Search Results

Search found 21268 results on 851 pages for 'null route'.

Page 435/851 | < Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Windows Azure Diagnostics: Next to Useless?

    - by Your DisplayName here!
    To quote my good friend Christian: “Tracing is probably one of the most discussed topics in the Windows Azure world. Not because it is freaking cool – but because it can be very tedious and partly massively counter-intuitive.” <rant> The .NET Framework has this wonderful facility called TraceSource. You define a named trace and route that to a configurable listener. This gives you a lot of flexibility – you can create a single trace file – or multiple ones. There is even nice tooling around that. SvcTraceViewer from the SDK let’s you open the XML trace files – you can filter and sort by trace source and event type, aggreate multiple files…blablabla. Just what you would expect from a decent tracing infrastructure. Now comes Windows Azure. I was already were grateful that starting with the SDK 1.2 we finally had a way to do tracing and diagnostics in the cloud (kudos!). But the way the Azure DiagnosticMonitor is currently implemented – could be called flawed. The Azure SDK provides a DiagnosticsMonitorTraceListener – which is the right way to go. The only problem is, that way this works is, that all traces (from all sources) get written to an ETW trace. Then the DiagMon listens to these traces and copies them periodically to your storage account. So far so good. But guess what happens to your nice trace files: the trace source names get “lost”. They appear in your message text at the end. So much for filtering and sorting and aggregating (regex #fail or #win??). Every trace line becomes an entry in a Azure Storage Table – the svclog format is gone. So much for the existing tooling. To solve that problem, one workaround was to write your own trace listener (!) that creates svclog files inside of local storage and use the DiagMon to copy those. Christian has a blog post about that. OK done that. Now it turns out that this mechanism does not work anymore in 1.3 with FullIIS (see here). Quoting: “Some IIS 7.0 logs not collected due to permissions issues...The root cause to both of these issues is the permissions on the log files.” And the workaround: “To read the files yourself, log on to the instance with a remote desktop connection.” Now then have fun with your multi-instance deployments…. </rant>

    Read the article

  • SQL – What ACID stands in the Database? – Contest to Win 24 Amazon Gift Cards and Joes 2 Pros 2012 Kit

    - by Pinal Dave
    We love puzzles. One of the brain’s main task is to solve puzzles. Sometime puzzles are very complicated (e.g Solving Rubik Cube or Sodoku)  and sometimes the puzzles are very simple (multiplying 4 by 8 or finding the shortest route while driving). It is always to solve puzzle and it creates an experience which humans are not able to forget easily. The best puzzles are the one where one has to do multiple things to reach to the final goal. Let us do something similar today. We will have a contest where you can participate and win something interesting. Contest This contest have two parts. Question 1: What ACID stands in the Database? This question seems very easy but here is the twist. Your answer should explain minimum one of the properties of the ACID in detail. If you wish you can explain all the four properties of the ACID but to qualify you need to explain minimum of the one properties. Question 2: What is the size of the installation file of NuoDB for any specific platform. You can answer this question following format – NuoDB installation file is of size __ MB for ___ Platform. Click on the Download the Link and download your installation file for NuoDB. You can post figure out the file size from the properties of the file. We have exciting content prizes for the winners. Prizes 1) 24 Amazon Gift Cards of USD 10 for next 24 hours. One card at every hour. (Open anywhere in the world) 2) One grand winner will get Joes 2 Pros SQL Server 2012 Training Kit worth USD 249. (Open where Amazon ship books). Amazon | 1 | 2 | 3 | 4 | 5  Rules The contest will be open till July 21, 2013. All the valid comments will be hidden till the result is announced. The winners will be announced on July 24, 2013. Hint: Download NuoDB  Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: PostADay, SQL, SQL Authority, SQL Puzzle, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Problems in php coding

    - by anwar
    Hi there everyone im new to PHP and Joomla and I have developed a component in Joomla but my code is giving me errors. I have tried to solve the problem but I’am unable to solve it. So can anyone suggest me what is the problem with my code? Thanks in advance. Here are my two files: 1st view.html.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.view'); class namnamViewlistrestaurant extends JView { function display($tpl = null) { $item = 'item'; RestUser::RestrictDirectAccess(); //-- Custom css JHTML::stylesheet( 'style.css', 'components/com_namnam/assets/css/' ); $cuisine=Lookups::getLookup('cuisine'); $lists['cuisine'] = JHTML::_('select.genericlist', $cuisine, 'idcuisine[]', 'class="inputbox" size="7"', 'value', 'text', $item->idcuisine); $category=Lookups::getLookup('restcategory'); $lists['category'] = JHTML::_('select.genericlist', $category, 'idcategory[]', 'class="inputbox" multiple="multiple" size="7"', 'value', 'text', $item->idcategory); $items = & $this->get('Data'); $pagination =& $this->get('Pagination'); $lists = & $this->get('List'); $this->assignRef('items', $items); $this->assignRef('pagination', $pagination); $this->assignRef('lists', $lists); parent::display($tpl); }//function }//class And 2nd is listrestaurant.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.model'); class namnamModellistrestaurant extends JModel { var $_data; var $_total = null; var $_pagination = null; function __construct() { parent::__construct(); global $mainframe, $option; $limit = $mainframe->getUserStateFromRequest( 'global.list.limit', 'limit', $mainframe->getCfg('list_limit'), 'int' ); $limitstart = $mainframe->getUserStateFromRequest( $option.'.limitstart', 'limitstart', 0, 'int' ); $limitstart = ($limit != 0 ? (floor($limitstart / $limit) * $limit) : 0); $this->setState('limit', $limit); $this->setState('limitstart', $limitstart); } function _buildQuery() { $where = array(); $where[]=" idowner=".RestUser::getUserID()." "; if ($this->search) { $where[] = 'LOWER(name) LIKE \''. $this->search. '\''; } $where =( count($where) ) ? ' WHERE ' . implode( ' AND ', $where ) : ''; $orderby = ''; #_ECR_MAT_FILTER_MODEL1_ if (($this->filter_order) && ($this->filter_order_Dir)) { $orderby = ' ORDER BY '. $this->filter_order .' '. $this->filter_order_Dir; } $this->_query = ' SELECT *' . ' FROM #__namnam_restaurants ' . $where . $orderby ; return $this->_query; } function getData() { if (empty($this->_data)) { $query = $this->_buildQuery(); $this->_data = $this->_getList($query, $this->getState('limitstart'), $this->getState('limit')); } return $this->_data; } function getList() { // table ordering $lists['order_Dir'] = $this->filter_order_Dir; $lists['order'] = $this->filter_order; // search filter $lists['search']= $this->search; return $lists; } function getTotal() { // Load the content if it doesn't already exist if (empty($this->_total)) { $query = $this->_buildQuery(); $this->_total = $this->_getListCount($query); } return $this->_total; } function getPagination() { // Load the content if it doesn't already exist if (empty($this->_pagination)) { jimport('joomla.html.pagination'); $this->_pagination = new JPagination($this->getTotal(), $this->getState('limitstart'), $this->getState('limit') ); } return $this->_pagination; } }//class And the errors are: Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 26 Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 29 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$filter_order_Dir in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 76 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 77 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 80

