Search Results

Search found 11297 results on 452 pages for 'delete operator'.

Page 424/452 | < Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >

  • Restoring multiple database backups in a transaction

    - by Raghu Dodda
    I wrote a stored procedure that restores as set of the database backups. It takes two parameters - a source directory and a restore directory. The procedure looks for all .bak files in the source directory (recursively) and restores all the databases. The stored procedure works as expected, but it has one issue - if I uncomment the try-catch statements, the procedure terminates with the following error: error_number = 3013 error_severity = 16 error_state = 1 error_message = DATABASE is terminating abnormally. The weird part is sometimes (it is not consistent) the restore is done even if the error occurs. The procedure: create proc usp_restore_databases ( @source_directory varchar(1000), @restore_directory varchar(1000) ) as begin declare @number_of_backup_files int -- begin transaction -- begin try -- step 0: Initial validation if(right(@source_directory, 1) <> '\') set @source_directory = @source_directory + '\' if(right(@restore_directory, 1) <> '\') set @restore_directory = @restore_directory + '\' -- step 1: Put all the backup files in the specified directory in a table -- declare @backup_files table ( file_path varchar(1000)) declare @dos_command varchar(1000) set @dos_command = 'dir ' + '"' + @source_directory + '*.bak" /s/b' /* DEBUG */ print @dos_command insert into @backup_files(file_path) exec xp_cmdshell @dos_command delete from @backup_files where file_path IS NULL select @number_of_backup_files = count(1) from @backup_files /* DEBUG */ select * from @backup_files /* DEBUG */ print @number_of_backup_files -- step 2: restore each backup file -- declare backup_file_cursor cursor for select file_path from @backup_files open backup_file_cursor declare @index int; set @index = 0 while(@index < @number_of_backup_files) begin declare @backup_file_path varchar(1000) fetch next from backup_file_cursor into @backup_file_path /* DEBUG */ print @backup_file_path -- step 2a: parse the full backup file name to get the DB file name. declare @db_name varchar(100) set @db_name = right(@backup_file_path, charindex('\', reverse(@backup_file_path)) -1) -- still has the .bak extension /* DEBUG */ print @db_name set @db_name = left(@db_name, charindex('.', @db_name) -1) /* DEBUG */ print @db_name set @db_name = lower(@db_name) /* DEBUG */ print @db_name -- step 2b: find out the logical names of the mdf and ldf files declare @mdf_logical_name varchar(100), @ldf_logical_name varchar(100) declare @backup_file_contents table ( LogicalName nvarchar(128), PhysicalName nvarchar(260), [Type] char(1), FileGroupName nvarchar(128), [Size] numeric(20,0), [MaxSize] numeric(20,0), FileID bigint, CreateLSN numeric(25,0), DropLSN numeric(25,0) NULL, UniqueID uniqueidentifier, ReadOnlyLSN numeric(25,0) NULL, ReadWriteLSN numeric(25,0) NULL, BackupSizeInBytes bigint, SourceBlockSize int, FileGroupID int, LogGroupGUID uniqueidentifier NULL, DifferentialBaseLSN numeric(25,0) NULL, DifferentialBaseGUID uniqueidentifier, IsReadOnly bit, IsPresent bit ) insert into @backup_file_contents exec ('restore filelistonly from disk=' + '''' + @backup_file_path + '''') select @mdf_logical_name = LogicalName from @backup_file_contents where [Type] = 'D' select @ldf_logical_name = LogicalName from @backup_file_contents where [Type] = 'L' /* DEBUG */ print @mdf_logical_name + ', ' + @ldf_logical_name -- step 2c: restore declare @mdf_file_name varchar(1000), @ldf_file_name varchar(1000) set @mdf_file_name = @restore_directory + @db_name + '.mdf' set @ldf_file_name = @restore_directory + @db_name + '.ldf' /* DEBUG */ print 'mdf_logical_name = ' + @mdf_logical_name + '|' + 'ldf_logical_name = ' + @ldf_logical_name + '|' + 'db_name = ' + @db_name + '|' + 'backup_file_path = ' + @backup_file_path + '|' + 'restore_directory = ' + @restore_directory + '|' + 'mdf_file_name = ' + @mdf_file_name + '|' + 'ldf_file_name = ' + @ldf_file_name restore database @db_name from disk = @backup_file_path with move @mdf_logical_name to @mdf_file_name, move @ldf_logical_name to @ldf_file_name -- step 2d: iterate set @index = @index + 1 end close backup_file_cursor deallocate backup_file_cursor -- end try -- begin catch -- print error_message() -- rollback transaction -- return -- end catch -- -- commit transaction end Does anybody have any ideas why this might be happening? Another question: is the transaction code useful ? i.e., if there are 2 databases to be restored, will SQL Server undo the restore of one database if the second restore fails?

    Read the article

  • Why is my UIImageView blurred?

    - by Denis M
    I have a really weird problem with UIImageView. I have an image (an RGB png) 45x45 pixels which I add to the view. I can see that image is blurred after added to the view. Here is the same image in the simulator (left) and in Xcode (right): I have custom UIImageView class with this initWithImage code: - (id) initWithImage:(UIImage*) image { self = [super initWithImage:image]; self.frame = CGRectMake(0, 0, 45, 45); self.contentMode = UIViewContentModeScaleAspectFit; self.quantity = 1; if (self) { self.label = [[UITextField alloc]initWithFrame:CGRectMake(0,40,45,25)]; self.label.font = [UIFont systemFontOfSize:16]; self.label.borderStyle = UITextBorderStyleNone; self.label.enabled = TRUE; self.label.userInteractionEnabled = TRUE; self.label.delegate = self; self.label.keyboardType = UIKeyboardTypeNumbersAndPunctuation; self.label.textAlignment = UITextAlignmentCenter; } self.userInteractionEnabled = TRUE; // Prepare 3 buttons: count up, count down, and delete self.deleteButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.deleteButton.hidden = NO; self.deleteButton.userInteractionEnabled = YES; self.deleteButton.titleLabel.font = [UIFont systemFontOfSize:20]; self.deleteButton.titleLabel.textColor = [UIColor redColor]; [self.deleteButton setTitle:@"X" forState:UIControlStateNormal]; [self.deleteButton addTarget:self action:@selector(deleteIcon:) forControlEvents:UIControlEventTouchUpInside]; self.upCountButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.upCountButton.hidden = NO; self.upCountButton.userInteractionEnabled = YES; [self.upCountButton setTitle:@"+" forState:UIControlStateNormal]; [self.upCountButton addTarget:self action:@selector(addQuantity:) forControlEvents:UIControlEventTouchUpInside]; self.downCountButton = [UIButton buttonWithType:UIButtonTypeRoundedRect]; self.downCountButton.hidden = YES; self.downCountButton.userInteractionEnabled = YES; [self.downCountButton setTitle:@"-" forState:UIControlStateNormal]; [self.downCountButton addTarget:self action:@selector(removeQuantity:) forControlEvents:UIControlEventTouchUpInside]; return self; } I create it like this: UIImage *desertIcon = [UIImage imageNamed:@"desert.png"]; IconObj *desertIconView = [[IconObj alloc] initWithImage:desertIcon]; desertIconView.center = CGPointMake(265,VERTICAL_POINT_ICON); desertIconView.type = [IconObj TYPE_DESERT]; [self.view addSubview:desertIconView]; [desertIconView release]; Why would the displayed image be so than the one stored in a file?

