, while building my Hibernate Configuration. When, I disable hibernate search (remove the search annotations and use Configuration instead of AnnotationsConfiguration), I try to start my application, it Works fine. But,the same app when I enable search, it just hangs up. I tried debugging and found the exact place where it hangs. After adding all the class to my AnnotationsConfiguration object, when I say cfg.buildSessionfactory(), It never comes out of that statement. (I have waited for hours!!!) Also when I decrease the number of my model classes (like say to half i.e. 50) it comes out of that statement and the application works fine.. Can Someone tell why is this happening?? My versions of hibernate are: hibernate-core-3.3.1.GA.jar hibernate-annotations-3.4.0.GA.jar hibernate-commons-annotations-3.1.0.GA.jar hibernate-search-3.1.0.GA.jar Also if need to avoid using AnnotationsConfiguration, I read that I need to configure the search event listeners explicitly.. can anyone list all the neccessary listeners and their respective classes? (I tried the standard ones given in Hibernate Search books, but they give me ClassNotFound exception and I have all the neccesarty libs in classpath) Here are the last few lines of hibernate trace I managed to pull : 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:33,716 INFO SettingsFactory:181 - JDBC batch size: 15 16:09:33,719 INFO SettingsFactory:184 - JDBC batch updates for versioned data: disabled 16:09:33,721 INFO SettingsFactory:189 - Scrollable result sets: enabled 16:09:33,723 DEBUG SettingsFactory:193 - Wrap result sets: disabled 16:09:33,725 INFO SettingsFactory:197 - JDBC3 getGeneratedKeys(): enabled 16:09:33,727 INFO SettingsFactory:205 - Connection release mode: auto 16:09:33,730 INFO SettingsFactory:229 - Maximum outer join fetch depth: 2 16:09:33,732 INFO SettingsFactory:232 - Default batch fetch size: 1000 16:09:33,735 INFO SettingsFactory:236 - Generate SQL with comments: disabled 16:09:33,737 INFO SettingsFactory:240 - Order SQL updates by primary key: disabled 16:09:33,740 INFO SettingsFactory:244 - Order SQL inserts for batching: disabled 16:09:33,742 INFO SettingsFactory:420 - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 16:09:33,744 INFO ASTQueryTranslatorFactory:47 - Using ASTQueryTranslatorFactory 16:09:33,747 INFO SettingsFactory:252 - Query language substitutions: {} 16:09:33,750 INFO SettingsFactory:257 - JPA-QL strict compliance: disabled 16:09:33,752 INFO SettingsFactory:262 - Second-level cache: enabled 16:09:33,754 INFO SettingsFactory:266 - Query cache: disabled 16:09:33,757 INFO SettingsFactory:405 - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 16:09:33,759 INFO RegionFactoryCacheProviderBridge:61 - Cache provider: net.sf.ehcache.hibernate.EhCacheProvider 16:09:33,762 INFO SettingsFactory:276 - Optimize cache for minimal puts: disabled 16:09:33,764 INFO SettingsFactory:285 - Structured second-level cache entries: disabled 16:09:33,766 INFO SettingsFactory:314 - Statistics: disabled 16:09:33,769 INFO SettingsFactory:318 - Deleted entity synthetic identifier rollback: disabled 16:09:33,771 INFO SettingsFactory:333 - Default entity-mode: pojo 16:09:33,774 INFO SettingsFactory:337 - Named query checking : enabled 16:09:33,869 INFO Version:20 - Hibernate Search 3.1.0.GA 16:09:35,134 DEBUG DocumentBuilderIndexedEntity:157 - Field selection in projections is set to false for entity **com.xyz.abc**. recognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernateDocumentBuilderIndexedEntity Donno what the last line indicates ??? (hibernaterecognized....) After the last line it doesnt do anything (no trace too ) and just hangs....