    Read the article

  • Can't access local network when connect to pppoe

    - by shantanu
    I am using DSL(PPPOE) connection in ubuntu. It has two part (I am not sure), when I just connect the cable, system automatically get an IP address started with 172.x.x.x(DHCP). When I connect using username/password (PPPOE) I get another IP started with 10.x.x.x and can access internet but can't access some local IP (in my LAN), which are some FTP, media server provided by my ISP. I complained about that to my ISP but they reply Windows is working It's true, Windows 7 is working fine with this settings. I can access internet and local server at the same time. Also I use a WIFI router (TP-link TL-WR340G/TL-WR340GD) which result the same problem. So when I connect cable directly to system and use Windows 7 than everything is fine. Otherwise problem. Similar problem discussed here. Edit before connect. route -n Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 0.0.0.0 172.100.0.1 0.0.0.0 UG 0 0 0 eth0 172.100.0.0 0.0.0.0 255.255.0.0 U 1 0 0 eth0 after connect. Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 0.0.0.0 10.12.44.91 0.0.0.0 UG 0 0 0 ppp0 10.12.44.91 0.0.0.0 255.255.255.255 UH 0 0 0 ppp0 ifconfig after connect eth0 Link encap:Ethernet HWaddr 74:d0:2b:d5:b3:6c inet6 addr: fe80::76d0:2bff:fed5:b36c/64 Scope:Link inet6 addr: 2002:ac64:154:c:76d0:2bff:fed5:b36c/64 Scope:Global inet6 addr: fec0::c:76d0:2bff:fed5:b36c/64 Scope:Site UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:26582 errors:0 dropped:18 overruns:0 frame:0 TX packets:2340 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:2542063 (2.5 MB) TX bytes:244938 (244.9 KB) lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:65536 Metric:1 RX packets:4118 errors:0 dropped:0 overruns:0 frame:0 TX packets:4118 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:336759 (336.7 KB) TX bytes:336759 (336.7 KB) ppp0 Link encap:Point-to-Point Protocol inet addr:10.12.44.95 P-t-P:10.12.44.91 Mask:255.255.255.255 inet6 addr: fe80::a536:c7ae:e079:d88d/10 Scope:Link UP POINTOPOINT RUNNING NOARP MULTICAST MTU:1492 Metric:1 RX packets:689 errors:0 dropped:0 overruns:0 frame:0 TX packets:744 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:3 RX bytes:385746 (385.7 KB) TX bytes:75296 (75.2 KB) I used network manager to create network(DSL connection)

    Read the article

  • problem in displaying list using array adapters

    - by Rahul Varma
    Hi, I am trying to display the list of songs using array adapters. But the problem is i couldnt display the list and only empty screen with preset background is showing up. Here's the code...All the thee are seperate classes... Plz help me... public class SongsAdapter extends ArrayAdapter<SongsList>{ private Context context; TextView tvTitle; TextView tvMovie; TextView tvSinger; String s; public SongsAdapter(Context context, int resource, int textViewResourceId, String title) { super(context, resource, textViewResourceId); this.context=context; } public View getView(int position, View convertView, ViewGroup parent) { final int i=position; List<SongsList> listSongs = new ArrayList<SongsList>(); String title = listSongs.get(i).gettitleName().toString(); String album = listSongs.get(i).getmovieName().toString(); String artist = listSongs.get(i).getsingerName().toString(); String imgal = listSongs.get(i).gettitleName().toString(); LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tvTitle=(TextView)v.findViewById(R.id.text2); tvMovie=(TextView)v.findViewById(R.id.text3); tvSinger=(TextView)v.findViewById(R.id.text1); tvTitle.setText(title); tvMovie.setText(album); tvSinger.setText(artist); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal; String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } public class imageloader implements Runnable{ private String ss; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); is.close(); im.setImageBitmap(bm); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); } } } } public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class MusicListActivity extends Activity { @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); ListView list = (ListView)findViewById(R.id.list1); SongsAdapter adapter = new SongsAdapter(this,R.layout.row, R.id.text2, null); list.setAdapter(adapter); } }