    Read the article

  • Seeding repository Rhino Mocks

    - by ahsteele
    I am embarking upon my first journey of test driven development in C#. To get started I'm using MSTest and Rhino.Mocks. I am attempting to write my first unit tests against my ICustomerRepository. It seems tedious to new up a Customer for each test method. In ruby-on-rails I'd create a seed file and load the customer for each test. It seems logical that I could put this boiler plate Customer into a property of the test class but then I would run the risk of it being modified. What are my options for simplifying this code? [TestMethod] public class CustomerTests : TestClassBase { [TestMethod] public void CanGetCustomerById() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetById(5)).Return(customer); // assert Assert.AreEqual(customer, repository.GetById(5)); } [TestMethod] public void CanGetCustomerByDifId() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetCustomerByDifID("55")).Return(customer); // assert Assert.AreEqual(customer, repository.GetCustomerByDifID("55")); } [TestMethod] public void CanGetCustomerByLogin() { // arrange var customer = new Customer() { CustId = 5, DifId = "55", CustLookupName = "The Dude", LoginList = new[] { new Login { LoginCustId = 5, LoginName = "tdude" } } }; var repository = Stub<ICustomerRepository>(); // act repository.Stub(rep => rep.GetCustomerByLogin("tdude")).Return(customer); // assert Assert.AreEqual(customer, repository.GetCustomerByLogin("tdude")); } } Test Base Class public class TestClassBase { protected T Stub<T>() where T : class { return MockRepository.GenerateStub<T>(); } } ICustomerRepository and IRepository public interface ICustomerRepository : IRepository<Customer> { IList<Customer> FindCustomers(string q); Customer GetCustomerByDifID(string difId); Customer GetCustomerByLogin(string loginName); } public interface IRepository<T> { void Save(T entity); void Save(List<T> entity); bool Save(T entity, out string message); void Delete(T entity); T GetById(int id); ICollection<T> FindAll(); }

    Read the article

  • Various GPS Android Functionality Questions..

    - by Tyler
    Hello - I have a few questions (so far) with the the LocationManager on Android and GPS in general.. Feel free to answer any number of the questions below, and I appreciate your help in advance! (I noticed this stuff doesn't appear to be documented very well, so hopefully these questions will help others out too!) 1) I am using the following code, but I think there may be extra fluff in here that I do not need. Can you tell me if I can delete any of this? LocationManager lm = (LocationManager) getSystemService(Context.LOCATION_SERVICE); LocationListener locationListener = new MyLocationListener(); lm.requestLocationUpdates(LocationManager.GPS_PROVIDER, 0, 0, locationListener); LocationProvider locationProvider = lm.getProvider("gps"); Location currentLocation = lm.getLastKnownLocation(locationProvider.getName()); 2) Is there a way to hold off on the last step (accessing "getLastKnownLocation" until after I am sure I have a GPS lock? What happens if this is called and GPS is still looking for signal? 3) MOST importantly, I want to ensure I have a GPS lock before I proceed to my next method, so is there a way to check to see if GPS is locked on and getLastKnownLocation is up to date? 4) Is there a way to 'shut down' the GPS listener once it does receive a lock and getLastKnownLocation is updated? I don't see a need to keep this running for my application once I have obtained a lock.. 5) Can you please confirm my assumption that "getLastKnownLocation" is updated frequently as the receiver moves? 6) In my code, I also have a class called "MyLocationListener" (code below) that I honestly just took from another example.. Is this actually needed? I assume this updates my location manager whenever the location changes, but it sure doesn't appear that there is much to the class itself! private class MyLocationListener implements LocationListener { @Override public void onLocationChanged(Location loc) { if (loc != null) { //Toast.makeText(getBaseContext(), "Location changed : Lat: " + loc.getLatitude() + " Lng: " + loc.getLongitude(), Toast.LENGTH_SHORT).show(); } } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } }

    Read the article

  • YASR - Yet another search and replace question

    - by petronius31
    Environment: asp.net c# openxml Ok, so I've been reading a ton of snippets and trying to recreate the wheel, but I'm hoping that somone can help me get to my desination faster. I have multiple documents that I need to merge together... check... I'm able to do that with openxml sdk. Birds are singing, sun is shining so far. Now that I have the document the way I want it, I need to search and replace text and/or content controls. I've tried using my own text - {replace this} but when I look at the xml (rename docx to zip and view the file), the { is nowhere near the text. So I either need to know how to protect that within the doucment so they don't diverge or I need to find another way to search and replace. I'm able to search/replace if it is an xml file, but then I'm back to not being able to combine the doucments easily. Code below... and as I mentioned... document merge works fine... just need to replace stuff. protected void exeProcessTheDoc(object sender, EventArgs e) { string doc1 = Server.MapPath("~/Templates/doc1.docx"); string doc2 = Server.MapPath("~/Templates/doc2.docx"); string final_doc = Server.MapPath("~/Templates/extFinal.docx"); File.Delete(final_doc); File.Copy(doc1, final_doc); using (WordprocessingDocument myDoc = WordprocessingDocument.Open(final_doc, true)) { string altChunkId = "AltChunkId2"; MainDocumentPart mainPart = myDoc.MainDocumentPart; AlternativeFormatImportPart chunk = mainPart.AddAlternativeFormatImportPart( AlternativeFormatImportPartType.WordprocessingML, altChunkId); using (FileStream fileStream = File.Open(doc2, FileMode.Open)) chunk.FeedData(fileStream); AltChunk altChunk = new AltChunk(); altChunk.Id = altChunkId; mainPart.Document.Body.InsertAfter(altChunk, mainPart.Document.Body.Elements<Paragraph>().Last()); mainPart.Document.Save(); } exeSearchReplace(final_doc); } protected void exeSearchReplace(string document) { using (WordprocessingDocument wordDoc = WordprocessingDocument.Open(document, true)) { string docText = null; using (StreamReader sr = new StreamReader(wordDoc.MainDocumentPart. GetStream())) { docText = sr.ReadToEnd(); } Regex regexText = new Regex("acvtClientName"); docText = regexText.Replace(docText, "Hi Everyone!"); using (StreamWriter sw = new StreamWriter(wordDoc.MainDocumentPart.GetStream(FileMode.Create))) { sw.Write(docText); } } } } }

    Read the article

  • SQLite3 table not accepting INSERT INTO statements. The table is created, and so is the database, but nothing is passed into it