  Read the article

• WP: AesManaged encryption vs. mcrypt_encrypt

  - by invalidusername

  I'm trying to synchronize my encryption and decryption methods between C# and PHP but something seems to be going wrong. In the Windows Phone 7 SDK you can use AESManaged to encrypt your data I use the following method: public static string EncryptA(string dataToEncrypt, string password, string salt) { AesManaged aes = null; MemoryStream memoryStream = null; CryptoStream cryptoStream = null; try { //Generate a Key based on a Password, Salt and HMACSHA1 pseudo-random number generator Rfc2898DeriveBytes rfc2898 = new Rfc2898DeriveBytes(password, Encoding.UTF8.GetBytes(salt)); //Create AES algorithm with 256 bit key and 128-bit block size aes = new AesManaged(); aes.Key = rfc2898.GetBytes(aes.KeySize / 8); aes.IV = new byte[] { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }; // rfc2898.GetBytes(aes.BlockSize / 8); // to check my results against those of PHP var blaat1 = Convert.ToBase64String(aes.Key); var blaat2 = Convert.ToBase64String(aes.IV); //Create Memory and Crypto Streams memoryStream = new MemoryStream(); cryptoStream = new CryptoStream(memoryStream, aes.CreateEncryptor(), CryptoStreamMode.Write); //Encrypt Data byte[] data = Encoding.Unicode.GetBytes(dataToEncrypt); cryptoStream.Write(data, 0, data.Length); cryptoStream.FlushFinalBlock(); //Return Base 64 String string result = Convert.ToBase64String(memoryStream.ToArray()); return result; } finally { if (cryptoStream != null) cryptoStream.Close(); if (memoryStream != null) memoryStream.Close(); if (aes != null) aes.Clear(); } } I solved the problem of generating the Key. The Key and IV are similar as those on the PHP end. But then the final step in the encryption is going wrong. here is my PHP code <?php function pbkdf2($p, $s, $c, $dk_len, $algo = 'sha1') { // experimentally determine h_len for the algorithm in question static $lengths; if (!isset($lengths[$algo])) { $lengths[$algo] = strlen(hash($algo, null, true)); } $h_len = $lengths[$algo]; if ($dk_len > (pow(2, 32) - 1) * $h_len) { return false; // derived key is too long } else { $l = ceil($dk_len / $h_len); // number of derived key blocks to compute $t = null; for ($i = 1; $i <= $l; $i++) { $f = $u = hash_hmac($algo, $s . pack('N', $i), $p, true); // first iterate for ($j = 1; $j < $c; $j++) { $f ^= ($u = hash_hmac($algo, $u, $p, true)); // xor each iterate } $t .= $f; // concatenate blocks of the derived key } return substr($t, 0, $dk_len); // return the derived key of correct length } } $password = 'test'; $salt = 'saltsalt'; $text = "texttoencrypt"; #$iv_size = mcrypt_get_iv_size(MCRYPT_RIJNDAEL_128, MCRYPT_MODE_CBC); #echo $iv_size . '<br/>'; #$iv = mcrypt_create_iv($iv_size, MCRYPT_RAND); #print_r (mcrypt_list_algorithms()); $iv = "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00"; $key = pbkdf2($password, $salt, 1000, 32); echo 'key: ' . base64_encode($key) . '<br/>'; echo 'iv: ' . base64_encode($iv) . '<br/>'; echo '<br/><br/>'; function addpadding($string, $blocksize = 32){ $len = strlen($string); $pad = $blocksize - ($len % $blocksize); $string .= str_repeat(chr($pad), $pad); return $string; } echo 'text: ' . $text . '<br/>'; echo 'text: ' . addpadding($text) . '<br/>'; // -- works till here $crypttext = mcrypt_encrypt(MCRYPT_RIJNDAEL_256, $key, $text, MCRYPT_MODE_CBC, $iv); echo '1.' . $crypttext . '<br/>'; $crypttext = base64_encode($crypttext); echo '2.' . $crypttext . '<br/>'; $crypttext = mcrypt_encrypt(MCRYPT_RIJNDAEL_256, $key, addpadding($text), MCRYPT_MODE_CBC, $iv); echo '1.' . $crypttext . '<br/>'; $crypttext = base64_encode($crypttext); echo '2.' . $crypttext . '<br/>'; ?> So to point out, the Key and IV look similar on both .NET and PHP, but something seems to be going wrong in the final call when executing mcrypt_encrypt(). The end result, the encrypted string, differs from .NET. Can anybody tell me what i'm doing wrong. As far as i can see everything should be correct. Thank you! EDIT: Additional information on the AESManaged object in .NET Keysize = 256 Mode = CBC Padding = PKCS7

  Read the article

• [PHP] missing keys in $_POST

  - by KPL

  Hello there, I am trying to get some form data from POST method. Here's the code of form - <form action="" method="post" name="form1" id="form1"> <input type="hidden" value="15" name="ad_id"> <table width="100%" cellspacing="0" cellpadding="0" border="0" class="block"> <tbody><tr> <td valign="top">&nbsp;</td> <td align="right">all fields are required</td> </tr> <tr> <td valign="top">&nbsp;</td> <td align="center"></td> </tr> <tr> <td valign="top" width="150"><label for="name">Advertisement Name</label> *</td> <td><input type="text" size="45" value="Banner" id="name" name="name"> e.g Home Banner</td> </tr> <tr> <td valign="top"><label for="placement">Advertisement Placement</label></td> <td><select id="placement" name="placement"> Wide Skyscrapper 160 x 600 </tr> <tr> <td valign="top"><label for="code">Advertisement Code</label></td> <td><textarea rows="5" cols="45" id="code" name="code"></textarea></td> </tr> <tr> <td>Status</td> <td><label> <input type="radio" checked="checked" value="1" name="status"> Active</label> <label> <input type="radio" value="0" name="status"> Inactive</label></td> </tr> <input type="hidden" value="1" name="banner_uploaded" id="banner_uploaded"> <tr> <td>For Country - </td> <td> <select id="country" name="country"> <option>Not posting all the names of country</option> </select> </td> </tr> <tr> <td><label for="Scheduling">Valid From </label></td> <td><input type="text" value="" id="date-from" name="date-from"> Format : dd/mm/yyyy:hh/mm</td> </tr> <tr> <td><label for="Scheduling">Valid Till </label></td> <td><input type="text" value="" id="date-to" name="date-to"> Format : dd/mm/yyyy:hh/mm</td> </tr> <tr> <td>&nbsp;</td> <td align="right"><input type="submit" onclick="return validate_ad_form(add_adv)" value="Update Advertisement" class="button" name="update"></td> </tr> </tbody></table> </form> But I am getting $_POST['code'] empty when I am passing HTML code through it. When I pass plain text, it works fine. When I printed $_POST [i.e. used - print_r($_POST) ], I got the following output - Array ( [ad_id] = 15 [name] = Banner [placement] = ad_468x60 [code] = [status] = 1 [banner_uploaded] = 1 [country] = IN [date-from] = [date-to] = [update] = Update Advertisement ) Please be known, I haven't entered the 'date-from','date-to' fields. I have entered on purpose as StackOverflow don't allow me to post images! People,any help will be highly appreciated.