    Read the article

  • Spritebatch drawing sprite with jagged borders

    - by Mutoh
    Alright, I've been on the making of a sprite class and a sprite sheet manager, but have come across this problem. Pretty much, the project is acting like so; for example: Let's take this .png image, with a transparent background. Note how it has alpha-transparent pixels around it in the lineart. Now, in the latter link's image, in the left (with CornflowerBlue background) it is shown the image drawn in another project (let's call it "Project1") with a simpler sprite class - there, it works. The right (with Purple background for differentiating) shows it drawn with a different class in "Project2" - where the problem manifests itself. This is the Sprite class of Project1: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace WindowsGame2 { class Sprite { Vector2 pos = new Vector2(0, 0); Texture2D image; Rectangle size; float scale = 1.0f; // --- public float X { get { return pos.X; } set { pos.X = value; } } public float Y { get { return pos.Y; } set { pos.Y = value; } } public float Width { get { return size.Width; } } public float Height { get { return size.Height; } } public float Scale { get { return scale; } set { if (value < 0) value = 0; scale = value; if (image != null) { size.Width = (int)(image.Width * scale); size.Height = (int)(image.Height * scale); } } } // --- public void Load(ContentManager Man, string filename) { image = Man.Load<Texture2D>(filename); size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Become(Texture2D frame) { image = frame; size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Draw(SpriteBatch Desenhista) { // Desenhista.Draw(image, pos, Color.White); Desenhista.Draw( image, pos, new Rectangle( 0, 0, image.Width, image.Height ), Color.White, 0.0f, Vector2.Zero, scale, SpriteEffects.None, 0 ); } } } And this is the code in Project2, a rewritten, pretty much, version of the previous class. In this one I added sprite sheet managing and, in particular, removed Load and Become, to allow for static resources and only actual Sprites to be instantiated. using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { // Actually, I might desconsider this, and instead use static AnimationLocation[] and instanciated ID and Frame; // For determining the starting frame of an animation in a sheet and being able to iterate through // the Rectangles vector of the Sheet; class AnimationLocation { public int Location; public int FrameCount; // --- public AnimationLocation(int StartingRow, int StartingColumn, int SheetWidth, int NumberOfFrames) { Location = (StartingRow * SheetWidth) + StartingColumn; FrameCount = NumberOfFrames; } public AnimationLocation(int PositionInSheet, int NumberOfFrames) { Location = PositionInSheet; FrameCount = NumberOfFrames; } public static int CalculatePosition(int StartingRow, int StartingColumn, SheetManager Sheet) { return ((StartingRow * Sheet.Width) + StartingColumn); } } class Sprite { // The general stuff; protected SheetManager Sheet; protected Vector2 Position; public Vector2 Axis; protected Color _Tint; public float Angle; public float Scale; protected SpriteEffects _Effect; // --- // protected AnimationManager Animation; // For managing the animations; protected AnimationLocation[] Animation; public int AnimationID; protected int Frame; // --- // Properties for easy accessing of the position of the sprite; public float X { get { return Position.X; } set { Position.X = Axis.X + value; } } public float Y { get { return Position.Y; } set { Position.Y = Axis.Y + value; } } // --- // Properties for knowing the size of the sprite's frames public float Width { get { return Sheet.FrameWidth * Scale; } } public float Height { get { return Sheet.FrameHeight * Scale; } } // --- // Properties for more stuff; public Color Tint { set { _Tint = value; } } public SpriteEffects Effect { set { _Effect = value; } } public int FrameID { get { return Frame; } set { if (value >= (Animation[AnimationID].FrameCount)) value = 0; Frame = value; } } // --- // The only things that will be constantly modified will be AnimationID and FrameID, anything else only // occasionally; public Sprite(SheetManager SpriteSheet, AnimationLocation[] Animations, Vector2 Location, Nullable<Vector2> Origin = null) { // Assign the sprite's sprite sheet; // (Passed by reference! To allow STATIC sheets!) Sheet = SpriteSheet; // Define the animations that the sprite has available; // (Passed by reference! To allow STATIC animation boundaries!) Animation = Animations; // Defaulting some numerical values; Angle = 0.0f; Scale = 1.0f; _Tint = Color.White; _Effect = SpriteEffects.None; // If the user wants a default Axis, it is set in the middle of the frame; if (Origin != null) Axis = Origin.Value; else Axis = new Vector2( Sheet.FrameWidth / 2, Sheet.FrameHeight / 2 ); // Now that we have the axis, we can set the position with no worries; X = Location.X; Y = Location.Y; } // Simply put, draw the sprite with all its characteristics; public void Draw(SpriteBatch Drafter) { Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f ); } } } And, in any case, this is the SheetManager class found in the previous code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { class SheetManager { protected Texture2D SpriteSheet; // For storing the sprite sheet; // Number of rows and frames in each row in the SpriteSheet; protected int NumberOfRows; protected int NumberOfColumns; // Size of a single frame; protected int _FrameWidth; protected int _FrameHeight; public Rectangle[] Rectangles; // For storing each frame; // --- public int Width { get { return NumberOfColumns; } } public int Height { get { return NumberOfRows; } } // --- public int FrameWidth { get { return _FrameWidth; } } public int FrameHeight { get { return _FrameHeight; } } // --- public Texture2D Texture { get { return SpriteSheet; } } // --- public SheetManager (Texture2D Texture, int Rows, int FramesInEachRow) { // Normal assigning SpriteSheet = Texture; NumberOfRows = Rows; NumberOfColumns = FramesInEachRow; _FrameHeight = Texture.Height / NumberOfRows; _FrameWidth = Texture.Width / NumberOfColumns; // Framing everything Rectangles = new Rectangle[NumberOfRows * NumberOfColumns]; int ID = 0; for (int i = 0; i < NumberOfRows; i++) { for (int j = 0; j < NumberOfColumns; j++) { Rectangles[ID] = new Rectangle ( _FrameWidth * j, _FrameHeight * i, _FrameWidth, _FrameHeight ); ID++; } } } public SheetManager (Texture2D Texture, int NumberOfFrames): this(Texture, 1, NumberOfFrames) { } } } For even more comprehending, if needed, here is how the main code looks like (it's just messing with the class' capacities, nothing actually; the result is a disembodied feet walking in place animation on the top-left of the screen and a static axe nearby): using System; using System.Collections.Generic; using System.Linq; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Audio; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.GamerServices; using Microsoft.Xna.Framework.Graphics; using Microsoft.Xna.Framework.Input; using Microsoft.Xna.Framework.Media; using System.Threading; namespace Mobby_s_Adventure { /// <summary> /// This is the main type for your game /// </summary> public class Game1 : Microsoft.Xna.Framework.Game { GraphicsDeviceManager graphics; SpriteBatch spriteBatch; static List<Sprite> ToDraw; static Texture2D AxeSheet; static Texture2D FeetSheet; static SheetManager Axe; static Sprite Jojora; static AnimationLocation[] Hack = new AnimationLocation[1]; static SheetManager Feet; static Sprite Mutoh; static AnimationLocation[] FeetAnimations = new AnimationLocation[2]; public Game1() { graphics = new GraphicsDeviceManager(this); Content.RootDirectory = "Content"; this.TargetElapsedTime = TimeSpan.FromMilliseconds(100); this.IsFixedTimeStep = true; } /// <summary> /// Allows the game to perform any initialization it needs to before starting to run. /// This is where it can query for any required services and load any non-graphic /// related content. Calling base.Initialize will enumerate through any components /// and initialize them as well. /// </summary> protected override void Initialize() { // TODO: Add your initialization logic here base.Initialize(); } /// <summary> /// LoadContent will be called once per game and is the place to load /// all of your content. /// </summary> protected override void LoadContent() { // Create a new SpriteBatch, which can be used to draw textures. spriteBatch = new SpriteBatch(GraphicsDevice); // Loading logic ToDraw = new List<Sprite>(); AxeSheet = Content.Load<Texture2D>("Sheet"); FeetSheet = Content.Load<Texture2D>("Feet Sheet"); Axe = new SheetManager(AxeSheet, 1); Hack[0] = new AnimationLocation(0, 1); Jojora = new Sprite(Axe, Hack, new Vector2(100, 100), new Vector2(5, 55)); Jojora.AnimationID = 0; Jojora.FrameID = 0; Feet = new SheetManager(FeetSheet, 8); FeetAnimations[0] = new AnimationLocation(1, 7); FeetAnimations[1] = new AnimationLocation(0, 1); Mutoh = new Sprite(Feet, FeetAnimations, new Vector2(0, 0)); Mutoh.AnimationID = 0; Mutoh.FrameID = 0; } /// <summary> /// UnloadContent will be called once per game and is the place to unload /// all content. /// </summary> protected override void UnloadContent() { // TODO: Unload any non ContentManager content here } /// <summary> /// Allows the game to run logic such as updating the world, /// checking for collisions, gathering input, and playing audio. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Update(GameTime gameTime) { // Allows the game to exit if (GamePad.GetState(PlayerIndex.One).Buttons.Back == ButtonState.Pressed) this.Exit(); // Update logic Mutoh.FrameID++; ToDraw.Add(Mutoh); ToDraw.Add(Jojora); base.Update(gameTime); } /// <summary> /// This is called when the game should draw itself. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } spriteBatch.Draw(Content.Load<Texture2D>("Sheet"), new Rectangle(50, 50, 55, 60), Color.White); spriteBatch.End(); base.Draw(gameTime); } } } Please help me find out what I'm overlooking! One thing that I have noticed and could aid is that, if inserted the equivalent of this code spriteBatch.Draw( Content.Load<Texture2D>("Image Location"), new Rectangle(X, Y, images width, height), Color.White ); in Project2's Draw(GameTime) of the main loop, it works. EDIT Ok, even if the matter remains unsolved, I have made some more progress! As you see, I managed to get the two kinds of rendering in the same project (the aforementioned Project2, with the more complex Sprite class). This was achieved by adding the following code to Draw(GameTime): protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } // Starting here spriteBatch.Draw( Axe.Texture, new Vector2(65, 100), new Rectangle ( 0, 0, Axe.FrameWidth, Axe.FrameHeight ), Color.White, 0.0f, new Vector2(0, 0), 1.0f, SpriteEffects.None, 0.0f ); // Ending here spriteBatch.End(); base.Draw(gameTime); } (Supposing that Axe is the SheetManager containing the texture, sorry if the "jargons" of my code confuse you :s) Thus, I have noticed that the problem is within the Sprite class. But I only get more clueless, because even after modifying its Draw function to this: public void Draw(SpriteBatch Drafter) { /*Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f );*/ Drafter.Draw( Sheet.Texture, Position, new Rectangle( 0, 0, Sheet.FrameWidth, Sheet.FrameHeight ), Color.White, 0.0f, Vector2.Zero, Scale, SpriteEffects.None, 0 ); } to make it as simple as the patch of code that works, it still draws the sprite jaggedly!