    - by user1460029
    <?php try { //open the database $db = new PDO('sqlite:music.db'); $db->exec("DELETE from Music;"); $db->exec("INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Whatd I Say', 'Ray Charles', '1956');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Smells Like Teen Spirit.', 'Nirvana', '1991');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Hey Jude', 'The Beatles', '1968');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Johnny B. Goode', 'Chuck Berry', '1958');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Good Vibrations', 'The Beach Boys', '1966');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Respect', 'Aretha Franklin', '1967');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Whats Going On', 'Marvin Gaye', '1971');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Imagine', 'John Lennon', '1971');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('(I Cant Get No) Satisfaction', 'Rolling Stones', '1965');" . "INSERT INTO Music(Title, Author, ReleaseDate) VALUES ('Like A Rolling Stone', 'Bob Dylan', '1965');"); //now output the data to a simple html table... //example of specifier --> WHERE First=\'Josh\'; <-- print "<table border=1>"; print "<tr><td>Title</td><td>Author</td><td>Y.O.P.</td></tr>"; $result = $db->query('SELECT * FROM Music '); foreach($result as $row) { print "<td>".$row['Title']."</td>"; print "<td>".$row['Author']."</td>"; print "<td>".$row['ReleaseDate']."</td></tr>"; } print "</table>"; $db = NULL; } catch(PDOException $e) { print 'Exception : '.$e->getMessage(); } ?> I am not sure why nothing is being inserted into the table. The file 'music.db' exists in the right path. For the record, I can only use SQlite3, no SQL allowed. PHP is allowed, so is SQLite3.

    Read the article

  • How to embed html table into the body of email

    - by Michael Mao
    Hi all: I am sending info to target email via PHP native mail() method right now. Everything else works fine but the table part troubles me the most. See sample output : Dear Michael Mao : Thank you for purchasing flight tickets with us, here is your receipt : Your tickets will be delivered by mail to the following address : Street Address 1 : sdfsdafsadf sdf Street Address 2 : N/A City : Sydney State : nsw Postcode : 2 Country : Australia Credit Card Number : *************1234 Your purchase details are recorded as : <table><tr><th class="delete">del?</th><th class="from_city">from</th><th class="to_city">to</th><th class="quantity">qty</th><th class="price">unit price</th><th class="price">total price</th></tr><tr class="evenrow" id="Sydney-Lima"><td><input name="isDeleting" type="checkbox"></td><td>Sydney</td><td>Lima</td><td>1</td><td>1030.00</td><td>1030</td></tr><tr class="oddrow" id="Sydney-Perth"><td><input name="isDeleting" type="checkbox"></td><td>Sydney</td><td>Perth</td><td>3</td><td>340.00</td><td>1020</td></tr><tr class="totalprice"><td colspan="5">Grand Total Price</td><td id="grandtotal">2050</td></tr></table> The source of table is directly taken from a webpage, exactly as the same. However, Gmail, Hotmail and most of other emails will ignore to render this as a table. So I am wondering, without using Outlook or other email sending agent software, how could I craft a embedded table for the PHP mail() method to send? Current code snippet corresponds to table generation : $purchaseinfo = $_POST["purchaseinfo"]; //if html tags are not to be filtered in the body of email $stringBuilder .= "<table>" .stripslashes($purchaseinfo) ."</table>"; //must send json response back to caller ajax request if(mail($email, 'Your purchase information on www.hardlyworldtravel.com', $emailbody, $headers)) echo json_encode(array("feedback"=>"successful")); else echo json_encode(array("feedback"=>"error")); Any hints and suggestions are welcomed, thanks a lot in advance.

    Read the article

  • How to communicate between Client and Server in a Client-Server Application?

    - by Sanoj
    I would like to implement an Client-Server Application, where the business-logic, security validations and a database are at the server and the user interface are at the client. I would like to implement clients in different languages i.e. one in WPF/.NET, one Swing/Java , one in Android/Java and maybe one HTML/JavaScript client. The server will be on Internet, so I would like to be able to have encrypted communication. The client will send some lists of items to be added to the database, or update items, and do some transactions. The server will check if the items are already updated by another client, or update the item, add new items or delete items. How do I solve the communication between clients and the server in such a system? I have been thinking about: http/https webserver, and sending messages in JSON or XML and use Web Sockets for bi-directional communication. Use http in a RESTful way, except when WebSockets are needed. But I guess there are better solutions for native desktop applications than http? CORBA - I have just heard about it, and it's old and complex. Not much talk about it these days. XMPP/Jabber - I have just heard about it and I don't know if it fits me at all. EJabberd seams to be a popular implementation. AMQP - I have just heard about it and I don't know if it fits me at all. RabbitMQ seams to be a popular implementation. Windows Communication Foundation, Java RMI, Java Message Service - but are they language independent? I guess some of these alternatives are on different levels, maybe I can have i.e xmpp or amqp in web sockets over https? What technologys are used for this problem in companies today? and what is recommended to use? I have no experience of them other than webservers and http. Please give me some guidance in this jungle. What are the pros and cons of these technologies in my situation?

    Read the article

  • Using a boost::fusion::map in boost::spirit::karma

    - by user1097105
    I am using boost spirit to parse some text files into a data structure and now I am beginning to generate text from this data structure (using spirit karma). One attempt at a data structure is a boost::fusion::map (as suggested in an answer to this question). But although I can use boost::spirit::qi::parse() and get data in it easily, when I tried to generate text from it using karma, I failed. Below is my attempt (look especially at the "map_data" type). After some reading and playing around with other fusion types, I found boost::fusion::vector and BOOST_FUSION_DEFINE_ASSOC_STRUCT. I succeeded to generate output with both of them, but they don't seem ideal: in vector you cannot access a member using a name (it is like a tuple) -- and in the other solution, I don't think I need both ways (member name and key type) to access the members. #include <iostream> #include <string> #include <boost/spirit/include/karma.hpp> #include <boost/fusion/include/map.hpp> #include <boost/fusion/include/make_map.hpp> #include <boost/fusion/include/vector.hpp> #include <boost/fusion/include/as_vector.hpp> #include <boost/fusion/include/transform.hpp> struct sb_key; struct id_key; using boost::fusion::pair; typedef boost::fusion::map < pair<sb_key, int> , pair<id_key, unsigned long> > map_data; typedef boost::fusion::vector < int, unsigned long > vector_data; #include <boost/fusion/include/define_assoc_struct.hpp> BOOST_FUSION_DEFINE_ASSOC_STRUCT( (), assocstruct_data, (int, a, sb_key) (unsigned long, b, id_key)) namespace karma = boost::spirit::karma; template <typename X> std::string to_string ( const X& data ) { std::string generated; std::back_insert_iterator<std::string> sink(generated); karma::generate_delimited ( sink, karma::int_ << karma::ulong_, karma::space, data ); return generated; } int main() { map_data d1(boost::fusion::make_map<sb_key, id_key>(234, 35314988526ul)); vector_data d2(boost::fusion::make_vector(234, 35314988526ul)); assocstruct_data d3(234,35314988526ul); std::cout << "map_data as_vector: " << boost::fusion::as_vector(d1) << std::endl; //std::cout << "map_data to_string: " << to_string(d1) << std::endl; //*FAIL No 1* std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d1) << boost::fusion::at_c<0>(d1) << std::endl << std::endl; std::cout << "vector_data: " << d2 << std::endl; std::cout << "vector_data to_string: " << to_string(d2) << std::endl << std::endl; std::cout << "assoc_struct as_vector: " << boost::fusion::as_vector(d3) << std::endl; std::cout << "assoc_struct to_string: " << to_string(d3) << std::endl; std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d3) << d3.a << boost::fusion::at_c<0>(d3) << std::endl; return 0; } Including the commented line gives lots of pages of compilation errors, among which notably something like: no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘double’ no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘float’ Might it be that to_string needs the values of the map_data, and not the pairs? Though I am not good with templates, I tried to get a vector from a map using transform in the following way template <typename P> struct take_second { typename P::second_type operator() (P p) { return p.second; } }; // ... inside main() pair <char, int> ff(32); std::cout << "take_second (expect 32): " << take_second<pair<char,int>>()(ff) << std::endl; std::cout << "transform map_data and to_string: " << to_string(boost::fusion::transform(d1, take_second<>())); //*FAIL No 2* But I don't know what types am I supposed to give when instantiating take_second and anyway I think there must be an easier way to get (iterate over) the values of a map (is there?) If you answer this question, please also give your opinion on whether using an ASSOC_STRUCT or a map is better.