  Read the article

• What happens when you click a button using WebRat under cucumber

  - by Peter Tillemans

  I am trying to login to a Java web application. The login page has the following html : <html> <head><title>Login Page</title></head> <body onload='document.f.j_username.focus();'> <h3>Login with Username and Password</h3> <form name='f' action='/ui/j_spring_security_check' method='POST'> <table> <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> <tr> <td><input type='checkbox' name='_spring_security_remember_me'/> </td> <td>Remember me on this computer.</td> </tr> <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> </table> </form> </body> </html> I use the following script: Given /^I am logged in as (.*) with password (.*)$/ do | user, password | visit "http://localhost:8080/ui" click_link "Projects" puts "Response Body:" puts response.body assert_contain "User:" fill_in "j_username", :with => user fill_in "j_password", :with => password puts "Response Body:" puts response.body click_button puts "Response Body:" puts response.body end This gives the following in the log file : [INFO] Response Body: [INFO] <html><head><title>Login Page</title></head><body onload='document.f.j_username.focus();'> [INFO] <h3>Login with Username and Password</h3><form name='f' action='/ui/j_spring_security_check' method='POST'> [INFO] <table> [INFO] <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> [INFO] <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> [INFO] <tr><td><input type='checkbox' name='_spring_security_remember_me'/></td><td>Remember me on this computer.</td></tr> [INFO] <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> [INFO] <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> [INFO] </table> [INFO] </form></body></html> [INFO] Response Body: [INFO] <html><head><title>Login Page</title></head><body onload='document.f.j_username.focus();'> [INFO] <h3>Login with Username and Password</h3><form name='f' action='/ui/j_spring_security_check' method='POST'> [INFO] <table> [INFO] <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> [INFO] <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> [INFO] <tr><td><input type='checkbox' name='_spring_security_remember_me'/></td><td>Remember me on this computer.</td></tr> [INFO] <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> [INFO] <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> [INFO] </table> [INFO] </form></body></html> [INFO] Response Body: [INFO] [INFO] Given I am logged in as pti with password ptipti # features/step_definitions/authentication_tests.rb:2 So apparently the response.body disappeared after clicking the submit button. I can see from the server log files that the script does not arrive on the Project page. I am new to webrat and quite new to ruby and I am now thoroughly confused. I have no idea why the response.body is gone. I have no idea where I am. I speculated that I had to wait for the page request, but all documentation says that webrat nicely waits till all redirects, pageloads, etc are finished. (At least I think I read that). Besides I find no method to wait for the page in the webrat API. Can someone give some tips on how to proceed with debugging this?

  Read the article

• Windows Impersonation failed

  - by skprocks

  I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

  Read the article

• Page.ClientScript Register a pair of javascript code

  - by blgnklc

  How can I register a javascript code a page? I want to put th javascript function to the aspx.page; I thing it might be like that; string strJS= "<script language = javascript> (function(images, elements) { var fetchImages = function() { if(images.length > 0) { var numImages = 10; while(images.length > 0 && numImages-- > 0) { // assuming your elements are <img> document.getElementById(elements.shift()).src = images.shift(); // if not you could also set the background (or backgroundImage) css property // document.getElementById(elements.shift()).style.background = "url(" + images.shift() + ")"; } setTimeout(fetchImages, 5000); } } // bind to window onload window.onload = fetchImages; // if you're going to use something like jquery then do something like this instead //$(fetchImages); }(['url1', 'url2', 'url3'], ['img1', 'img2', 'img3'])) </script>"; Page.ClientScript.RegisterClientScriptBlock(typeof(ui_SUBMVGInfo), "SmartPenCheck", strJS); The second Questin is; ... ... g(ctrlIDBirthPlaceCode).onchange(); }} </script> <script language = javascript> var url1 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url2 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url3 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url4 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url5 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url6 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url7 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url8 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url9 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url10 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url11 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url12 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; function(images, elements) {var fetchImages = function() {if(images.length > 0) {var numImages = 5; while(images.length > 0 && numImages-- > 0) { document.getElementById(elements.shift()).src = images.shift(); }setTimeout(fetchImages, 5000); }}window.onload = fetchImages; }(['+url1+', '+url2+', '+url3+','+url4+', '+url5+', '+url6+','+url7+', '+url8+', '+url9+','+url10+', '+url11+', '+url12+'], ['ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerSurNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_MaritalStatusImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_SexImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthDateImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceCodeImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_IdNationalityImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_MotherOldSurNameImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_TaxNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_CitizenshipNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_HomePhoneImage'])); </script> <script> var ui_BirthPlaceCode_a='Intertech.Utility'; var ui_BirthPlaceCode_c='Intertech.Utility.Common'; var ui_BirthPlaceCode_sbn=''; ... .. What do you think is it allright or how can I do that? And according to second question above; the use of the code is correct? ref:** PS: To see my purpose please continue reading below; There is a web site page which is coded on asp.net with using c# and ajax is enabled too. I want a very fast loading web page; which is going to happen with the following architecture; 1- First all data is shown by the text boxes (There are 50 text boxes, it is an application form.) 2- When the web Page is requested and loaded, then I want all the photos are shown near the each text boxes 10 by 10 from top of the page till the end of it. (Each photo is between 5 kb - 20 kb; ) I know ImageHandler's the question is how can I put all these idea into real life? some examples and ideas will be great ! thanks This issue has been answered and you may have a look - here Regards Bk