    Read the article

  • KVM Bridged Network Not Working

    - by EApubs
    I just installed KVM on my Ubuntu Server according to this guide : https://help.ubuntu.com/community/KVM/Installation Then prepared a bridged network as shown in here : https://help.ubuntu.com/community/KVM/Networking Then, I created a virtual machine with virt-manager. I tried several times but the guest fails to connect to the network! Any help? ifconfig : br0 Link encap:Ethernet HWaddr d0:27:88:b0:e4:38 inet addr:192.168.20.100 Bcast:192.168.20.255 Mask:255.255.255.0 inet6 addr: fe80::d227:88ff:feb0:e438/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:62 errors:0 dropped:0 overruns:0 frame:0 TX packets:62 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:10493 (10.4 KB) TX bytes:8433 (8.4 KB) eth0 Link encap:Ethernet HWaddr d0:27:88:b0:e4:38 UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:62 errors:0 dropped:0 overruns:0 frame:0 TX packets:63 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:11361 (11.3 KB) TX bytes:8479 (8.4 KB) Interrupt:41 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) virbr0 Link encap:Ethernet HWaddr 5a:8c:57:95:af:3b inet addr:192.168.122.1 Bcast:192.168.122.255 Mask:255.255.255.0 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) brctl show : bridge name bridge id STP enabled interfaces br0 8000.d02788b0e438 no eth0 virbr0 8000.000000000000 yes brctl showmacs br0 : port no mac addr is local? ageing timer 1 5c:d9:98:67:b6:28 no 48.33 1 d0:27:88:b0:e4:38 yes 0.00 1 e0:2a:82:f9:6c:09 no 0.00 ip route : default via 192.168.20.1 dev br0 metric 100 192.168.20.0/24 dev br0 proto kernel scope link src 192.168.20.100 192.168.122.0/24 dev virbr0 proto kernel scope link src 192.168.122.1 *In the guest * I was unable to copy paste the info from the guest because can't ssh to it. It didn't get any ip from DHCP. Won't work even after setting it up manually.

    Read the article

  • Trying to draw 2 objects on screen and store the selected item names in an array

    - by thefonso
    Ok...this is a homework question, here is what i'm asked to do.... "Allow the user to draw two Shapes, which when instantiated, get put into the array myShapes...(store the shapes in the createShape() method." I want to know if I'm going in the right direction. Do I need to modify only Model.java or GUIDemo.java as well? Am I sufficient in thinking of only storing the values for the array via a loop inside my createShape() method? How do I go a bout checking to see if things work so far. There are many steps for this homework project after this one but i'm stuck here. Please point me in the right direction. The array myShapes lives inside my model class inside Model.java: package model; import java.awt.Color; import java.awt.Container; import shapes.Line; import shapes.Oval; import shapes.Rectangle; import shapes.Shape; import shapes.Triangle; import interfaces.Resettable; public class Model implements Resettable { private Container container; private String message; public final static String DRAW = "Draw"; public final static String MOVE = "Move"; public final static String REMOVE = "Remove"; public final static String RESIZE = "Resize"; public final static String FILL = "Fill"; public final static String CHANGE = "Change"; public final static String RECTANGLE = "Rectangle"; public final static String OVAL = "Oval"; public final static String LINE = "Line"; public final static String TRIANGLE = "Triangle"; private String action = DRAW; private boolean fill = false; public static String[] selections = {"Rectangle", "Oval", "Line", "Triangle"}; //project 9 begin public Shape[] myShapes = new Shape[2]; //project 9 stop private String currentShapeType; private Shape currentShape; public Color lineColor; private Color fillColor = Color.gray; public Shape createShape() { if(currentShapeType == RECTANGLE){ currentShape = new Rectangle(0, 0, 0, 0, lineColor, fillColor, fill); } if(currentShapeType == OVAL) { currentShape = new Oval(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == LINE) { currentShape = new Line(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == TRIANGLE) { currentShape = new Triangle(0,0,0,0, lineColor, fillColor, fill); } //project 9 start if(myShapes[0] == null) { myShapes[0]=currentShape; } else { myShapes[1]=currentShape; } //project 9 stop return currentShape; } public Shape getCurrentShape() { return currentShape; } public String getCurrentShapeType(){ return currentShapeType; } public void setCurrentShapeType(String shapeType){ currentShapeType = shapeType; } public Model(Container container) { this.container = container; } public void repaint() { container.repaint(); } public void resetComponents() { action = DRAW; currentShape = null; if (container instanceof Resettable) { ((Resettable) container).resetComponents(); } } public String getAction() { return action; } public void setAction(String action) { this.action = action; } public boolean isFill() { return fill; } public void setFill(boolean fill) { this.fill = fill; } public void setMessage(String msg) { this.message = msg; } public String getMessage() { return this.message; } public Color getLineColor() { return this.lineColor; } public void setLineColor(Color c) { this.lineColor = c; } public String toString() { return "Model:\n\tAction: " + action + "\n\tFill: " + fill; } } The application is run from GUIDemo.java: package ui.applet; import interfaces.Resettable; import java.applet.Applet; import java.awt.Graphics; import event.ShapeMouseHandler; import shapes.Shape; //import ui.panels.ButtonPanel; import ui.panels.ChoicePanel; import ui.panels.MainPanel; import model.Model; @SuppressWarnings("serial") public class GUIDemo extends Applet implements Resettable { MainPanel mainPanel; Model model; ChoicePanel choicePanel; public void init() { resize(600,400); model = new Model(this); choicePanel = new ChoicePanel(model); mainPanel = new MainPanel(model); this.add(choicePanel);//this is the drop down list this.add(mainPanel);//these are the radio buttons and reset button ShapeMouseHandler mouseHandler = new ShapeMouseHandler(model); addMouseListener(mouseHandler); addMouseMotionListener(mouseHandler); } public void paint(Graphics g) { Shape shape; shape = model.getCurrentShape(); if(shape != null) { shape.draw(g); } System.out.println(model); System.out.println(shape); } public void resetComponents() { mainPanel.resetComponents(); choicePanel.resetComponents(); } }

    Read the article

  • Anyone succeeded at injecting Interfaces into Entity Framework 4 Entities, using T4?