    Read the article

  • Image rescale and write rescaled image file in blackberry

    - by Karthick
    I am using the following code to resize and save the file in to the blackberry device. After image scale I try to write image file into device. But it gives the same data. (Height and width of the image are same).I have to make rescaled image file.Can anyone help me ??? class ResizeImage extends MainScreen implements FieldChangeListener { private String path="file:///SDCard/BlackBerry/pictures/test.jpg"; private ButtonField btn; ResizeImage() { btn=new ButtonField("Write File"); btn.setChangeListener(this); add(btn); } public void fieldChanged(Field field, int context) { if (field == btn) { try { InputStream inputStream = null; //Get File Connection FileConnection fileConnection = (FileConnection) Connector.open(path); if (fileConnection.exists()) { inputStream = fileConnection.openInputStream(); //byte data[]=inputStream.toString().getBytes(); ByteArrayOutputStream baos = new ByteArrayOutputStream(); int j = 0; while((j=inputStream.read()) != -1) { baos.write(j); } byte data[] = baos.toByteArray(); inputStream.close(); fileConnection.close(); WriteFile("file:///SDCard/BlackBerry/pictures/org_Image.jpg",data); EncodedImage eImage = EncodedImage.createEncodedImage(data,0,data.length); int scaleFactorX = Fixed32.div(Fixed32.toFP(eImage.getWidth()), Fixed32.toFP(80)); int scaleFactorY = Fixed32.div(Fixed32.toFP(eImage.getHeight()), Fixed32.toFP(80)); eImage=eImage.scaleImage32(scaleFactorX, scaleFactorY); WriteFile("file:///SDCard/BlackBerry/pictures/resize.jpg",eImage.getData()); BitmapField bit=new BitmapField(eImage.getBitmap()); add(bit); } } catch(Exception e) { System.out.println("Exception is ==> "+e.getMessage()); } } } void WriteFile(String fileName,byte[] data) { FileConnection fconn = null; try { fconn = (FileConnection) Connector.open(fileName,Connector.READ_WRITE); } catch (IOException e) { System.out.print("Error opening file"); } if (fconn.exists()) try { fconn.delete(); } catch (IOException e) { System.out.print("Error deleting file"); } try { fconn.create(); } catch (IOException e) { System.out.print("Error creating file"); } OutputStream out = null; try { out = fconn.openOutputStream(); } catch (IOException e) { System.out.print("Error opening output stream"); } try { out.write(data); } catch (IOException e) { System.out.print("Error writing to output stream"); } try { fconn.close(); } catch (IOException e) { System.out.print("Error closing file"); } } }

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • dynamiclly schedule a lead sales agent

    - by Josh
    I have a website that I'm trying to migrate from classic asp to asp.net. It had a lead schedule, where each sales agent would be featured for the current day, or part of the day.The next day a new agent would be scheduled. It was driven off a database table that had a row for each day in it. So to figure out if a sales agent would show on a day, it was easy, just find today's date in the table. Problem was it ran out rows, and you had to run a script to update the lead days 6 months at a time. Plus if there was ever any change to the schedule, you had to delete all the rows and re-run the script. So I'm trying to code it where sql server figures that out for me, and no script has to be ran. I have a table like so CREATE TABLE [dbo].[LeadSchedule]( [leadid] [int] IDENTITY(1,1) NOT NULL, [userid] [int] NOT NULL, [sunday] [bit] NOT NULL, [monday] [bit] NOT NULL, [tuesday] [bit] NOT NULL, [wednesday] [bit] NOT NULL, [thursday] [bit] NOT NULL, [friday] [bit] NOT NULL, [saturday] [bit] NOT NULL, [StartDate] [smalldatetime] NULL, [EndDate] [smalldatetime] NULL, [StartTime] [time](0) NULL, [EndTime] [time](0) NULL, [order] [int] NULL, So the user can schedule a sales agent depending on their work schedule. Also if they wanted to they could split certain days, or sales agents by time, So from Midnight to 4 it was one agent, from 4-midnight it was another. So far I've tried using a numbers table, row numbers, goofy date math, and I'm at a loss. Any suggestions on how to handle this purely from sql code? If it helps, the table should always be small, like less than 20 never over 100. update After a few hours all I've managed to come up with is the below. It doesn't handle filling in days not available or times, just rotates through all the sales agents with leadTable as ( select leadid,userid,[order],StartDate, case DATEPART(dw,getdate()) when 1 then sunday when 2 then monday when 3 then tuesday when 4 then wednesday when 5 then thursday when 6 then friday when 7 then saturday end as DayAvailable , ROW_NUMBER() OVER (ORDER BY [order] ASC) AS ROWID from LeadSchedule where GETDATE()>=StartDate and (CONVERT(time(0),GETDATE())>= StartTime or StartTime is null) and (CONVERT(time(0),GETDATE())<= EndTime or EndTime is null) ) select userid, DATEADD(d,(number+ROWID-2)*totalUsers,startdate ) leadday from (select *, (select COUNT(1) from leadTable) totalUsers from leadTable inner join Numbers on 1=1 where DayAvailable =1 ) tb1 order by leadday asc