  Read the article

• Help required in adding new methods, properties into existing classes dynamically

  - by Bepenfriends

  Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• PHP: How to automate building a 100 <UL>/<LI> menuitems, while keeping the Menu Structure File Flat / Simply Managable?

  - by Sam

  Above: current "stupid" menu. (entire ul/li menu for javascript menu system) + (some li lines as page-specific submenu) Hi folks! With passion for automation and elegancy, but limited knowledge/knowhow, im stuck with "my hands in my hair" as we Dutch say, for my current menu system works perfectly, but is a pain in the a*s to update! So, i would appreciate it greatly, if you can suggest how to automate this in php: how to let the php generate the html menu code basing on a flat menu input file with TABS indented. OLD SITUATION <ul> <!-- about 100 of these <li>....</li> lines --> <li><a href="carrot.php"><p class="mnu" style="background-position:0 -820px"><? echo __("carrot juice") ?></p></a></li> <!-- lots of data, with only little bit thats really the menu itself--> </ul a javascript file reads a ul/li structure as input to build menu of format in that ul/li, the items with a hyperlink and sprite-bg position represent webpages, (inside LI) while items without hyperlink and sprite-bg are just headers of that menusection, (inside H6) to highlight the current page in the menu, the javascript menumaker uses an id number. this number corresponds to the consequtive li that is a webpage, skips h6 headers correctly. these h6 headers are only there for when importing sections of the same menu as submenu. non-li headers are not shown in menu, nore counted by the javascript menu for their ID. to know which page should be shown, i have to count from ID 0, the li items till finding the current webpage in the li structure and then manually put it in each webpage! BUT: changing an item in li order, means stupidly re-counting their entire li again! each webpage has an icon (= sprite bg-position numer), which is also used in the webpage. INTENDED RESULT I dream of, once setting what the current webpage is (e.g carrot.php) the menu system automatically "finds" and "counts" the li's and returns the id nr (for proper highlight of main menu); generates the entire menu html, and depending on which headings are set for submenu, (e.g. meals, drinks) generates those submenu (entire section below each given header); ginally adds h5 highlight inside the li of that submenu item. For the menu, i wish an easily readable, simple plain txt menu that is indented with tabs, (each tab is one depth for example) and further tabs follow for url and sprite position of icon. MY DREAM MENU-MANAGEMENT FILE |>TAB SEPARATED/INDENTED FLATMENU FILE |MUST BE CALCULATED BY PHP: |>MENUTEXT============URL=============SPRITE=====|ID===TAG================== |>about "#" -520 |00 li |> INFORMATION |—— h6 |> physical state "physical.php" -920 |01 li |> mental health "mental.php" -10 |02 li |> |>apetite "#" -1290 |03 li |> meals "#" -600 |04 li |> COLD MEAL |—— h6 |> egg salade "salad.php" -1040 |05 li |> salmon fish "salmon.php" -540 |06 li |> HOT MEAL |—— h6 |> spare ribs "spareribs.php" -120 |07 li |> di macaroni "macaroni.php" -870 |08 li |> |> drinks "#" -230 |09 li |> JUCY DRINK |—— h6 |> carrot juice "carrot.php" -820 |10 li |> mango hive "mango.php" -270 |11 li DESIRED CHRONOLOGY php outputs the entire ul/li html so the javascript can show the menu: webpage items go inside li tags, and header items go inside h6 tags, e.g. <h6>JUCY DRINK</h6> Each website page has a url filename [eg: salad.php]. Based on this given fact, the php menu generator detects the pagename, gives the IDnr of the position of that page according to the li-item nr and sets variable for javascript to highlight current menu item. the menu items below the specified headers are loaded as submenu in which the current page.php is wrapped inside h5 to highlight current page in submenu: e.g. (<li><h5><a href="carrot.php"><p>..etc..</p></h5></li> Question Which methods / steps / (chronological)ways are there for doing this? I am no good in php programming, but am learning it so please dont write any code without a line of comment why I should use that method etc. Where do I start? If I am unclear in my question, please ask. Thanks. Much appreciated!! Concrete Task List from the provided Comments/Answers, sofar: (RobertB) First, get some PHP code working that can read through a tab-delimited file and put the data into an appropriate data structure. NOW WORKING AT THIS

  Read the article

• How to move the mouse

  - by GroundZero

  I'm making a little bot in C#. At the moment it works pretty well, it can load text from a file and type it for you. But for now, I need to manualy click the textfield to put the focus on it, remaximize my form and then click the Type-button. After the typing, I need to manualy slide the scorebar and press submit. I'd like to know how I can move my mouse with C# and if possible, if possible I'd like to load the mouse positions from a xml-file. I need to move to the textfield, click in it to focus on it, start the type script, move to the slider, hold the mouse down on it while dragging, releasing it on the correct position & clicking on the submitbutton This is what I have for now: To load in the variables, I'm using this script: private void Initialize() { XmlTextReader reader = new XmlTextReader(Application.StartupPath + @"..\..\..\CursorPositions.xml"); while (reader.Read()) { switch (reader.NodeType) { case XmlNodeType.Element: // The node is an element. element = reader.Value; break; case XmlNodeType.Text: //Display the text in each element. switch (element) { case "Textbox-X": textX = int.Parse(reader.Value); break; case "Textbox-Y": textY = int.Parse(reader.Value); break; case "SliderBegin-X": sliderX = int.Parse(reader.Value); break; case "SliderBegin-Y": sliderY = int.Parse(reader.Value); break; case "SubmitButton-X": submitX = int.Parse(reader.Value); break; case "SubmitButton-Y": submitY = int.Parse(reader.Value); break; } break; } } This is the xml-file: <?xml version="1.0" encoding="utf-8" ?> <CursorPositions> <Textbox-X>430</Textbox-X> <Textbox-Y>270</Textbox-Y> <SliderBegin-X>430</SliderBegin-X> <SliderBegin-Y>470</SliderBegin-Y> <SubmitButton-X>860</SubmitButton-X> <SubmitButton-Y>365</SubmitButton-Y> </CursorPositions> To move the mouse I'm using this piece of code: public partial class FrmMain : Form { [System.Runtime.InteropServices.DllImport("user32.dll")] public static extern void mouse_event(int dwFlags, int dx, int dy, int cButtons, int dwExtraInfo); public const int MOUSEEVENTF_LEFTDOWN = 0x0002; public const int MOUSEEVENTF_LEFTUP = 0x0004; public const int MOUSEEVENTF_RIGHTDOWN = 0x0008; public const int MOUSEEVENTF_RIGHTUP = 0x0010; ... private void btnStart_Click(object sender, EventArgs e) { // start button (de)activates loop if (!running) { btnStart.Text = "Stop"; btnStart.Cursor = Cursors.No; running = true; } else { btnStart.Text = "Start"; btnStart.Cursor = Cursors.AppStarting; running = false; } while (running) { // move to textbox & type Cursor.Position = new Point(textX, textY); mouse_event(MOUSEEVENTF_LEFTDOWN, textX, textY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, textX, textY, 0, 0); Type(); // wait 90 seconds till slider available Thread.Sleep(90 * 1000); // move to slider & slide according to score Cursor.Position = new Point(sliderX, sliderY); mouse_event(MOUSEEVENTF_LEFTDOWN, sliderX, sliderY, 0, 0); Cursor.Position = new Point(sliderX + 345 / 10 * score, sliderY); mouse_event(MOUSEEVENTF_LEFTUP, sliderX + 345 / 10 * score, sliderY, 0, 0); // submit Cursor.Position = new Point(submitX, submitY); mouse_event(MOUSEEVENTF_LEFTDOWN, submitX, submitY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, submitX, submitY, 0, 0); // wait 10 sec to be sure it's submitted Thread.Sleep(10 * 1000); // refresh page SendKeys.SendWait("{F5}"); // get new text NewText(); // wait 10 sec to refresh and load song Thread.Sleep(10 * 1000); } } } PS: I get the coordinates via my form. I've got 2 labels that show my X & Y coordinates. To capture them outside the form, I press and hold my Left Mouse Button and 'drag' it outside the form to the correct place. This way I get the coordinates of my mouse outside the form

  Read the article

• Hi i am creating a php calendar i have a Problem in that

  - by udaya

  Hi i am creating a calendar i which i filled the year and date like this <<<<< Year <<<<< month by clicking on the arrow marks the year and month can be increased and decreased now i have to fill the dates for the year and month selected I calculated the first day of month and last date of the month The dates must be start filling from the first day Say if the first day is thursday the date 1 must be on thursday and the next days must follow that till the last date These are my functions in my controller " function phpcal() { $month=04; $day=01; $year=2010; echo date("D", mktime(0,0,0,$month,$day,$year)); //here i am calculating the first day of the month echo '<br>lastdate'.date("t", strtotime($year . "-" . $month . "-01"));'' here i am calculating the lasdt date of the month //echo '<br>'.$date_end = $this->lastOfMonth(); $this->load->view('phpcal'); } function firstOfMonth($m1,$y1) { return date("m/d/Y", strtotime($m1.'/01/'.$y1.' 00:00:00')); } function lastOfMonth() { return date("m/d/Y", strtotime('-1 second',strtotime('+1 month',strtotime(date('m').'/01/'.date('Y').' 00:00:00')))); } function phpcalview() { $year = $this->input->post('yearvv'); $data['year'] = $this->adminmodel->selectyear(); $data['date'] = $this->adminmodel->selectmonth(); //print_r($data['date'] ); $this->load->view('phpcal',$data); } This is my view page <table cellpadding="2" cellspacing="0" border="1" bgcolor="#CCFFCC" align="center" class="table_Style_Border"> <? if(isset($date)) { foreach($date as $row) {?> <tr> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate2'];?></td> <td><?= $row['dbDate3'];?></td> <td><?= $row['dbDate4'];?></td> <td><?= $row['dbDate5'];?></td> <td><?= $row['dbDate6'];?></td> <td><?= $row['dbDate7'];?></td> </tr> <tr bgcolor="#FFFFFF"> <td><?= $row['dbDate8'];?></td> <td><?= $row['dbDate9'];?></td> <td><?= $row['dbDate10'];?></td> <td><?= $row['dbDate11'];?></td> <td><?= $row['dbDate12'];?></td> <td><?= $row['dbDate13'];?></td> <td><?= $row['dbDate14'];?></td> </tr> <tr> <td><?= $row['dbDate15'];?></td> <td><?= $row['dbDate16'];?></td> <td><?= $row['dbDate17'];?></td> <td><?= $row['dbDate18'];?></td> <td><?= $row['dbDate19'];?></td> <td><?= $row['dbDate20'];?></td> <td><?= $row['dbDate21'];?></td> </tr> <tr bgcolor="#FFFFFF"> <td><?= $row['dbDate22'];?></td> <td><?= $row['dbDate23'];?></td> <td><?= $row['dbDate24'];?></td> <td><?= $row['dbDate25'];?></td> <td><?= $row['dbDate26'];?></td> <td><?= $row['dbDate27'];?></td> <td><?= $row['dbDate28'];?></td> </tr> <tr> <td><?= $row['dbDate29'];?></td> <td><?= $row['dbDate30'];?></td> <td><?= $row['dbDate31'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> </tr> </tr> <? }} ?> </table> How can i insert the dates starting from the day i have calculated in the function phpcal

  Read the article

• weird problem..the exact xml work in one host and not working in another...

  - by Ofear

  hi all! i search alot for this but can't find an aswer... I have made a working xml parser using php. till today i host my files on a free web host, and everything works just fine. today i got access to my college server and i host my files there. now for some reason.. i can't make the parser work as i was in the free host... look on those files please: working site: xml file: [http://ofear.onlinewebshop.net/asce/calendar.xml] working parser is this: [http://ofear.onlinewebshop.net/asce/calendar.php] (the lower table is the xml,it's hebrew) not working site: xml file: [http://apps.sce.ac.il/agoda/calendar.xml] not working parser is this: [http://apps.sce.ac.il/agoda/calendar.php] anyone have idea why it's not working.. those are the same files and they should work. maybe it a server problem? calendar.xml: <?xml version="1.0" encoding="UTF-8" ?> <events> <record> <event>??? ???? ????? ???? ???</event> <eventDate>30/12/2010</eventDate> <desc>?????? ?? ????</desc> </record> <record> <event>??? ???? ??????? - 2 : ???? ??? ???? ??????</event> <eventDate>22/12/2010</eventDate> <desc>????? ???? ??????? ?????? ??? ???? ??????? ?????? ????? ?????? ?? ??? ???? ??????? 2 ??????? ????? ???????? 22-23 ?????? 2010. ???? ????? ???? ????? "?????? ????"</desc> </record> <record> <event>????? ???? ?????? ?????? - ?? ????</event> <eventDate>5/12/2010</eventDate> <desc>??? ????? 17:30-20:45</desc> </record> </events> parser: <?php $doc = new DOMDocument(); $doc->load( 'calendar.xml' ); $events = $doc->getElementsByTagName( "record" ); foreach( $events as $record ) { $events = $record->getElementsByTagName( "event" ); $event = $events->item(0)->nodeValue; $eventDates= $record->getElementsByTagName( "eventDate" ); $eventDate= $eventDates->item(0)->nodeValue; $descs = $record->getElementsByTagName( "desc" ); $desc = $descs->item(0)->nodeValue; echo "<tr><td>$event</td><td>$eventDate</td><td>$desc</td></tr>"; } ?> after a little debugging i saw that it's stop here: $doc = new DOMDocument(); and it's not doing anything after that. i think that the line above is the cos

  Read the article

• jenkins-maven-android when running throwing the error "android-sdk-linux/platforms" is not a directory"

  - by Sam

  I start setting up the jenkins-maven-android and i'm facing an issue when running the jenkin job. My Machine Details $uname -a Linux development2 3.0.0-12-virtual #20-Ubuntu SMP Fri Oct 7 18:19:02 UTC 2011 x86_64 x86_64 x86_64 GNU/Linux Steps to install the Android SDK in Ubuntu https://help.ubuntu.com/community/AndroidSDK since i'm working on headless env (ssh to client machine) i used following command to install the platform tools android update sdk --no-ui download apache maven and install on http://maven.apache.org/download.html mvn -version output root@development2:/opt/android-sdk-linux/tools# mvn -version Apache Maven 3.0.4 (r1232337; 2012-01-17 08:44:56+0000) Maven home: /opt/apache-maven-3.0.4 Java version: 1.6.0_24, vendor: Sun Microsystems Inc. Java home: /usr/lib/jvm/java-6-openjdk/jre Default locale: en_US, platform encoding: UTF-8 OS name: "linux", version: "3.0.0-12-virtual", arch: "amd64", family: "unix" root@development2:/opt/android-sdk-linux/tools# ran the following two command as mention in below sudo apt-get update sudo apt-get install ia32-libs Problems with Eclipse and Android SDK http://developer.android.com/sdk/installing/index.html As error suggest i gave the path to android SDK in jenkins build config still im getting the error clean install -Dandroid.sdk.path=/opt/android-sdk-linux Can someone help me to resolve this. Thanks Error I'm Getting Waiting for Jenkins to finish collecting data mavenExecutionResult exceptions not empty message : Failed to execute goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources (default-generate-sources) on project base-template: Execution default-generate-sources of goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources failed: Path "/opt/android-sdk-linux/platforms" is not a directory. Please provide a proper Android SDK directory path as configuration parameter <sdk><path>...</path></sdk> in the plugin <configuration/>. As an alternative, you may add the parameter to commandline: -Dandroid.sdk.path=... or set environment variable ANDROID_HOME. cause : Execution default-generate-sources of goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources failed: Path "/opt/android-sdk-linux/platforms" is not a directory. Please provide a proper Android SDK directory path as configuration parameter <sdk><path>...</path></sdk> in the plugin <configuration/>. As an alternative, you may add the parameter to commandline: -Dandroid.sdk.path=... or set environment variable ANDROID_HOME. Stack trace : org.apache.maven.lifecycle.LifecycleExecutionException: Failed to execute goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources (default-generate-sources) on project base-template: Execution default-generate-sources of goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources failed: Path "/opt/android-sdk-linux/platforms" is not a directory. Please provide a proper Android SDK directory path as configuration parameter <sdk><path>...</path></sdk> in the plugin <configuration/>. As an alternative, you may add the parameter to commandline: -Dandroid.sdk.path=... or set environment variable ANDROID_HOME. at org.apache.maven.lifecycle.internal.MojoExecutor.execute(MojoExecutor.java:225) at org.apache.maven.lifecycle.internal.MojoExecutor.execute(MojoExecutor.java:153) at org.apache.maven.lifecycle.internal.MojoExecutor.execute(MojoExecutor.java:145) at org.apache.maven.lifecycle.internal.LifecycleModuleBuilder.buildProject(LifecycleModuleBuilder.java:84) at org.apache.maven.lifecycle.internal.LifecycleModuleBuilder.buildProject(LifecycleModuleBuilder.java:59) at org.apache.maven.lifecycle.internal.LifecycleStarter.singleThreadedBuild(LifecycleStarter.java:183) at org.apache.maven.lifecycle.internal.LifecycleStarter.execute(LifecycleStarter.java:161) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:320) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:156) at org.jvnet.hudson.maven3.launcher.Maven3Launcher.main(Maven3Launcher.java:79) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:57) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:616) at org.codehaus.plexus.classworlds.launcher.Launcher.launchStandard(Launcher.java:329) at org.codehaus.plexus.classworlds.launcher.Launcher.launch(Launcher.java:239) at org.jvnet.hudson.maven3.agent.Maven3Main.launch(Maven3Main.java:158) at hudson.maven.Maven3Builder.call(Maven3Builder.java:98) at hudson.maven.Maven3Builder.call(Maven3Builder.java:64) at hudson.remoting.UserRequest.perform(UserRequest.java:118) at hudson.remoting.UserRequest.perform(UserRequest.java:48) at hudson.remoting.Request$2.run(Request.java:326) at hudson.remoting.InterceptingExecutorService$1.call(InterceptingExecutorService.java:72) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:334) at java.util.concurrent.FutureTask.run(FutureTask.java:166) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1110) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:603) at java.lang.Thread.run(Thread.java:679) Caused by: org.apache.maven.plugin.PluginExecutionException: Execution default-generate-sources of goal com.jayway.maven.plugins.android.generation2:android-maven-plugin:3.1.1:generate-sources failed: Path "/opt/android-sdk-linux/platforms" is not a directory. Please provide a proper Android SDK directory path as configuration parameter <sdk><path>...</path></sdk> in the plugin <configuration/>. As an alternative, you may add the parameter to commandline: -Dandroid.sdk.path=... or set environment variable ANDROID_HOME. at org.apache.maven.plugin.DefaultBuildPluginManager.executeMojo(DefaultBuildPluginManager.java:110) at org.apache.maven.lifecycle.internal.MojoExecutor.execute(MojoExecutor.java:209) ... 27 more Caused by: com.jayway.maven.plugins.android.InvalidSdkException: Path "/opt/android-sdk-linux/platforms" is not a directory. Please provide a proper Android SDK directory path as configuration parameter <sdk><path>...</path></sdk> in the plugin <configuration/>. As an alternative, you may add the parameter to commandline: -Dandroid.sdk.path=... or set environment variable ANDROID_HOME. at com.jayway.maven.plugins.android.AndroidSdk.assertPathIsDirectory(AndroidSdk.java:125) at com.jayway.maven.plugins.android.AndroidSdk.getPlatformDirectories(AndroidSdk.java:285) at com.jayway.maven.plugins.android.AndroidSdk.findAvailablePlatforms(AndroidSdk.java:260) at com.jayway.maven.plugins.android.AndroidSdk.<init>(AndroidSdk.java:80) at com.jayway.maven.plugins.android.AbstractAndroidMojo.getAndroidSdk(AbstractAndroidMojo.java:844) at com.jayway.maven.plugins.android.phase01generatesources.GenerateSourcesMojo.generateR(GenerateSourcesMojo.java:329) at com.jayway.maven.plugins.android.phase01generatesources.GenerateSourcesMojo.execute(GenerateSourcesMojo.java:102) at org.apache.maven.plugin.DefaultBuildPluginManager.executeMojo(DefaultBuildPluginManager.java:101) ... 28 more channel stopped Finished: FAILURE* android home Echo root@development2:~# echo $ANDROID_HOME /opt/android-sdk-linux

  Read the article

• C# 5 Async, Part 1: Simplifying Asynchrony – That for which we await

  - by Reed

  Today’s announcement at PDC of the future directions C# is taking excite me greatly.  The new Visual Studio Async CTP is amazing.  Asynchronous code – code which frustrates and demoralizes even the most advanced of developers, is taking a huge leap forward in terms of usability.  This is handled by building on the Task functionality in .NET 4, as well as the addition of two new keywords being added to the C# language: async and await. This core of the new asynchronous functionality is built upon three key features.  First is the Task functionality in .NET 4, and based on Task and Task<TResult>.  While Task was intended to be the primary means of asynchronous programming with .NET 4, the .NET Framework was still based mainly on the Asynchronous Pattern and the Event-based Asynchronous Pattern. The .NET Framework added functionality and guidance for wrapping existing APIs into a Task based API, but the framework itself didn’t really adopt Task or Task<TResult> in any meaningful way.  The CTP shows that, going forward, this is changing. One of the three key new features coming in C# is actually a .NET Framework feature.  Nearly every asynchronous API in the .NET Framework has been wrapped into a new, Task-based method calls.  In the CTP, this is done via as external assembly (AsyncCtpLibrary.dll) which uses Extension Methods to wrap the existing APIs.  However, going forward, this will be handled directly within the Framework.  This will have a unifying effect throughout the .NET Framework.  This is the first building block of the new features for asynchronous programming: Going forward, all asynchronous operations will work via a method that returns Task or Task<TResult> The second key feature is the new async contextual keyword being added to the language.  The async keyword is used to declare an asynchronous function, which is a method that either returns void, a Task, or a Task<T>. Inside the asynchronous function, there must be at least one await expression.  This is a new C# keyword (await) that is used to automatically take a series of statements and break it up to potentially use discontinuous evaluation.  This is done by using await on any expression that evaluates to a Task or Task<T>. For example, suppose we want to download a webpage as a string.  There is a new method added to WebClient: Task<string> WebClient.DownloadStringTaskAsync(Uri).  Since this returns a Task<string> we can use it within an asynchronous function.  Suppose, for example, that we wanted to do something similar to my asynchronous Task example – download a web page asynchronously and check to see if it supports XHTML 1.0, then report this into a TextBox.  This could be done like so: private async void button1_Click(object sender, RoutedEventArgs e) { string url = "http://reedcopsey.com"; string content = await new WebClient().DownloadStringTaskAsync(url); this.textBox1.Text = string.Format("Page {0} supports XHTML 1.0: {1}", url, content.Contains("XHTML 1.0")); } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } Let’s walk through what’s happening here, step by step.  By adding the async contextual keyword to the method definition, we are able to use the await keyword on our WebClient.DownloadStringTaskAsync method call. When the user clicks this button, the new method (Task<string> WebClient.DownloadStringTaskAsync(string)) is called, which returns a Task<string>.  By adding the await keyword, the runtime will call this method that returns Task<string>, and execution will return to the caller at this point.  This means that our UI is not blocked while the webpage is downloaded.  Instead, the UI thread will “await” at this point, and let the WebClient do it’s thing asynchronously. When the WebClient finishes downloading the string, the user interface’s synchronization context will automatically be used to “pick up” where it left off, and the Task<string> returned from DownloadStringTaskAsync is automatically unwrapped and set into the content variable.  At this point, we can use that and set our text box content. There are a couple of key points here: Asynchronous functions are declared with the async keyword, and contain one or more await expressions In addition to the obvious benefits of shorter, simpler code – there are some subtle but tremendous benefits in this approach.  When the execution of this asynchronous function continues after the first await statement, the initial synchronization context is used to continue the execution of this function.  That means that we don’t have to explicitly marshal the call that sets textbox1.Text back to the UI thread – it’s handled automatically by the language and framework!  Exception handling around asynchronous method calls also just works. I’d recommend every C# developer take a look at the documentation on the new Asynchronous Programming for C# and Visual Basic page, download the Visual Studio Async CTP, and try it out.

  Read the article

< Previous Page | 418 419 420 421 422 423 424 425 426 427 428 429  | Next Page >