    - by Ciel
    Hello: POCO sort of leaves me wanting: (how can I say I use DI/IoC, if the Repository is not the only place that is creating the entities?)...hence my desire to lock it down, get rid of the temptation of newing up POCOs or EntityObjects anywhere in the code, and just allowing entity interfaces above the Repository/Factory layer. For a second there, I nearly thought I had it...was editing EF4's T4 in order to inject in an Interface def. Was going swimmingly, compiled and worked, until I got to the Associations... I wrapped them with a ICollection, and renamed the underlying original collection with a prefix of Wrapped. Unfortunately, when run, throws an error: //The Member 'WrappedSubExamples' in the CLR type 'XAct.App.Data.Model.EF4.Example' is not present in the conceptual model type 'XAct.App.Data.Model.Entity.Example'. var examples = context2.CreateObjectSet(); My T4 segment I used was (this may not work, as it's the longest code snippet I've ever posted here...sorry): #region Generic Property Abstraction <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) {#> //XAct.App Generic Wrapper: <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> ICollection<I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=code.Escape(navProperty)#> { get { if (_X<#=code.Escape(navProperty)# == null){ _X<#=code.Escape(navProperty)# = new WrappedCollection,<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#(this.<#=(navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many)?"Wrapped":""#<#=code.Escape(navProperty)#); } return _X<#=code.Escape(navProperty)#; } } private ICollection _X<#=code.Escape(navProperty)#; <# } else { # <#=code.SpaceAfter(NewModifier(navProperty))#<#=Accessibility.ForProperty(navProperty)# I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)# <#=code.Escape(navProperty)# { get { return (I<#=code.Escape(navProperty)#)this.Wrapped<#=code.Escape(navProperty)#; } set { this.Wrapped<#=code.Escape(navProperty)# = value as <#=code.Escape(navProperty)#; } } <# } # #endregion which then wraps the original collection, renamed with the prefix 'Wrapped': /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel) #> [XmlIgnoreAttribute()] [SoapIgnoreAttribute()] [DataMemberAttribute()] [EdmRelationshipNavigationPropertyAttribute("<#=navProperty.RelationshipType.NamespaceName#>", "<#=navProperty.RelationshipType.Name#>", "<#=navProperty.ToEndMember.Name#>")] <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> EntityCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } else { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> <#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value; } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value = value; } } <# string refPropertyName = navProperty.Name + "Reference"; if (entity.Members.Any(m => m.Name == refPropertyName)) { // 6017 is the same error number that EntityClassGenerator uses. Errors.Add(new System.CodeDom.Compiler.CompilerError(SourceCsdlPath, -1, -1, "6017", String.Format(CultureInfo.CurrentCulture, GetResourceString("Template_ConflictingGeneratedNavPropName"), navProperty.Name, entity.FullName, refPropertyName))); } #> /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel)#> [BrowsableAttribute(false)] [DataMemberAttribute()] <#=Accessibility.ForProperty(navProperty)#> EntityReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=refPropertyName#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } The point is...it bugs out. I've tried various solutions...none worked. Any ideas -- or is this just a wild goose chase, and time to give it up?

    Read the article

  • migrating from Prototype to jQuery in Rails, having trouble with duplicate get request

    - by aressidi
    I'm in the process of migrating from Prototype to jQuery and moving all JS outside of the view files. All is going fairly well with one exception. Here's what I'm trying to do, and the problem I'm having. I have a diary where users can update records in-line in the page like so: user clicks 'edit' link to edit an entry in the diary a get request is performed via jQuery and an edit form is displayed allowing the user to modify the record user updates the record, the form disappears and the updated record is shown in place of the form All of that works so far. The problem arises when: user updates a record user clicks 'edit' to update another record in this case, the edit form is shown twice! In firebug I get a status code 200 when the form shows, and then moments later, another edit form shows again with a status code of 304 I only want the form to show once, not twice. The form shows twice only after I update a record, otherwise everything works fine. Here's the code, any ideas? I think this might have to do with the fact that in food_item_update.js I call the editDiaryEntry() after a record is updated, but if I don't call that function and try and update the record after it's been modified, then it just spits up the .js.erb response on the screen. That's also why I have the editDiaryEntry() in the add_food.js.erb file. Any help would be greatly appreciated. diary.js jQuery(document).ready(function() { postFoodEntry(); editDiaryEntry(); initDatePicker(); }); function postFoodEntry() { jQuery('form#add_entry').submit(function(e) { e.preventDefault(); jQuery.post(this.action, jQuery(this).serialize(), null, "script"); // return this }); } function editDiaryEntry() { jQuery('.edit_link').click(function(e) { e.preventDefault(); // This should look to see if one version of this is open... if (jQuery('#edit_container_' + this.id).length == 0 ) { jQuery.get('/diary/entry/edit', {id: this.id}, null, "script"); } }); } function closeEdit () { jQuery('.close_edit').click(function(e) { e.preventDefault(); jQuery('.entry_edit_container').remove(); jQuery("#entry_" + this.id).show(); }); } function updateDiaryEntry() { jQuery('.edit_entry_form').submit(function(e) { e.preventDefault(); jQuery.post(this.action, $(this).serialize(), null, "script"); }); } function initDatePicker() { jQuery("#date, #edit_date").datepicker(); }; add_food.js.erb jQuery("#entry_alert").show(); jQuery('#add_entry')[ 0 ].reset(); jQuery('#diary_entries').html("<%= escape_javascript(render :partial => 'members/diary/diary_entries', :object => @diary, :locals => {:record_counter => 0, :date_header => 0, :edit_mode => @diary_edit}, :layout => false ) %>"); jQuery('#entry_alert').html("<%= escape_javascript(render :partial => 'members/diary/entry_alert', :locals => {:type => @type, :message => @alert_message}) %>"); jQuery('#entry_alert').show(); setTimeout(function() { jQuery('#entry_alert').fadeOut('slow'); }, 5000); editDiaryEntry(); food_item_edit.js.erb jQuery("#entry_<%= @entry.id %>").hide(); jQuery("#entry_<%= @entry.id %>").after("<%= escape_javascript(render :partial => 'members/diary/food_item_edit', :locals => {:user_food_profile => @entry}) %>"); closeEdit(); updateDiaryEntry(); initDatePicker(); food_item_update.js jQuery("#entry_<%= @entry.id %>").replaceWith("<%= escape_javascript(render :partial => 'members/diary/food_item', :locals => {:entry => @entry, :total_calories => 0}) %>"); jQuery('.entry_edit_container').remove(); editDiaryEntry();