    Read the article

  • Event sourcing: Write event before or after updating the model

    - by Magnus
    I'm reasoning about event sourcing and often I arrive at a chicken and egg problem. Would be grateful for some hints on how to reason around this. If I execute all I/O-bound processing async (ie writing to the event log) then how do I handle, or sometimes even detect, failures? I'm using Akka Actors so processing is sequential for each event/message. I do not have any database at this time, instead I would persist all the events in an event log and then keep an aggregated state of all the events in a model stored in memory. Queries are all against this model, you can consider it to be a cache. Example Creating a new user: Validate that the user does not exist in model Persist event to journal Update model (in memory) If step 3 breaks I still have persisted my event so I can replay it at a later date. If step 2 breaks I can handle that as well gracefully. This is fine, but since step 2 is I/O-bound I figured that I should do I/O in a separate actor to free up the first actor for queries: Updating a user while allowing queries (A0 = Front end/GUI actor, A1 = Processor Actor, A2 = IO-actor, E = event bus). (A0-E-A1) Event is published to update user 'U1'. Validate that the user 'U1' exists in model (A1-A2) Persist event to journal (separate actor) (A0-E-A1-A0) Query for user 'U1' profile (A2-A1) Event is now persisted continue to update model (A0-E-A1-A0) Query for user 'U1' profile (now returns fresh data) This is appealing since queries can be processed while I/O-is churning along at it's own pace. But now I can cause myself all kinds of problems where I could have two incompatible commands (delete and then update) be persisted to the event log and crash on me when replayed up at a later date, since I do the validation before persisting the event and then update the model. My aim is to have a simple reasoning around my model (since Actor processes messages sequentially single threaded) but not be waiting for I/O-bound updates when Querying. I get the feeling I'm modeling a database which in itself is might be a problem. If things are unclear please write a comment.

    Read the article

  • Multiprogramming in Django, writing to the Database

    - by Marcus Whybrow
    Introduction I have the following code which checks to see if a similar model exists in the database, and if it does not it creates the new model: class BookProfile(): # ... def save(self, *args, **kwargs): uniqueConstraint = {'book_instance': self.book_instance, 'collection': self.collection} # Test for other objects with identical values profiles = BookProfile.objects.filter(Q(**uniqueConstraint) & ~Q(pk=self.pk)) # If none are found create the object, else fail. if len(profiles) == 0: super(BookProfile, self).save(*args, **kwargs) else: raise ValidationError('A Book Profile for that book instance in that collection already exists') I first build my constraints, then search for a model with those values which I am enforcing must be unique Q(**uniqueConstraint). In addition I ensure that if the save method is updating and not inserting, that we do not find this object when looking for other similar objects ~Q(pk=self.pk). I should mention that I ham implementing soft delete (with a modified objects manager which only shows non-deleted objects) which is why I must check for myself rather then relying on unique_together errors. Problem Right thats the introduction out of the way. My problem is that when multiple identical objects are saved in quick (or as near as simultaneous) succession, sometimes both get added even though the first being added should prevent the second. I have tested the code in the shell and it succeeds every time I run it. Thus my assumption is if say we have two objects being added Object A and Object B. Object A runs its check upon save() being called. Then the process saving Object B gets some time on the processor. Object B runs that same test, but Object A has not yet been added so Object B is added to the database. Then Object A regains control of the processor, and has allready run its test, even though identical Object B is in the database, it adds it regardless. My Thoughts The reason I fear multiprogramming could be involved is that each Object A and Object is being added through an API save view, so a request to the view is made for each save, thus not a single request with multiple sequential saves on objects. It might be the case that Apache is creating a process for each request, and thus causing the problems I think I am seeing. As you would expect, the problem only occurs sometimes, which is characteristic of multiprogramming or multiprocessing errors. If this is the case, is there a way to make the test and set parts of the save() method a critical section, so that a process switch cannot happen between the test and the set?

    Read the article

  • how to pass data when using MenuItem.ItemContainerStyle

    - by black sensei
    Hello Experts! i've been trying to have a dynamic ContextMenu to show the name property of each of the object in its collection of objects. here is concrete example ,i'm connecting to a webservice to pull contacts and groups of a particular account.so i have those as global variables.i display the contacts in a listbox and i want to show on right click of a contact in the listbox the list of groups that it can be added to. to be able to add a contact to a group i need the id of the contact(which i have) and the id of the group which i'm looking for here is my code. xmlns:serviceAdmin="clr-namespace:MyWpfApp.serviceAdmin" ...... <ListBox.ContextMenu> <ContextMenu> <MenuItem Header="Refresh" Click="RefreshContact_Click"></MenuItem> <MenuItem Header="Add New Contact" Click="ContactNew_Click"></MenuItem> <MenuItem Header="Add to Group" Name="groupMenus"> //<!--<MenuItem.Resources> // <DataTemplate DataType="{x:Type serviceAdmin:groupInfo}" x:Key="groupMenuKey" > // <MenuItem> // <TextBlock Text="{Binding name}" /> // </MenuItem> // </DataTemplate> // </MenuItem.Resources>--> <MenuItem.ItemContainerStyle> <Style> <Setter Property="MenuItem.Header" Value="{Binding name}"/> <Setter Property="MenuItem.Tag" Value="{Binding id}" /> </Style> </MenuItem.ItemContainerStyle> </MenuItem> <MenuItem Header="Delete Selected" Click="ContactDelete_Click"></MenuItem> </ContextMenu> </ListBox.ContextMenu> ...... and on xaml.cs //this code is in the method that loads the groups loadedgroup = service.getGroups(session.key, null); groupListBox.ItemsSource = loadedgroup; groupMenus.ItemsSource = loadedgroup.ToList(); this code is showing the name of the groups alright but i need the id of the group clicked on. If you've noticed i commented a portion of the xaml code. with that i could bind(with ease) the id to the tag.But it won't work and the MenuItem.ItemContainerStyle is the one working but then i'm lost: Question 1 : how do i create a handler method for a click event of a submenu that has the names of the groups? Question 2 : how do i get the clicked group id to work with? thanks for reading and kindly help me in this