    Read the article

  • Connecting SceneBuilder edited FXML to Java code

    - by daniel
    Recently I had to answer several questions regarding how to connect an UI built with the JavaFX SceneBuilder 1.0 Developer Preview to Java Code. So I figured out that a short overview might be helpful. But first, let me state the obvious. What is FXML? To make it short, FXML is an XML based declaration format for JavaFX. JavaFX provides an FXML loader which will parse FXML files and from that construct a graph of Java object. It may sound complex when stated like that but it is actually quite simple. Here is an example of FXML file, which instantiate a StackPane and puts a Button inside it: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml"> <children> <Button mnemonicParsing="false" text="Button" /> </children> </StackPane> ... and here is the code I would have had to write if I had chosen to do the same thing programatically: import javafx.scene.control.*; import javafx.scene.layout.*; ... final Button button = new Button("Button"); button.setMnemonicParsing(false); final StackPane stackPane = new StackPane(); stackPane.setPrefWidth(200.0); stackPane.setPrefHeight(150.0); stacPane.getChildren().add(button); As you can see - FXML is rather simple to understand - as it is quite close to the JavaFX API. So OK FXML is simple, but why would I use it?Well, there are several answers to that - but my own favorite is: because you can make it with SceneBuilder. What is SceneBuilder? In short SceneBuilder is a layout tool that will let you graphically build JavaFX user interfaces by dragging and dropping JavaFX components from a library, and save it as an FXML file. SceneBuilder can also be used to load and modify JavaFX scenegraphs declared in FXML. Here is how I made the small FXML file above: Start the JavaFX SceneBuilder 1.0 Developer Preview In the Library on the left hand side, click on 'StackPane' and drag it on the content view (the white rectangle) In the Library, select a Button and drag it onto the StackPane on the content view. In the Hierarchy Panel on the left hand side - select the StackPane component, then invoke 'Edit > Trim To Selected' from the menubar That's it - you can now save, and you will obtain the small FXML file shown above. Of course this is only a trivial sample, made for the sake of the example - and SceneBuilder will let you create much more complex UIs. So, I have now an FXML file. But what do I do with it? How do I include it in my program? How do I write my main class? Loading an FXML file with JavaFX Well, that's the easy part - because the piece of code you need to write never changes. You can download and look at the SceneBuilder samples if you need to get convinced, but here is the short version: Create a Java class (let's call it 'Main.java') which extends javafx.application.Application In the same directory copy/save the FXML file you just created using SceneBuilder. Let's name it "simple.fxml" Now here is the Java code for the Main class, which simply loads the FXML file and puts it as root in a stage's scene. /* * Copyright (c) 2012, Oracle and/or its affiliates. All rights reserved. */ package simple; import java.util.logging.Level; import java.util.logging.Logger; import javafx.application.Application; import javafx.fxml.FXMLLoader; import javafx.scene.Scene; import javafx.scene.layout.StackPane; import javafx.stage.Stage; public class Main extends Application { /** * @param args the command line arguments */ public static void main(String[] args) { Application.launch(Main.class, (java.lang.String[])null); } @Override public void start(Stage primaryStage) { try { StackPane page = (StackPane) FXMLLoader.load(Main.class.getResource("simple.fxml")); Scene scene = new Scene(page); primaryStage.setScene(scene); primaryStage.setTitle("FXML is Simple"); primaryStage.show(); } catch (Exception ex) { Logger.getLogger(Main.class.getName()).log(Level.SEVERE, null, ex); } } } Great! Now I only have to use my favorite IDE to compile the class and run it. But... wait... what does it do? Well nothing. It just displays a button in the middle of a window. There's no logic attached to it. So how do we do that? How can I connect this button to my application logic? Here is how: Connection to code First let's define our application logic. Since this post is only intended to give a very brief overview - let's keep things simple. Let's say that the only thing I want to do is print a message on System.out when the user clicks on my button. To do that, I'll need to register an action handler with my button. And to do that, I'll need to somehow get a handle on my button. I'll need some kind of controller logic that will get my button and add my action handler to it. So how do I get a handle to my button and pass it to my controller? Once again - this is easy: I just need to write a controller class for my FXML. With each FXML file, it is possible to associate a controller class defined for that FXML. That controller class will make the link between the UI (the objects defined in the FXML) and the application logic. To each object defined in FXML we can associate an fx:id. The value of the id must be unique within the scope of the FXML, and is the name of an instance variable inside the controller class, in which the object will be injected. Since I want to have access to my button, I will need to add an fx:id to my button in FXML, and declare an @FXML variable in my controller class with the same name. In other words - I will need to add fx:id="myButton" to my button in FXML: -- <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> and declare @FXML private Button myButton in my controller class @FXML private Button myButton; // value will be injected by the FXMLLoader Let's see how to do this. Add an fx:id to the Button object Load "simple.fxml" in SceneBuilder - if not already done In the hierarchy panel (bottom left), or directly on the content view, select the Button object. Open the Properties sections of the inspector (right panel) for the button object At the top of the section, you will see a text field labelled fx:id. Enter myButton in that field and validate. Associate a controller class with the FXML file Still in SceneBuilder, select the top root object (in our case, that's the StackPane), and open the Code section of the inspector (right hand side) At the top of the section you should see a text field labelled Controller Class. In the field, type simple.SimpleController. This is the name of the class we're going to create manually. If you save at this point, the FXML will look like this: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml" fx:controller="simple.SimpleController"> <children> <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> </children> </StackPane> As you can see, the name of the controller class has been added to the root object: fx:controller="simple.SimpleController" Coding the controller class In your favorite IDE, create an empty SimpleController.java class. Now what does a controller class looks like? What should we put inside? Well - SceneBuilder will help you there: it will show you an example of controller skeleton tailored for your FXML. In the menu bar, invoke View > Show Sample Controller Skeleton. A popup appears, displaying a suggestion for the controller skeleton: copy the code displayed there, and paste it into your SimpleController.java: /** * Sample Skeleton for "simple.fxml" Controller Class * Use copy/paste to copy paste this code into your favorite IDE **/ package simple; import java.net.URL; import java.util.ResourceBundle; import javafx.fxml.FXML; import javafx.fxml.Initializable; import javafx.scene.control.Button; public class SimpleController implements Initializable { @FXML // fx:id="myButton" private Button myButton; // Value injected by FXMLLoader @Override // This method is called by the FXMLLoader when initialization is complete public void initialize(URL fxmlFileLocation, ResourceBundle resources) { assert myButton != null : "fx:id=\"myButton\" was not injected: check your FXML file 'simple.fxml'."; // initialize your logic here: all @FXML variables will have been injected } } Note that the code displayed by SceneBuilder is there only for educational purpose: SceneBuilder does not create and does not modify Java files. This is simply a hint of what you can use, given the fx:id present in your FXML file. You are free to copy all or part of the displayed code and paste it into your own Java class. Now at this point, there only remains to add our logic to the controller class. Quite easy: in the initialize method, I will register an action handler with my button: () { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... -- ... // initialize your logic here: all @FXML variables will have been injected myButton.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... That's it - if you now compile everything in your IDE, and run your application, clicking on the button should print a message on the console! Summary What happens is that in Main.java, the FXMLLoader will load simple.fxml from the jar/classpath, as specified by 'FXMLLoader.load(Main.class.getResource("simple.fxml"))'. When loading simple.fxml, the loader will find the name of the controller class, as specified by 'fx:controller="simple.SimpleController"' in the FXML. Upon finding the name of the controller class, the loader will create an instance of that class, in which it will try to inject all the objects that have an fx:id in the FXML. Thus, after having created '<Button fx:id="myButton" ... />', the FXMLLoader will inject the button instance into the '@FXML private Button myButton;' instance variable found on the controller instance. This is because The instance variable has an @FXML annotation, The name of the variable exactly matches the value of the fx:id Finally, when the whole FXML has been loaded, the FXMLLoader will call the controller's initialize method, and our code that registers an action handler with the button will be executed. For a complete example, take a look at the HelloWorld SceneBuilder sample. Also make sure to follow the SceneBuilder Get Started guide, which will guide you through a much more complete example. Of course, there are more elegant ways to set up an Event Handler using FXML and SceneBuilder. There are also many different ways to work with the FXMLLoader. But since it's starting to be very late here, I think it will have to wait for another post. I hope you have enjoyed the tour! --daniel

    Read the article

  • Software monetization that is not evil

    - by t0x1n
    I have a free open-source project with around 800K downloads to date. I've been contacted by some monetization companies from time to time and turned them down, since I didn't want toolbar malware associated with my software. I was wondering however, is there a non-evil way to monetize software ? Here are the options as I know them: Add a donation button. I don't feel comfortable with that as I really don't need "donations" - I'm paid quite well. Donating users may feel entitled to support etc. (see the second to last bullet) Add ads inside your application. In the web that may be acceptable, but in a desktop program it looks incredibly lame. Charge a small amount for each download. This model works well in the mobile world, but I suspect no one will go for it on the desktop. It doesn't mix well with open source, though I suppose I could charge only for the binaries (most users won't go to the hassle of compiling the sources). People may expect support etc. after having explicitly paid (see next bullet). Make money off a service / community / support associated with the program. This is one route I definitely don't want to take, I don't want any sort of hassle beyond coding. I assure you, the program is top notch (albeit simple) and I'm not aware of any bugs as of yet (there are support forums and blog comments where users may report them). It is also very simple, documented, and discoverable so I do think I have a case for supplying it "as is". Add affiliate suggestions to your installer. If you use a monetization company, you lose control over what they propose. Unless you can establish some sort of strong trust with the company to supply quality suggestions (I sincerely doubt it), I can't have that. Choosing your own affiliate (e.g. directly suggesting Google Toolbar) is possibly the only viable solution to my mind. Problem is, where do I find a solid affiliate that could actually give value to the user rather than infect his computer with crapware? I thought maybe Babylon (not the toolbar of course, I hate toolbars)?

    Read the article

  • Geek Bike Ride JavaOne 2012

    - by Tori Wieldt
    "Geek Bike Ride?" the clerk at the bike rental shop asked. "Are you guys all from the same company?" "We aren't even from the same country!" we answered. "I'm from Russia." "We're from Germany."  "I'm from Belgium." "I'm from Palo Alto." "I'm from Japan."  "We're from Brazil." "We're from Brazil." "I'm from Sweden." "Coooool" was all she could say. She was right. The Geek Bike Ride was cooool. We had 39 bike riders and one skater show up Saturday for a great route from San Francisco's Fisherman's Wharf, across the Golden Gate bridge, to Saulsalito, and back to the city by ferry. Duke Bike jerseys, sponsored by OTN, were given out. To make sure Java developers got them, each person had to answer a Java question to get a jersey. The questions were really hard, like "Who is the Father of Java?" "What's the biggest Java conference in San Francisco?" The best was when the question was "Name one of Duke's Choice Award winner from this year," and Régina ten Bruggencate answered answered "Me!"  It was foggy throughout the day, with the sun poking out occasionally. The fog was thickest on the bridge, more that one rider commented that we were "in the cloud." It was a great day to meet new friends, and have a chat with old friends. We all had fun, though some of us may more a little more slowly during JavaOne. Ride on!  Photos by permission by Arun Gupta and Yoshio Terada. Thanks, guys!

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • SetWindowHookEx and execution blocking

    - by Kalaz
    Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

    Read the article

  • Guiding Management to the Correct Decision

    - by Blumer
    My supervisor (also a developer) and I have a running joke about writing a book called "Managing From Beneath: Subversively Guiding Management to the Right Decision" and including a number of "techniques" we've developed for helping those who make the decisions to make the right ones. So far, we've got (cynicism warning!): BIC It! BIC stands for "Bury In Committee." When a bad idea comes up that someone wants to champion, we try to get it deferred to a committee for input. Typically it will either get killed outright (especially if other members of the committee are competing for you as a resource), or it will be hung up long enough that the proponent forgets about it. Smart, Stupid, or Expensive? When someone gets a visionary idea, offer them three ways to do it: a smart way, a stupid way, and an expensive way. The hope is that you've at least got a 2/3 shot of not having to do it the way that makes a piece of your soul die. All-Pro. It's a preemptive pro/con list in which you get into the mind of the (pr)opponent and think what would be cons against doing it your way. Twist them into pros and present them in your pro list before they have a chance to present them as cons. Dependicitis. Link pending decisions together, ideally with the proponent's pet project as the final link in the chain. Use this leverage to force action on those that have been put off. Preemptive Acceptance. Sometimes it's clear that management is going to go a particular direction regardless of advice to the contrary, and it's time to make the best of it. Take the opportunity to get something else you need, though. Approach the sponsor out of the blue and take the first step: "You know, I've been thinking about it, and while it's not the route I would advise, as long as we can get the schedule and budget for Project Awesome loosened up, I can work some magic to make your project fly." So ... what techniques have you come up with to try to head off the problem projects or make the best of what may come?

    Read the article

  • Fluent NHibernate/SQL Server 2008 insert query problem

    - by Mark
    Hi all, I'm new to Fluent NHibernate and I'm running into a problem. I have a mapping defined as follows: public PersonMapping() { Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.FirstName).Not.Nullable().Length(50); Map(p => p.MiddleInitial).Nullable().Length(1); Map(p => p.LastName).Not.Nullable().Length(50); Map(p => p.Suffix).Nullable().Length(3); Map(p => p.SSN).Nullable().Length(11); Map(p => p.BirthDate).Nullable(); Map(p => p.CellPhone).Nullable().Length(12); Map(p => p.HomePhone).Nullable().Length(12); Map(p => p.WorkPhone).Nullable().Length(12); Map(p => p.OtherPhone).Nullable().Length(12); Map(p => p.EmailAddress).Nullable().Length(50); Map(p => p.DriversLicenseNumber).Nullable().Length(50); Component<Address>(p => p.CurrentAddress, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); Map(p => p.EyeColor).Nullable().Length(3); Map(p => p.HairColor).Nullable().Length(3); Map(p => p.Gender).Nullable().Length(1); Map(p => p.Height).Nullable(); Map(p => p.Weight).Nullable(); Map(p => p.Race).Nullable().Length(1); Map(p => p.SkinTone).Nullable().Length(3); HasMany(p => p.PriorAddresses).Cascade.All(); } public PreviousAddressMapping() { Table("PriorAddress"); Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.EndEffectiveDate).Not.Nullable(); Component<Address>(p => p.Address, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); } My test is [Test] public void can_correctly_map_Person_with_Addresses() { var myPerson = new Person("Jane", "", "Doe"); var priorAddresses = new[] { new PreviousAddress(ObjectMother.GetAddress1(), DateTime.Parse("05/13/2010")), new PreviousAddress(ObjectMother.GetAddress2(), DateTime.Parse("05/20/2010")) }; new PersistenceSpecification<Person>(Session) .CheckProperty(c => c.FirstName, myPerson.FirstName) .CheckProperty(c => c.LastName, myPerson.LastName) .CheckProperty(c => c.MiddleInitial, myPerson.MiddleInitial) .CheckList(c => c.PriorAddresses, priorAddresses) .VerifyTheMappings(); } GetAddress1() (yeah, horrible name) has Line2 == null The tables seem to be created correctly in sql server 2008, but the test fails with a SQLException "String or binary data would be truncated." When I grab the sql statement in SQL Profiler, I get exec sp_executesql N'INSERT INTO PriorAddress (Line1, Line2, City, State, Zip, EndEffectiveDate, Id) VALUES (@p0, @p1, @p2, @p3, @p4, @p5, @p6)',N'@p0 nvarchar(18),@p1 nvarchar(4000),@p2 nvarchar(10),@p3 nvarchar(2),@p4 nvarchar(5),@p5 datetime,@p6 int',@p0=N'6789 Somewhere Rd.',@p1=NULL,@p2=N'Hot Coffee',@p3=N'MS',@p4=N'09876',@p5='2010-05-13 00:00:00',@p6=1001 Notice the @p1 parameter is being set to nvarchar(4000) and being passed a NULL value. Why is it setting the parameter to nvarchar(4000)? How can I fix it? Thanks!