    Read the article

  • QValidator for hex input

    - by Evan Teran
    I have a Qt widget which should only accept a hex string as input. It is very simple to restrict the input characters to [0-9A-Fa-f], but I would like to have it display with a delimiter between "bytes" so for example if the delimiter is a space, and the user types 0011223344 I would like the line edit to display 00 11 22 33 44 Now if the user presses the backspace key 3 times, then I want it to display 00 11 22 3. I almost have what i want, so far there is only one subtle bug involving using the delete key to remove a delimiter. Does anyone have a better way to implement this validator? Here's my code so far: class HexStringValidator : public QValidator { public: HexStringValidator(QObject * parent) : QValidator(parent) {} public: virtual void fixup(QString &input) const { QString temp; int index = 0; // every 2 digits insert a space if they didn't explicitly type one Q_FOREACH(QChar ch, input) { if(std::isxdigit(ch.toAscii())) { if(index != 0 && (index & 1) == 0) { temp += ' '; } temp += ch.toUpper(); ++index; } } input = temp; } virtual State validate(QString &input, int &pos) const { if(!input.isEmpty()) { // TODO: can we detect if the char which was JUST deleted // (if any was deleted) was a space? and special case this? // as to not have the bug in this case? const int char_pos = pos - input.left(pos).count(' '); int chars = 0; fixup(input); pos = 0; while(chars != char_pos) { if(input[pos] != ' ') { ++chars; } ++pos; } // favor the right side of a space if(input[pos] == ' ') { ++pos; } } return QValidator::Acceptable; } }; For now this code is functional enough, but I'd love to have it work 100% as expected. Obviously the ideal would be the just separate the display of the hex string from the actual characters stored in the QLineEdit's internal buffer but I have no idea where to start with that and I imagine is a non-trivial undertaking. In essence, I would like to have a Validator which conforms to this regex: "[0-9A-Fa-f]( [0-9A-Fa-f])*" but I don't want the user to ever have to type a space as delimiter. Likewise, when editing what they types, the spaces should be managed implicitly.

    Read the article

  • Flash Buttons Don't Work: TypeError: Error #1009: Cannot access a property or method of a null objec

    - by goldenfeelings
    I've read through several threads about this error, but haven't been able to apply it to figure out my situation... My flash file is an approx 5 second animation. Then, the last keyframe of each layer (frame #133) has a button in it. My flash file should stop on this last key frame, and you should be able to click on any of the 6 buttons to navigate to another html page in my website. Here is the Action Script that I have applied to the frame in which the buttons exist (on a separate layer, see screenshot at: http://www.footprintsfamilyphoto.com/wp-content/themes/Footprints/images/flash_buttonissue.jpg stop (); function babieschildren(event:MouseEvent):void { trace("babies children method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/babies-children"); navigateToURL(targetURL, "_self"); } bc_btn1.addEventListener(MouseEvent.CLICK, babieschildren); bc_btn2.addEventListener(MouseEvent.CLICK, babieschildren); function fams(event:MouseEvent):void { trace("families method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/families"); navigateToURL(targetURL, "_self"); } f_btn1.addEventListener(MouseEvent.CLICK, fams); f_btn2.addEventListener(MouseEvent.CLICK, fams); function couplesweddings(event:MouseEvent):void { trace("couples weddings method was called!!!"); var targetURL:URLRequest = new URLRequest("http://www.footprintsfamilyphoto.com/portfolio/couples-weddings"); navigateToURL(targetURL, "_self"); } cw_btn1.addEventListener(MouseEvent.CLICK, couplesweddings); cw_btn2.addEventListener(MouseEvent.CLICK, couplesweddings); When I test the movie, I get this error in the output box: "TypeError: Error #1009: Cannot access a property or method of a null object reference." The test movie does stop on the appropriate frame, but the buttons don't do anything (no URL is opened, and the trace statements don't show up in the output box when the buttons are clicked on the test movie). You can view the .swf file here: www.footprintsfamilyphoto.com/portfolio I'm confident that all 6 buttons do exist in the appropriate frame (frame 133), so I don't think that's what's causing the 1009 error. I also tried deleting each of the three function/addEventListener sections one at a time and testing, and I still got the 1009 error every time. If I delete ALL of the action script except for the "stop ()" line, then I do NOT get the 1009 error. Any ideas?? I'm very new to Flash, so if I haven't clarified something that I need to, let me know!

    Read the article

  • WMS authentication plugin

    - by roul
    Hi, I'm trying to create a custom authentication plugin for WMS 2009 in C#. I managed to implement something that for some reason blocks all requests... [ComVisible(true)] [Guid("C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE")] public class AuthenticationPlugin : IWMSBasicPlugin, IWMSAuthenticationPlugin, IWMSAuthenticationContext private const string SubKey = "SOFTWARE\\Microsoft\\Windows Media\\Server\\RegisteredPlugins\\Authentication\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}"; [ComRegisterFunction] public static void RegisterFunction(Type t) { try { RegistryKey regHKLM = Registry.LocalMachine; regHKLM = regHKLM.CreateSubKey(SubKey); regHKLM.SetValue(null, "UC WMS Authentication plugin"); RegistryKey regHKCR = Registry.ClassesRoot; regHKCR = regHKCR.CreateSubKey("CLSID\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}\\Properties"); regHKCR.SetValue("Name", CustomC WMS Authentication plugin"); regHKCR.SetValue("Author", "Me"); regHKCR.SetValue("CopyRight", "Copyright 2009. All rights reserved"); regHKCR.SetValue("Description", "Enables custom WMS authentication"); } catch (Exception error) { Console.WriteLine(error.Message, "Inside RegisterFunction(). Cannot Register."); } } [ComUnregisterFunction] public static void UnRegisterFunction(Type t) { try { RegistryKey regHKLM = Registry.LocalMachine; regHKLM.DeleteSubKey(SubKey); RegistryKey regHKCR = Registry.ClassesRoot; regHKCR.DeleteSubKeyTree("CLSID\\{C0A0B38C-C4FE-43B5-BE9E-C100A83BBCEE}"); regHKCR.DeleteSubKeyTree("CSEventTest.CSEventPlugin"); } catch (Exception error) { Console.WriteLine(error.Message, "Cannot delete a subkey."); } } #region IWMSBasicPlugin Members public void InitializePlugin(IWMSContext serverContext, WMSNamedValues namedValues, IWMSClassObject classFactory) { } public void ShutdownPlugin() { } public void EnablePlugin(ref int flags, ref int heartbeatPeriod) { } public void DisablePlugin() { } public object GetCustomAdminInterface() { return null; } public void OnHeartbeat() { } #endregion #region IWMSAuthenticationPlugin Members public IWMSAuthenticationContext CreateAuthenticationContext() { return (IWMSAuthenticationContext)this; } public int GetFlags() { return Convert.ToInt32(WMS_AUTHENTICATION_FLAGS.WMS_AUTHENTICATION_ANONYMOUS, CultureInfo.InvariantCulture); } public string GetPackageName() { return "Custom WMS Authentication"; } public string GetProtocolName() { return "Basic"; } #endregion #region IWMSAuthenticationContext Members public void Authenticate(object responseBlob, IWMSContext userContext, IWMSContext presentationContext, IWMSCommandContext commandContext, IWMSAuthenticationCallback callBack, object context) { callBack.OnAuthenticateComplete(WMS_AUTHENTICATION_RESULT.WMS_AUTHENTICATION_SUCCESS, null, context); } public IWMSAuthenticationPlugin GetAuthenticationPlugin() { return (IWMSAuthenticationPlugin)this; } public string GetImpersonationAccountName() { return String.Empty; } public int GetImpersonationToken() { return 0; } public string GetLogicalUserID() { return this.GetImpersonationAccountName(); } #endregion } Can anyone spot why this is happening? Also, is there any way I could have a look at the code for the standard Anonymous Authentication plugin already installed on the server? Is it in an assembly somewhere? Thanks.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can't get InputStream read to block...

    - by mark dufresne
    I would like the input stream read to block instead of reading end of stream (-1). Is there a way to configure the stream to do this? Here's my Servlet code: PrintWriter out = response.getWriter(); BufferedReader in = request.getReader(); try { String line; int loop = 0; while (loop < 20) { line = in.readLine(); lgr.log(Level.INFO, line); out.println("<" + loop + "html>"); Thread.sleep(1000); loop++; // } } catch (InterruptedException ex) { lgr.log(Level.SEVERE, null, ex); } finally { out.close(); } Here's my Midlet code: private HttpConnection conn; InputStream is; OutputStream os; private boolean exit = false; public void run() { String url = "http://localhost:8080/WebApplication2/NewServlet"; try { conn = (HttpConnection) Connector.open(url); is = conn.openInputStream(); os = conn.openOutputStream(); StringBuffer sb = new StringBuffer(); int c; while (!exit) { os.write("<html>\n".getBytes()); while ((c = is.read()) != -1) { sb.append((char) c); } System.out.println(sb.toString()); sb.delete(0, sb.length() - 1); try { Thread.sleep(1000); } catch (InterruptedException ex) { ex.printStackTrace(); } } os.close(); is.close(); conn.close(); } catch (IOException ex) { ex.printStackTrace(); } } I've tried InputStream.read, but it doesn't block either, it returns -1 as well. I'm trying to keep the I/O streams on either side alive. I want the servlet to wait for input, process the input, then send back a response. In the code above it should do this 20 times. thanks for any help

    Read the article

  • Magento: add product twice to cart, with different attributes!

    - by Peter
    Hello all, i have been working with this for a whole day but i cannot find any solution: I have a product (lenses), which has identical attributes, but user can choose one attribute set for one eye and another attribute set for another. On the frontend i got it ok, see it here: http://connecta.si/clarus/index.php/featured/acuvue-oasys-for-astigmatism.html So the user can select attributes for left or right eye, but it is the same product. I build a function, wich should take a product in a cart (before save), add other set of attributes, so there should be two products in the cart. What happens is there are two products, but with the same set of attributes??? Here is the snippet of the function: $req = Mage::app()-getRequest(); $request[’qty’] = 1; $request[’product’] = 15; $request[’uenc’] = $req-get(’uenc’); $request[’options’][1] = 1; $request[’options’][3] = 5; $request[’options’][2] = 3; $reqo = new Varien_Object($request); $newitem = $quote-addProduct($founditem-getProduct(), $reqo); //add another one ------------------------------------------ $request[’qty’] = 1; $request[’product’] = 15; $request[’uenc’] = $req-get(’uenc’); $request[’options’][1] = 2; $request[’options’][3] = 6; $request[’options’][2] = 4; $reqo = new Varien_Object($request); $newitem = $quote-addProduct($founditem-getProduct(), $reqo); Or another test, with some other functions (again, product added, with 2 quantity , but same attributes...): $req = Mage::app()-getRequest(); $request[’qty’] = 1; $request[’product’] = 15; $request[’uenc’] = $req-get(’uenc’); $request[’options’][1] = 2; $request[’options’][3] = 6; $request[’options’][2] = 4; $product = $founditem-getProduct(); $cart = Mage::getSingleton(’checkout/cart’); //delete all first… $cart-getItems()-clear()-save(); $reqo = new Varien_Object($request); $cart-addProduct($founditem-getProduct(), $reqo); $cart-getItems()-save(); $request[’options’][1] = 1; $request[’options’][3] = 5; $request[’options’][2] = 3; $reqo = new Varien_Object($request); $cart-addProduct($founditem-getProduct(), $reqo); $cart-getItems()-save(); i really dont know what more to do, please any advice, this is my first module in magento… thank you, Peter

    Read the article

  • J2ME/Java: Referencing StringBuffer through Threads

    - by Jemuel Dalino
    This question might be long, but I want to provide much information. Overview: I'm creating a Stock Quotes Ticker app for Blackberry. But I'm having problems with my StringBuffer that contains an individual Stock information. Process: My app connects to our server via SocketConnection. The server sends out a formatted set of strings that contains the latest Stock trade. So whenever a new trade happens, the server will send out an individual Stock Quote of that trade. Through an InputStream I am able to read that information and place each character in a StringBuffer that is referenced by Threads. By parsing based on char3 I am able to determine a set of stock quote/information. char1 - to separate data char3 - means end of a stock quote/information sample stock quote format sent out by our server: stock_quote_name(char 1)some_data(char1)some_data(char1)(char3) My app then parses that stock quote to compare certain data and formats it how it will look like when displayed in the screen. When trades happen gradually(slow) the app works perfectly. However.. Problem: When trades happen too quickly and almost at the same time, My app is not able to handle the information sent efficiently. The StringBuffer has its contents combined with the next trade. Meaning Two stock information in one StringBuffer. field should be: Stock_quote_name some_data some_data sample of what's happening: Stock_quote_name some_data some_dataStock_quote_name some_data some_data here's my code for this part: while (-1 != (data = is.read())) { sb.append((char)data); while(3 != (data = is.read())) { sb.append((char)data); } UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { try { synchronized(UiApplication.getEventLock()) { SetStringBuffer(sb); DisplayStringBuffer(); RefreshStringBuffer(); } } catch (Exception e) { System.out.println("Error in setting stringbuffer: " + e.toString()); } } }); } public synchronized void DisplayStringBuffer() { try { //parse sb - string buffer ...... } catch(Exception ex) { System.out.println("error in DisplayStringBuffer(): " + ex.toString()); } } public synchronized void SetStringBuffer(StringBuffer dataBuffer) { this.sb =dataBuffer; System.out.println(sb); } public synchronized void RefreshStringBuffer() { this.sb.delete(0, this.sb.length()); } From what I can see, when trades happen very fast, The StringBuffer is not refreshed immediately and still has the contents of the previous trade, when i try to put new data. My Question is: Do you guys have any suggestion on how i can put data into the StringBuffer, without the next information being appended to the first content

    Read the article

  • Overwrite values when using gridview Edit?

    - by sah302
    I am using a GridView which is bound to a LinqDataSource and using the automatic edit and delete buttons. However, I don't want the user to edit two of the columns manually, but done automatically. Specifically username who last updated the entry, and the date it was updated. The gridview only contains 3 columns: Name, Date modified, last updated by. Right now when the user clicks the edit button they can only edit the name column (other two set to read-only). Upon clicking the update button, I want the other 2 fields to update as well based on some extra code. I thought this was done in the code behind within the event rowUpdating, but it doesn't seem to work. My gridview: <asp:GridView ID="gvNewsSources" runat="server" AutoGenerateColumns="False" DataSourceID="ldsNewsSource" AutoGenerateDeleteButton="True" AutoGenerateEditButton="True" CellPadding="4" ForeColor="#333333" GridLines="None" DataKeyNames="Id"> <RowStyle BackColor="#F7F6F3" ForeColor="#333333" /> <Columns> <asp:BoundField DataField="Name" HeaderText="Name" SortExpression="Name" /> <asp:BoundField DataField="LastUpdatedBy" HeaderText="Last Updated By" SortExpression="LastUpdatedBy" ReadOnly="True" /> <asp:BoundField DataField="DatedModified" HeaderText="Dated Modified" SortExpression="DatedModified" ReadOnly="True" /> </Columns> <FooterStyle BackColor="#5D7B9D" Font-Bold="True" ForeColor="White" /> <PagerStyle BackColor="#284775" ForeColor="White" HorizontalAlign="Center" /> <SelectedRowStyle BackColor="#E2DED6" Font-Bold="True" ForeColor="#333333" /> <HeaderStyle BackColor="#5D7B9D" Font-Bold="True" ForeColor="White" /> <EditRowStyle BackColor="#999999" /> <AlternatingRowStyle BackColor="White" ForeColor="#284775" /> </asp:GridView> My code behind: Partial Class _Default Inherits System.Web.UI.Page Protected Sub gvNewsSources_RowUpdating(ByVal sender As Object, ByVal e As System.Web.UI.WebControls.GridViewUpdateEventArgs) Handles gvNewsSources.RowUpdating e.NewValues("LastUpdatedBy") = GetUser.GetUserName e.NewValues("DateModified") = Date.Now() lblOutput.Text = e.NewValues("DateModified").ToString() End Sub End Class Yet when I run through this, I get no errors, but the values aren't being updated in the database or in the gridview. I ran through debug mode and the new values dictionary starts at 1 and ends up being 3 by the end of the rowUpdating event and the value is being set (tested by output the newValue of Datemodified), but it isn't saving. What am I doing wrong?

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • Spring transaction management breaks hibernate cascade

    - by TimmyJ
    I'm having a problem where the addition of spring's transaction management to an application causes Hibernate to throw the following error: org.hibernate.HibernateException: A collection with cascade="all-delete-orphan" was no longer referenced by the owning entity instance: org.fstrf.masterpk.domain.ReportCriteriaBean.treatmentArms org.hibernate.engine.Collections.processDereferencedCollection(Collections.java:96) org.hibernate.engine.Collections.processUnreachableCollection(Collections.java:39) org.hibernate.event.def.AbstractFlushingEventListener.flushCollections(AbstractFlushingEventListener.java:218) org.hibernate.event.def.AbstractFlushingEventListener.flushEverythingToExecutions(AbstractFlushingEventListener.java:77) org.hibernate.event.def.DefaultFlushEventListener.onFlush(DefaultFlushEventListener.java:26) org.hibernate.impl.SessionImpl.flush(SessionImpl.java:1000) org.springframework.orm.hibernate3.SpringSessionSynchronization.beforeCommit(SpringSessionSynchronization.java:135) org.springframework.transaction.support.TransactionSynchronizationUtils.triggerBeforeCommit(TransactionSynchronizationUtils.java:72) org.springframework.transaction.support.AbstractPlatformTransactionManager.triggerBeforeCommit(AbstractPlatformTransactionManager.java:905) org.springframework.transaction.support.AbstractPlatformTransactionManager.processCommit(AbstractPlatformTransactionManager.java:715) org.springframework.transaction.support.AbstractPlatformTransactionManager.commit(AbstractPlatformTransactionManager.java:701) org.springframework.transaction.interceptor.TransactionAspectSupport.commitTransactionAfterReturning(TransactionAspectSupport.java:321) org.springframework.transaction.interceptor.TransactionInterceptor.invoke(TransactionInterceptor.java:116) org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:171) org.springframework.aop.framework.JdkDynamicAopProxy.invoke(JdkDynamicAopProxy.java:204) $Proxy92.saveNewReportCriteria(Unknown Source) org.fstrf.masterpk.domain.logic.MasterPkFacade.saveNewReportCriteria(MasterPkFacade.java:134) org.fstrf.masterpk.controllers.ReportCriteriaController.setupReportType(ReportCriteriaController.java:302) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) java.lang.reflect.Method.invoke(Method.java:585) org.springframework.web.bind.annotation.support.HandlerMethodInvoker.doInvokeMethod(HandlerMethodInvoker.java:413) org.springframework.web.bind.annotation.support.HandlerMethodInvoker.invokeHandlerMethod(HandlerMethodInvoker.java:134) org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter.invokeHandlerMethod(AnnotationMethodHandlerAdapter.java:310) org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter.handle(AnnotationMethodHandlerAdapter.java:297) org.springframework.web.servlet.DispatcherServlet.doDispatch(DispatcherServlet.java:875) org.springframework.web.servlet.DispatcherServlet.doService(DispatcherServlet.java:809) org.springframework.web.servlet.FrameworkServlet.processRequest(FrameworkServlet.java:571) org.springframework.web.servlet.FrameworkServlet.doPost(FrameworkServlet.java:511) javax.servlet.http.HttpServlet.service(HttpServlet.java:710) javax.servlet.http.HttpServlet.service(HttpServlet.java:803) org.jboss.web.tomcat.filters.ReplyHeaderFilter.doFilter(ReplyHeaderFilter.java:96) I'm using Spring 2.5 and annotations to implement this management. Here is the class containing the saveNewReportCriteria method (which, as can be seen by the stack trace, is causing the error) @Transactional( propagation = Propagation.REQUIRED, isolation = Isolation.DEFAULT, readOnly = false) public class HibernateReportCriteriaDao implements ReportCriteriaDao{ private HibernateTemplate hibernateTemplate; public Integer saveNewReportCriteria(ReportCriteriaBean reportCriteria) { hibernateTemplate.save(reportCriteria); List<Integer> maxIdList = hibernateTemplate.find("SELECT max(id) from ReportCriteriaBean"); logger.info("ID of newly saved list is: " + maxIdList.get(0)); return maxIdList.get(0); } public void setHibernateTemplate(HibernateTemplate hibernateTemplate) { this.hibernateTemplate = hibernateTemplate; } } Then I added the following sections to my configuration files to tell spring that I am using annotation driven transaction management: <bean id="actgDataSource" class="org.springframework.jndi.JndiObjectFactoryBean"> <property name="jndiName" value="jdbc/actg" /> <property name="resourceRef" value="true" /> </bean> <bean id="transactionManager" class="org.springframework.jdbc.datasource.DataSourceTransactionManager"> <property name="dataSource" ref="actgDataSource" /> </bean> <tx:annotation-driven/> I'm pretty sure that the de-referencing error is being caused due to the proxy class that Spring AOP creates and uses in order to handle transaction management, but I have no idea how I'd go about fixing it.

    Read the article

< Previous Page | 420 421 422 423 424 425 426 427 428 429 430 431  | Next Page >