    Read the article

  • WiFi connected to router, but no internet connection

    - by Quetzacotl
    I just got a new notebook, a ThinkPad Edge E530, and installed Ubuntu on it. I'm pretty new to Ubuntu. On the same laptop, running Windows 7, the Wi-Fi connection works fine. Ethernet connection works both on Win7 and on Ubuntu. Only Wi-Fi on Ubuntu does not work; it connects to the Wi-Fi access point but I don't have Internet access. My wireless card is Intel Centrino Wireless-N 2230. What can fix the problem? EDIT: ifconfig -a eth0 Link encap:Ethernet HWaddr b8:88:e3:30:72:34 UP BROADCAST MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) Interrupt:43 Base address:0x8000 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:163 errors:0 dropped:0 overruns:0 frame:0 TX packets:163 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:10124 (10.1 KB) TX bytes:10124 (10.1 KB) usb0 Link encap:Ethernet HWaddr 02:15:e0:ec:01:00 UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:0 errors:0 dropped:0 overruns:0 frame:0 TX packets:0 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:0 (0.0 B) TX bytes:0 (0.0 B) wlan0 Link encap:Ethernet HWaddr 68:5d:43:43:71:e1 inet addr:192.168.2.101 Bcast:192.168.2.255 Mask:255.255.255.0 inet6 addr: fe80::6a5d:43ff:fe43:71e1/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:40 errors:0 dropped:0 overruns:0 frame:0 TX packets:220 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:2801 (2.8 KB) TX bytes:26230 (26.2 KB) route -n Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface 0.0.0.0 192.168.2.1 0.0.0.0 UG 0 0 0 wlan0 169.254.0.0 0.0.0.0 255.255.0.0 U 1000 0 0 wlan0 192.168.2.0 0.0.0.0 255.255.255.0 U 2 0 0 wlan0 cat /etc/resolv.conf # Dynamic resolv.conf(5) file for glibc resolver(3) generated by resolvconf(8) # DO NOT EDIT THIS FILE BY HAND -- YOUR CHANGES WILL BE OVERWRITTEN nameserver 127.0.0.1 iwconfig lo no wireless extensions. usb0 no wireless extensions. wlan0 IEEE 802.11bgn ESSID:"SATELITE" Mode:Managed Frequency:2.462 GHz Access Point: 00:1F:1F:8D:CC:08 Bit Rate=1 Mb/s Tx-Power=16 dBm Retry long limit:7 RTS thr:off Fragment thr:off Power Management:off Link Quality=60/70 Signal level=-50 dBm Rx invalid nwid:0 Rx invalid crypt:0 Rx invalid frag:0 Tx excessive retries:93 Invalid misc:243 Missed beacon:0 eth0 no wireless extensions.

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Windows 8 and the future of Silverlight

    - by Laila
    After Steve Ballmer's indiscrete 'MisSpeak' about Windows 8, there has been a lot of speculation about the new operating system. We've now had a few glimpses, such as the demonstration of 'Mosh' at the D9 2011 conference, and the Youtube video, which showed a touch-centric new interface for apps built using HTML5 and JavaScript. This has caused acute anxiety to the programmers who have followed the recommended route of WPF, Silverlight and .NET, but it need not have caused quite so much panic since it was, in fact, just a thin layer to make Windows into an apparently mobile-friendly OS. More worryingly, the press-release from Microsoft was at pains to say that 'Windows 8 apps use the power of HTML5, tapping into the native capabilities of Windows using standard JavaScript and HTML', as if all thought of Silverlight, dominant in WP7, had been jettisoned. Ironically, this brave new 'happening' platform can all be done now in Windows 7 and an iPad, using Adobe Air, so it is hardly cutting-edge; in fact the tile interface had a sort of Retro-Zune Metro UI feel first seen in Media Centre, followed by Windows Phone 7, with any originality leached out of it by the corporate decision-making process. It was kinda weird seeing old Excel running alongside stodgily away amongst all the extreme paragliding videos. The ability to snap and resize concurrent apps might be a novelty on a tablet, but it is hardly so on a PC. It was at that moment that it struck me that here was a spreadsheet application that hadn't even made the leap to the .NET platform. Windows was once again trying to be all things to all men, whereas Apple had carefully separated Mac OS X development from iOS. The acrobatic feat of straddling all mobile and desktop devices with one OS is looking increasingly implausible. There is a world of difference between an operating system that facilitates business procedures and a one that drives a device for playing pop videos and your holiday photos. So where does this leave Silverlight? Pretty much where it was. Windows 8 will support it, and it will continue to be developed, but if these press-releases reflect the thinking within Microsoft, it is no longer seen as the strategic direction. However, Silverlight is still there and there will be a whole new set of developer APIs for building touch-centric apps. Jupiter, for example, is rumoured to involve an App store that provides new, Silverlight based "immersive" applications that are deployed as AppX packages. When the smoke clears, one suspects that the Javascript/HTML5 is merely an alternative development environment for Windows 8 to attract the legions of independent developers outside the .NET culture who are unlikely to ever take a shine to a more serious development environment such as WPF or Silverlight. Cheers, Laila

    Read the article

  • Why would you dual-run an app on Azure and AWS?

    - by Elton Stoneman
    Originally posted on: http://geekswithblogs.net/EltonStoneman/archive/2013/11/10/why-would-you-dual-run-an-app-on-azure-and-aws.aspxI had this question from a viewer of my Pluralsight course, Implementing the Reactive Manifesto with Azure and AWS, and thought I’d publish the response. So why would you dual-run your cloud app by hosting it on Azure and AWS? Sounds like a lot of extra development and management overhead. Well the most compelling reasons are reliability and portability. In 2012 I was working for a client who was making a big investment in the cloud, and at the end of the year we published their first external API for business partners. It was hosted in Azure and used some really nice features to route back into existing on-premise services. We were able to publish a clean, simple API to partners, and hide away the underlying complexity of the internal services while still leveraging them to do all the work. Two days after we went live, we were hit by the Azure SSL certificate expiry outage, and our API was unavailable for the best part of 3 days. Fortunately we had planned a gradual roll-out to partners, so the impact was minimal, but we’d been intending to ramp up quickly, and if the outage had happened a week or two later we would have been in a very bad place. Not least because our app could only run on Azure, we couldn’t package it up for another service without going back and reworking the code. More recently AWS had an issue with a networking device in one of their data centres which caused an outage that took the best part of a day to resolve. In both scenarios the SLAs are worthless, as you’ll get back a small percentage of your cloud expenditure, which is going to be negligible compared to your costs in dealing with the outage. And if your app is built specifically for AWS or Azure then if there’s an extended outage you can’t just deploy it onto a new set of kit from a different supplier. And the chances are pretty good there will be another extended outage, both for Microsoft and for Amazon. But the chances are small that it will happen to both at the same time. So my basic guidance has been: ignore the SLAs, go for better uptime by using two clouds. As soon as you need to scale beyond a single instance, start by scaling out to another cloud. Then scale out to different data centres in both clouds. Then you’ve got dual-cloud, quadruple-datacentre redundancy, so any more scaling you need can be left to the clouds to auto-scale themselves. By running in both clouds, you’ve made your app portable, so in the highly unlikely event that both AWS and Azure go down in multiple regions, you’ll have a deployment package which will let you spin up a new stack on yet another cloud, without having to rework your solution.

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

< Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >