Search Results

Search found 11166 results on 447 pages for 'justin standard'.

Page 438/447 | < Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >

  • How do I make a simple image-based button with visual states in Silverlight 3?

    - by Jacob
    At my previous company, we created our RIAs using Flex with graphical assets created in Flash. In Flash, you could simply lay out your graphics for different states, i.e. rollover, disabled. Now, I'm working on a Silverlight 3 project. I've been given a bunch of images that need to serve as the graphics for buttons that have a rollover, pressed, and normal state. I cannot figure out how to simply create buttons with different images for different visual states in Visual Studio 2008 or Expression Blend 3. Here's where I am currently. My button is defined like this in the XAML: <Button Style="{StaticResource MyButton}"/> The MyButton style appears as follows: <Style x:Key="MyButton" TargetType="Button"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="Button"> <Image Source="/Assets/Graphics/mybtn_up.png" Width="54" Height="24"> <VisualStateManager.VisualStateGroups> <VisualStateGroup x:Name="FocusStates"> <VisualState x:Name="Focused"/> <VisualState x:Name="Unfocused"/> </VisualStateGroup> <VisualStateGroup x:Name="CommonStates"> <VisualState x:Name="Normal"/> <VisualState x:Name="MouseOver"/> <VisualState x:Name="Pressed"/> <VisualState x:Name="Disabled"/> </VisualStateGroup> </VisualStateManager.VisualStateGroups> </Image> </ControlTemplate> </Setter.Value> </Setter> </Style> I cannot figure out how to assign a different template to different states, nor how to change the image's source based on which state I'm in. How do I do this? Also, if you know of any good documentation that describes how styles work in Silverlight, that would be great. All of the search results I can come up with are frustratingly unhelpful. Edit: I found a way to change the image via storyboards like this: <Style x:Key="MyButton" TargetType="Button"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="Button"> <Image Source="/Assets/Graphics/mybtn_up.png" Width="54" Height="24" x:Name="Image"> <VisualStateManager.VisualStateGroups> <VisualStateGroup x:Name="FocusStates"> <VisualState x:Name="Focused"/> <VisualState x:Name="Unfocused"/> </VisualStateGroup> <VisualStateGroup x:Name="CommonStates"> <VisualState x:Name="Normal"/> <VisualState x:Name="MouseOver"> <Storyboard Storyboard.TargetName="Image" Storyboard.TargetProperty="Source"> <ObjectAnimationUsingKeyFrames> <DiscreteObjectKeyFrame KeyTime="0" Value="/Assets/Graphics/mybtn_over.png"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> <VisualState x:Name="Pressed"> <Storyboard Storyboard.TargetName="Image" Storyboard.TargetProperty="Source"> <ObjectAnimationUsingKeyFrames> <DiscreteObjectKeyFrame KeyTime="0" Value="/Assets/Graphics/mybtn_active.png"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> <VisualState x:Name="Disabled"/> </VisualStateGroup> </VisualStateManager.VisualStateGroups> </Image> </ControlTemplate> </Setter.Value> </Setter> </Style> However, this seems like a strange way of doing things to me. Is there a more standard way of accomplishing this?

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Scrollbar still is painted after it should be removed

    - by Walter Williams
    I have the following custom control and can place on a form (with AutoScroll set to true and the control anchored left, top and right). If the form is too short for the control, the form correctly resizes the control (to make room for the scroll) and displays the scroll bar. When the control is closed using the close glyph, the control is resized and the scroll bar is removed, but occasionally the scroll bar appears to remain painted. If the form is minimized or moved off-screen, the leftover paint is removed. I've tried Parent.Invalidate and have toyed with it in many ways but to no avail. Any suggestions? (Using VS 2008 Standard) using System; using System.ComponentModel; using System.Drawing; using System.Drawing.Drawing2D; using System.Windows.Forms; namespace GroupPanelTest { public class GroupPanel : GroupBox { #region Members private const Int32 iHeaderHeight = 20; private Int32 iFullHeight = 200; private Boolean bClosed = false; private Rectangle rectCloseGlyphBounds = Rectangle.Empty; private Boolean bIsMoveOverCloseGlyph = false; #endregion #region Properties [DefaultValue(false)] public Boolean Closed { get { return (this.bClosed); } set { if (this.bClosed != value) { this.bClosed = value; if (this.bClosed) { this.iFullHeight = base.Height; base.Height = GroupPanel.iHeaderHeight; } else { base.Height = this.iFullHeight; } foreach (Control con in base.Controls) con.Visible = !this.bClosed; this.Invalidate(); } } } public new Int32 Height { get { return (base.Height); } set { if (value != base.Height) { if (this.Closed) { this.iFullHeight = value; } else { Int32 iOldHeight = base.Height; base.Height = value; } } } } [DefaultValue(typeof(Size), "350,200")] public new Size Size { get { return (base.Size); } set { if (base.Size != value) { base.Size = value; if (!this.Closed) this.iFullHeight = value.Height; } } } [DefaultValue(typeof(Padding), "0,7,0,0")] public new Padding Padding { get { return (base.Padding); } set { base.Padding = value; } } #endregion #region Construction public GroupPanel () { SetStyle(ControlStyles.UserPaint, true); SetStyle(ControlStyles.ResizeRedraw, true); SetStyle(ControlStyles.AllPaintingInWmPaint, true); SetStyle(ControlStyles.OptimizedDoubleBuffer, true); SetStyle(ControlStyles.Selectable, true); this.Size = new Size(350, 200); this.Padding = new Padding(0, 7, 0, 0); // the groupbox will add to that this.rectCloseGlyphBounds = new Rectangle(base.ClientSize.Width - 24, 2, 16, 16); } #endregion #region Overrides protected override void OnSizeChanged (EventArgs e) { this.rectCloseGlyphBounds = new Rectangle(base.ClientSize.Width - 24, 2, 16, 16); base.OnSizeChanged(e); } protected override void OnPaint (PaintEventArgs e) { base.OnPaint(e); // we want all the delegates to receive the events, but we do this first so we can paint over it Graphics g = e.Graphics; g.FillRectangle(SystemBrushes.Window, this.ClientRectangle); Rectangle rectTitle = new Rectangle(0, 0, this.ClientRectangle.Width, GroupPanel.iHeaderHeight); g.FillRectangle(SystemBrushes.Control, rectTitle); g.DrawString(this.Text, this.Font, SystemBrushes.ControlText, new PointF(5.0f, 3.0f)); if (this.bIsMoveOverCloseGlyph) { g.FillRectangle(SystemBrushes.ButtonHighlight, this.rectCloseGlyphBounds); Rectangle rectBorder = this.rectCloseGlyphBounds; rectBorder.Inflate(-1, -1); g.DrawRectangle(SystemPens.Highlight, rectBorder); } using (Pen pen = new Pen(SystemColors.ControlText, 1.6f)) { if (this.Closed) { g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 3, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 8); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 3, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 8); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 7, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 12); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 7, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 12); } else { g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 8, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 3); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 8, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 3); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 3, this.rectCloseGlyphBounds.Top + 12, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 7); g.DrawLine(pen, this.rectCloseGlyphBounds.Left + 13, this.rectCloseGlyphBounds.Top + 12, this.rectCloseGlyphBounds.Left + 8, this.rectCloseGlyphBounds.Top + 7); } } } protected override void OnMouseDown (MouseEventArgs e) { if (e.Button == MouseButtons.Left && this.rectCloseGlyphBounds.Contains(e.Location)) this.Closed = !this.Closed; // close will call invalidate base.OnMouseDown(e); } protected override void OnMouseMove (MouseEventArgs e) { this.bIsMoveOverCloseGlyph = this.rectCloseGlyphBounds.Contains(e.Location); this.Invalidate(this.rectCloseGlyphBounds); base.OnMouseMove(e); } #endregion } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Saving to SharedPreferences from custom DialogPreference

    - by Ronnie
    I've currently got a preferences screen, and I've created a custom class that extends DialogPreference and is called from within my Preferences. My preferences data seems store/retrieve from SharedPreferences without an issue, but I'm trying to add 2 more sets of settings from the DialogPreference. Basically I have two issues that I have not been able to find. Every site I've seen gives me the same standard info to save/restore data and I'm still having problems. Firstly I'm trying to save a username and password to my SharedPreferences (visible in the last block of code) and if possibly I'd like to be able to do it in the onClick(). My preferences XML that calls my DialogPreference: <?xml version="1.0" encoding="utf-8"?> <PreferenceScreen xmlns:android="http://schemas.android.com/apk/res/android"> <PreferenceCategory> <com.rone.optusmon.AccDialog android:key="AccSettings" android:title="Account Settings" android:negativeButtonText="Cancel" android:positiveButtonText="Save" /> </PreferenceCategory> </PreferenceScreen> My Preference Activity Class: package com.rone.optusmon; import android.app.AlertDialog; import android.content.Context; import android.content.DialogInterface; import android.os.Bundle; import android.preference.Preference; import android.preference.Preference.OnPreferenceClickListener; import android.preference.PreferenceActivity; import android.view.KeyEvent; public class EditPreferences extends PreferenceActivity { Context context = this; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); addPreferencesFromResource(R.xml.preferences); } } My Custom DialogPreference Class file: package com.rone.optusmon; import android.content.Context; import android.content.DialogInterface; import android.content.SharedPreferences; import android.preference.DialogPreference; import android.preference.PreferenceManager; import android.text.method.PasswordTransformationMethod; import android.util.AttributeSet; import android.view.View; import android.widget.CheckBox; import android.widget.CompoundButton; import android.widget.CompoundButton.OnCheckedChangeListener; import android.widget.EditText; import android.widget.LinearLayout; import android.widget.TextView; import android.widget.Toast; public class AccDialog extends DialogPreference implements DialogInterface.OnClickListener { private TextView mUsername, mPassword; private EditText mUserbox, mPassbox; CharSequence mPassboxdata, mUserboxdata; private CheckBox mShowchar; private Context mContext; private int mWhichButtonClicked; public AccDialog(Context context, AttributeSet attrs) { super(context, attrs); mContext = context; } @Override protected View onCreateDialogView() { @SuppressWarnings("unused") LinearLayout.LayoutParams params; LinearLayout layout = new LinearLayout(mContext); layout.setOrientation(LinearLayout.VERTICAL); layout.setPadding(10, 10, 10, 10); layout.setBackgroundColor(0xFF000000); mUsername = new TextView(mContext); mUsername.setText("Username:"); mUsername.setTextColor(0xFFFFFFFF); mUsername.setPadding(0, 8, 0, 3); mUserbox = new EditText(mContext); mUserbox.setSingleLine(true); mUserbox.setSelectAllOnFocus(true); mPassword = new TextView(mContext); mPassword.setText("Password:"); mPassword.setTextColor(0xFFFFFFFF); mPassbox = new EditText(mContext); mPassbox.setSingleLine(true); mPassbox.setSelectAllOnFocus(true); mShowchar = new CheckBox(mContext); mShowchar.setOnCheckedChangeListener(mShowchar_listener); mShowchar.setText("Show Characters"); mShowchar.setTextColor(0xFFFFFFFF); mShowchar.setChecked(false); if(!mShowchar.isChecked()) { mPassbox.setTransformationMethod(new PasswordTransformationMethod()); } layout.addView(mUsername); layout.addView(mUserbox); layout.addView(mPassword); layout.addView(mPassbox); layout.addView(mShowchar); return layout; // Access default SharedPreferences SharedPreferences settings = PreferenceManager.getDefaultSharedPreferences(this); } public void onClick(DialogInterface dialog, int which) { mWhichButtonClicked = which; // if statement to set save/cancel button roles if (mWhichButtonClicked == -1) { Toast.makeText(mContext, "Save was clicked", Toast.LENGTH_SHORT).show(); mUserboxdata = mUserbox.getText(); mPassboxdata = mPassbox.getText(); // Save user preferences SharedPreferences settings = getDefaultSharedPreferences(this); SharedPreferences.Editor editor = settings.edit(); editor.putString("usernamekey", (String) mUserboxdata); editor.putString("passwordkey", (String) mPassboxdata); } else { Toast.makeText(mContext, "Cancel was clicked", Toast.LENGTH_SHORT).show(); } } } In my SharedPreferences settings = PreferenceManager.getDefaultSharedPreferences(this); line, Eclipse says "The method getDefaultSharedPreferences(AccDialog) is undefined for the type AccDialog". I've attempted to change the context to my preferences class, use a blank context and I've also tried naming my SharedPrefs and using "getSharedPreferences()" as well. I'm just not sure exactly what I'm doing here. As I'm quite new to Java/Android/coding in general, could you please be as detailed as possible with any help, eg. which of my files I need to write the code in and whereabouts in that file should I write it (i.e. onCreate(), onClick(), etc) Edit: I will need to the preferences to be Application-wide accessible, not activity-wide. Thanks

    Read the article

  • Is there a better way to avoid an infinite loop using winforms?

    - by Hamish Grubijan
    I am using .Net 3.5 for now. Right now I am using a using trick to disable and enable events around certain sections of code. The user can change either days, hours, minutes or total minutes, and that should not cause an infinite cascade of events (e.g. minutes changing total, total changing minutes, etc.) While the code does what I want, there might be a better / more straight-forward way. Do you know of any? For brawny points: This control will be used by multiple teams - I do not want to make it embarrassing. I suspect that I do not need to reinvent the wheel when defining hours in a day, days in week, etc. Some other standard .Net library out there must have it. Any other remarks regarding code? This using (EventHacker.DisableEvents(this)) business - that must be a common pattern in .Net ... changing the setting temporarily. What is the name of it? I'd like to be able to refer to it in a comment and also read up more on current implementations. In the general case not only a handle to the thing being changed needs to be remembered, but also the previous state (in this case previous state does not matter - events are turned on and off unconditionally). Then there is also a possibility of multi-threaded hacking. One could also utilize generics to make the code arguably cleaner. Figuring all this out can lead to a multi-page blog post. I'd be happy to hear some of the answers. P.S. Does it seem like I suffer from obsessive compulsive disorder? Some people like to get things finished and move on; I like to keep them open ... there is always a better way. // Corresponding Designer class is omitted. using System; using System.Windows.Forms; namespace XYZ // Real name masked { interface IEventHackable { void EnableEvents(); void DisableEvents(); } public partial class PollingIntervalGroupBox : GroupBox, IEventHackable { private const int DAYS_IN_WEEK = 7; private const int MINUTES_IN_HOUR = 60; private const int HOURS_IN_DAY = 24; private const int MINUTES_IN_DAY = MINUTES_IN_HOUR * HOURS_IN_DAY; private const int MAX_TOTAL_DAYS = 100; private static readonly decimal MIN_TOTAL_NUM_MINUTES = 1; // Anything faster than once per minute can bog down our servers. private static readonly decimal MAX_TOTAL_NUM_MINUTES = (MAX_TOTAL_DAYS * MINUTES_IN_DAY) - 1; // 99 days should be plenty. // The value above was chosen so to not cause an overflow exception. // Watch out for it - numericUpDownControls each have a MaximumValue setting. public PollingIntervalGroupBox() { InitializeComponent(); InitializeComponentCustom(); } private void InitializeComponentCustom() { this.m_upDownDays.Maximum = MAX_TOTAL_DAYS - 1; this.m_upDownHours.Maximum = HOURS_IN_DAY - 1; this.m_upDownMinutes.Maximum = MINUTES_IN_HOUR - 1; this.m_upDownTotalMinutes.Maximum = MAX_TOTAL_NUM_MINUTES; this.m_upDownTotalMinutes.Minimum = MIN_TOTAL_NUM_MINUTES; } private void m_upDownTotalMinutes_ValueChanged(object sender, EventArgs e) { setTotalMinutes(this.m_upDownTotalMinutes.Value); } private void m_upDownDays_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownHours_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownMinutes_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void updateTotalMinutes() { this.setTotalMinutes( MINUTES_IN_DAY * m_upDownDays.Value + MINUTES_IN_HOUR * m_upDownHours.Value + m_upDownMinutes.Value); } public decimal TotalMinutes { get { return m_upDownTotalMinutes.Value; } set { m_upDownTotalMinutes.Value = value; } } public decimal TotalHours { set { setTotalMinutes(value * MINUTES_IN_HOUR); } } public decimal TotalDays { set { setTotalMinutes(value * MINUTES_IN_DAY); } } public decimal TotalWeeks { set { setTotalMinutes(value * DAYS_IN_WEEK * MINUTES_IN_DAY); } } private void setTotalMinutes(decimal nTotalMinutes) { if (nTotalMinutes < MIN_TOTAL_NUM_MINUTES) { setTotalMinutes(MIN_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } if (nTotalMinutes > MAX_TOTAL_NUM_MINUTES) { setTotalMinutes(MAX_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } using (EventHacker.DisableEvents(this)) { // First set the total minutes this.m_upDownTotalMinutes.Value = nTotalMinutes; // Then set the rest this.m_upDownDays.Value = (int)(nTotalMinutes / MINUTES_IN_DAY); nTotalMinutes = nTotalMinutes % MINUTES_IN_DAY; // variable reuse. this.m_upDownHours.Value = (int)(nTotalMinutes / MINUTES_IN_HOUR); nTotalMinutes = nTotalMinutes % MINUTES_IN_HOUR; this.m_upDownMinutes.Value = nTotalMinutes; } } // Event magic public void EnableEvents() { this.m_upDownTotalMinutes.ValueChanged += this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged += this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged += this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged += this.m_upDownMinutes_ValueChanged; } public void DisableEvents() { this.m_upDownTotalMinutes.ValueChanged -= this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged -= this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged -= this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged -= this.m_upDownMinutes_ValueChanged; } // We give as little info as possible to the 'hacker'. private sealed class EventHacker : IDisposable { IEventHackable _hackableHandle; public static IDisposable DisableEvents(IEventHackable hackableHandle) { return new EventHacker(hackableHandle); } public EventHacker(IEventHackable hackableHandle) { this._hackableHandle = hackableHandle; this._hackableHandle.DisableEvents(); } public void Dispose() { this._hackableHandle.EnableEvents(); } } } }

    Read the article

  • EXC_BAD_ACCESS at UITableView on IOS

    - by Suprie
    Hi all, When scrolling through table, my application crash and console said it was EXC_BAD_ACCESS. I've look everywhere, and people suggest me to use NSZombieEnabled on my executables environment variables. I've set NSZombieEnabled, NSDebugEnabled, MallocStackLogging and MallocStackLoggingNoCompact to YES on my executables. But apparently i still can't figure out which part of my program that cause EXC_BAD_ACCESS. This is what my console said [Session started at 2010-12-21 21:11:21 +0700.] GNU gdb 6.3.50-20050815 (Apple version gdb-1510) (Wed Sep 22 02:45:02 UTC 2010) Copyright 2004 Free Software Foundation, Inc. GDB is free software, covered by the GNU General Public License, and you are welcome to change it and/or distribute copies of it under certain conditions. Type "show copying" to see the conditions. There is absolutely no warranty for GDB. Type "show warranty" for details. This GDB was configured as "x86_64-apple-darwin".sharedlibrary apply-load-rules all Attaching to process 9335. TwitterSearch(9335) malloc: recording malloc stacks to disk using standard recorder TwitterSearch(9335) malloc: process 9300 no longer exists, stack logs deleted from /tmp/stack-logs.9300.TwitterSearch.suirlR.index TwitterSearch(9335) malloc: stack logs being written into /tmp/stack- logs.9335.TwitterSearch.tQJAXk.index 2010-12-21 21:11:25.446 TwitterSearch[9335:207] View Did Load Program received signal: “EXC_BAD_ACCESS”. And this is when i tried to type backtrace on gdb : Program received signal: “EXC_BAD_ACCESS”. (gdb) backtrace #0 0x00f20a67 in objc_msgSend () #1 0x0565cd80 in ?? () #2 0x0033b7fa in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] () #3 0x0033177f in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] () #4 0x00346450 in -[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] () #5 0x0033e538 in -[UITableView layoutSubviews] () #6 0x01ffc451 in -[CALayer layoutSublayers] () #7 0x01ffc17c in CALayerLayoutIfNeeded () #8 0x01ff537c in CA::Context::commit_transaction () #9 0x01ff50d0 in CA::Transaction::commit () #10 0x020257d5 in CA::Transaction::observer_callback () #11 0x00d9ffbb in __CFRUNLOOP_IS_CALLING_OUT_TO_AN_OBSERVER_CALLBACK_FUNCTION__ () #12 0x00d350e7 in __CFRunLoopDoObservers () #13 0x00cfdbd7 in __CFRunLoopRun () #14 0x00cfd240 in CFRunLoopRunSpecific () #15 0x00cfd161 in CFRunLoopRunInMode () #16 0x01a73268 in GSEventRunModal () #17 0x01a7332d in GSEventRun () #18 0x002d642e in UIApplicationMain () #19 0x00001d4e in main (argc=1, argv=0xbfffee34) at /Users/suprie/Documents/Projects/Self/cocoa/TwitterSearch/main.m:14 I really appreciate for any clue to help me debug my application. EDIT this is the Header file of table #import <UIKit/UIKit.h> @interface TwitterTableViewController : UITableViewController { NSMutableArray *twitters; } @property(nonatomic,retain) NSMutableArray *twitters; @end and the implementation file #import "TwitterTableViewController.h" @implementation TwitterTableViewController @synthesize twitters; #pragma mark - #pragma mark Table view data source - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 1; } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return [twitters count]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { return 90.0f; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { const NSInteger TAG_IMAGE_VIEW = 1001; const NSInteger TAG_TWEET_VIEW = 1002; const NSInteger TAG_FROM_VIEW = 1003; static NSString *CellIdentifier = @"Cell"; UIImageView *imageView; UILabel *tweet; UILabel *from; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; // Image imageView = [[[[UIImageView alloc] initWithFrame:CGRectMake(5.0f, 5.0f, 60.0f, 60.0f)] autorelease] retain]; [cell.contentView addSubview:imageView]; imageView.tag = TAG_IMAGE_VIEW; // Tweet tweet = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 5.0f, 200.0f, 50.0f)] autorelease]; [cell.contentView addSubview:tweet]; tweet.tag = TAG_TWEET_VIEW; tweet.numberOfLines = 2; tweet.font = [UIFont fontWithName:@"Helvetica" size:12]; tweet.textColor = [UIColor blackColor]; tweet.backgroundColor = [UIColor clearColor]; // From from = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 55.0, 200.0f, 35.0f)] autorelease]; [cell.contentView addSubview:from]; from.tag = TAG_FROM_VIEW; from.numberOfLines = 1; from.font = [UIFont fontWithName:@"Helvetica" size:10]; from.textColor = [UIColor blackColor]; from.backgroundColor = [UIColor clearColor]; } // Configure the cell... NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger) indexPath.row]; // cell.text = [twitter objectForKey:@"text"]; tweet.text = (NSString *) [twitter objectForKey:@"text"]; tweet.hidden = NO; from.text = (NSString *) [twitter objectForKey:@"from_user"]; from.hidden = NO; NSString *avatar_url = (NSString *)[twitter objectForKey:@"profile_image_url"]; NSData * imageData = [[NSData alloc] initWithContentsOfURL: [NSURL URLWithString: avatar_url]]; imageView.image = [UIImage imageWithData: imageData]; imageView.hidden = NO; return cell; } #pragma mark - #pragma mark Table view delegate - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger)indexPath.row]; NSLog(@"Twit ini kepilih :%@", [twitter objectForKey:@"text"]); } #pragma mark - #pragma mark Memory management - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; } - (void)viewDidUnload { } - (void)dealloc { [super dealloc]; } @end

    Read the article

  • Condition Variable in Shared Memory - is this code POSIX-conformant?

    - by GrahamS
    We've been trying to use a mutex and condition variable to synchronise access to named shared memory on a LynuxWorks LynxOS-SE system (POSIX-conformant). One shared memory block is called "/sync" and contains the mutex and condition variable, the other is "/data" and contains the actual data we are syncing access to. We're seeing failures from pthread_cond_signal() if both processes don't perform the mmap() calls in exactly the same order, or if one process mmaps in some other piece of shared memory before it mmaps the sync memory. This example code is about as short as I can make it: #include <sys/types.h> #include <sys/stat.h> #include <sys/mman.h> #include <sys/file.h> #include <stdlib.h> #include <pthread.h> #include <errno.h> #include <iostream> #include <string> using namespace std; static const string shm_name_sync("/sync"); static const string shm_name_data("/data"); struct shared_memory_sync { pthread_mutex_t mutex; pthread_cond_t condition; }; struct shared_memory_data { int a; int b; }; //Create 2 shared memory objects // - sync contains 2 shared synchronisation objects (mutex and condition) // - data not important void create() { // Create and map 'sync' shared memory int fd_sync = shm_open(shm_name_sync.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_sync, sizeof(shared_memory_sync)); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // init the cond and mutex pthread_condattr_t cond_attr; pthread_condattr_init(&cond_attr); pthread_condattr_setpshared(&cond_attr, PTHREAD_PROCESS_SHARED); pthread_cond_init(&(p_sync->condition), &cond_attr); pthread_condattr_destroy(&cond_attr); pthread_mutexattr_t m_attr; pthread_mutexattr_init(&m_attr); pthread_mutexattr_setpshared(&m_attr, PTHREAD_PROCESS_SHARED); pthread_mutex_init(&(p_sync->mutex), &m_attr); pthread_mutexattr_destroy(&m_attr); // Create the 'data' shared memory int fd_data = shm_open(shm_name_data.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_data, sizeof(shared_memory_data)); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); // Run the second process while it sleeps here. sleep(10); int res = pthread_cond_signal(&(p_sync->condition)); assert(res==0); // <--- !!!THIS ASSERT WILL FAIL ON LYNXOS!!! munmap(addr_sync, sizeof(shared_memory_sync)); shm_unlink(shm_name_sync.c_str()); munmap(addr_data, sizeof(shared_memory_data)); shm_unlink(shm_name_data.c_str()); } //Open the same 2 shared memory objects but in reverse order // - data // - sync void open() { sleep(2); int fd_data = shm_open(shm_name_data.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); int fd_sync = shm_open(shm_name_sync.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // Wait on the condvar pthread_mutex_lock(&(p_sync->mutex)); pthread_cond_wait(&(p_sync->condition), &(p_sync->mutex)); pthread_mutex_unlock(&(p_sync->mutex)); munmap(addr_sync, sizeof(shared_memory_sync)); munmap(addr_data, sizeof(shared_memory_data)); } int main(int argc, char** argv) { if(argc>1) { open(); } else { create(); } return (0); } Run this program with no args, then another copy with args, and the first one will fail at the assert checking the pthread_cond_signal(). But change the open() function to mmap() the "/sync" memory first and it will all work fine. This seems like a major bug in LynxOS but LynuxWorks claim that using mutex and condition variable in this way is not covered by the POSIX standard, so they are not interested. Can anyone determine if this code does violate POSIX? Or does anyone have any convincing documentation that it is POSIX compliant?

    Read the article

  • compile time if && return string reference optimization

    - by Truncheon
    Hi. I'm writing a series classes that inherit from a base class using virtual. They are INT, FLOAT and STRING objects that I want to use in a scripting language. I'm trying to implement weak typing, but I don't want STRING objects to return copies of themselves when used in the following way (instead I would prefer to have a reference returned which can be used in copying): a = "hello "; b = "world"; c = a + b; I have written the following code as a mock example: #include <iostream> #include <string> #include <cstdio> #include <cstdlib> std::string dummy("<int object cannot return string reference>"); struct BaseImpl { virtual bool is_string() = 0; virtual int get_int() = 0; virtual std::string get_string_copy() = 0; virtual std::string const& get_string_ref() = 0; }; struct INT : BaseImpl { int value; INT(int i = 0) : value(i) { std::cout << "constructor called\n"; } INT(BaseImpl& that) : value(that.get_int()) { std::cout << "copy constructor called\n"; } bool is_string() { return false; } int get_int() { return value; } std::string get_string_copy() { char buf[33]; sprintf(buf, "%i", value); return buf; } std::string const& get_string_ref() { return dummy; } }; struct STRING : BaseImpl { std::string value; STRING(std::string s = "") : value(s) { std::cout << "constructor called\n"; } STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } bool is_string() { return true; } int get_int() { return atoi(value.c_str()); } std::string get_string_copy() { return value; } std::string const& get_string_ref() { return value; } }; struct Base { BaseImpl* impl; Base(BaseImpl* p = 0) : impl(p) {} ~Base() { delete impl; } }; int main() { Base b1(new INT(1)); Base b2(new STRING("Hello world")); Base b3(new INT(*b1.impl)); Base b4(new STRING(*b2.impl)); std::cout << "\n"; std::cout << b1.impl->get_int() << "\n"; std::cout << b2.impl->get_int() << "\n"; std::cout << b3.impl->get_int() << "\n"; std::cout << b4.impl->get_int() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_ref() << "\n"; std::cout << b2.impl->get_string_ref() << "\n"; std::cout << b3.impl->get_string_ref() << "\n"; std::cout << b4.impl->get_string_ref() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_copy() << "\n"; std::cout << b2.impl->get_string_copy() << "\n"; std::cout << b3.impl->get_string_copy() << "\n"; std::cout << b4.impl->get_string_copy() << "\n"; return 0; } It was necessary to add an if check in the STRING class to determine whether its safe to request a reference instead of a copy: Script code: a = "test"; b = a; c = 1; d = "" + c; /* not safe to request reference by standard */ C++ code: STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } If was hoping there's a way of moving that if check into compile time, rather than run time.

    Read the article

  • Trying to reduce the speed overhead of an almost-but-not-quite-int number class

    - by Fumiyo Eda
    I have implemented a C++ class which behaves very similarly to the standard int type. The difference is that it has an additional concept of "epsilon" which represents some tiny value that is much less than 1, but greater than 0. One way to think of it is as a very wide fixed point number with 32 MSBs (the integer parts), 32 LSBs (the epsilon parts) and a huge sea of zeros in between. The following class works, but introduces a ~2x speed penalty in the overall program. (The program includes code that has nothing to do with this class, so the actual speed penalty of this class is probably much greater than 2x.) I can't paste the code that is using this class, but I can say the following: +, -, +=, <, > and >= are the only heavily used operators. Use of setEpsilon() and getInt() is extremely rare. * is also rare, and does not even need to consider the epsilon values at all. Here is the class: #include <limits> struct int32Uepsilon { typedef int32Uepsilon Self; int32Uepsilon () { _value = 0; _eps = 0; } int32Uepsilon (const int &i) { _value = i; _eps = 0; } void setEpsilon() { _eps = 1; } Self operator+(const Self &rhs) const { Self result = *this; result._value += rhs._value; result._eps += rhs._eps; return result; } Self operator-(const Self &rhs) const { Self result = *this; result._value -= rhs._value; result._eps -= rhs._eps; return result; } Self operator-( ) const { Self result = *this; result._value = -result._value; result._eps = -result._eps; return result; } Self operator*(const Self &rhs) const { return this->getInt() * rhs.getInt(); } // XXX: discards epsilon bool operator<(const Self &rhs) const { return (_value < rhs._value) || (_value == rhs._value && _eps < rhs._eps); } bool operator>(const Self &rhs) const { return (_value > rhs._value) || (_value == rhs._value && _eps > rhs._eps); } bool operator>=(const Self &rhs) const { return (_value >= rhs._value) || (_value == rhs._value && _eps >= rhs._eps); } Self &operator+=(const Self &rhs) { this->_value += rhs._value; this->_eps += rhs._eps; return *this; } Self &operator-=(const Self &rhs) { this->_value -= rhs._value; this->_eps -= rhs._eps; return *this; } int getInt() const { return(_value); } private: int _value; int _eps; }; namespace std { template<> struct numeric_limits<int32Uepsilon> { static const bool is_signed = true; static int max() { return 2147483647; } } }; The code above works, but it is quite slow. Does anyone have any ideas on how to improve performance? There are a few hints/details I can give that might be helpful: 32 bits are definitely insufficient to hold both _value and _eps. In practice, up to 24 ~ 28 bits of _value are used and up to 20 bits of _eps are used. I could not measure a significant performance difference between using int32_t and int64_t, so memory overhead itself is probably not the problem here. Saturating addition/subtraction on _eps would be cool, but isn't really necessary. Note that the signs of _value and _eps are not necessarily the same! This broke my first attempt at speeding this class up. Inline assembly is no problem, so long as it works with GCC on a Core i7 system running Linux!

    Read the article

  • Paypal development. encrypt transactions. php p12

    - by ninchen
    when i take a look at the paypal documentation, they say "Note that the PayPal SDK for PHP does not require SSL encryption". https://developer.paypal.com/docs/classic/api/apiCredentials/#encrypting-your-certificate Is the statement of this phrase, that i don't have to create a p12 certificate when working with php, but use the public_key.pem and paypal_public_key.pem? If yes: Is it secure enough to create the encrypted form input elements without p12 certificate? If no: What do they mean? :-) Before this question came up, i've tested this little programm. http://www.softarea51.com/blog/how-to-integrate-your-custom-shopping-cart-with-paypal-website-payments-standard-using-php/ There is a config file paypal-wps-config.inc.php where i can define the paths to my certificates. // tryed to use // 'paypal_cert.p12 '; $config['private_key_path'] = '/home/folder/.cert/pp/prvkey.pem'; // must match the one you set when you created the private key $config['private_key_password'] = ''; //'my_password'; When i try to use the p12 certificate, openssl_error_string() returns "Could not sign data: error:0906D06C:PEM routines:PEM_read_bio:no start line openssl_pkcs7_sign When i instead use the prvkey.pem without password all works fine. Here is the function, which signs and encrypt the data. function signAndEncrypt($dataStr_, $ewpCertPath_, $ewpPrivateKeyPath_, $ewpPrivateKeyPwd_, $paypalCertPath_) { $dataStrFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($dataStrFile, 'w'); if(!$fd) { $error = "Could not open temporary file $dataStrFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $dataStr_); fclose($fd); $signedDataFile = realpath(tempnam('/tmp', 'pp_')); **// here the error came from** if(!@openssl_pkcs7_sign( $dataStrFile, $signedDataFile, "file://$ewpCertPath_", array("file://$ewpPrivateKeyPath_", $ewpPrivateKeyPwd_), array(), PKCS7_BINARY)) { unlink($dataStrFile); unlink($signedDataFile); $error = "Could not sign data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($dataStrFile); $signedData = file_get_contents($signedDataFile); $signedDataArray = explode("\n\n", $signedData); $signedData = $signedDataArray[1]; $signedData = base64_decode($signedData); unlink($signedDataFile); $decodedSignedDataFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($decodedSignedDataFile, 'w'); if(!$fd) { $error = "Could not open temporary file $decodedSignedDataFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $signedData); fclose($fd); $encryptedDataFile = realpath(tempnam('/tmp', 'pp_')); if(!@openssl_pkcs7_encrypt( $decodedSignedDataFile, $encryptedDataFile, file_get_contents($paypalCertPath_), array(), PKCS7_BINARY)) { unlink($decodedSignedDataFile); unlink($encryptedDataFile); $error = "Could not encrypt data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($decodedSignedDataFile); $encryptedData = file_get_contents($encryptedDataFile); if(!$encryptedData) { $error = "Encryption and signature of data failed."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($encryptedDataFile); $encryptedDataArray = explode("\n\n", $encryptedData); $encryptedData = trim(str_replace("\n", '', $encryptedDataArray[1])); return array("status" => true, "encryptedData" => $encryptedData); } // signAndEncrypt } // PPCrypto The main questions: 1. Is it possible to use p12 cert with php, or is it secure enough to work without it? 2. Why i become an error when using openssl_pkcs7_sign Please help. Greetings ninchen

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • Receiving broadcast packets using packet socket

    - by user314336
    Hello I try to send DHCP RENEW packets to the network and receive the responses. I broadcast the packet and I can see that it's successfully sent using Wireshark. But I have difficulties receiving the responses.I use packet sockets to catch the packets. I can see that there are responses to my RENEW packet using Wireshark, but my function 'packet_receive_renew' sometimes catch the packets but sometimes it can not catch the packets. I set the file descriptor using FDSET but the 'select' in my code can not realize that there are new packets for that file descriptor and timeout occurs. I couldn't make it clear that why it sometimes catches the packets and sometimes doesn't. Anybody have an idea? Thanks in advance. Here's the receive function. int packet_receive_renew(struct client_info* info) { int fd; struct sockaddr_ll sock, si_other; struct sockaddr_in si_me; fd_set rfds; struct timeval tv; time_t start, end; int bcast = 1; int ret = 0, try = 0; char buf[1500] = {'\0'}; uint8_t tmp[BUFLEN] = {'\0'}; struct dhcp_packet pkt; socklen_t slen = sizeof(si_other); struct dhcps* new_dhcps; memset((char *) &si_me, 0, sizeof(si_me)); memset((char *) &si_other, 0, sizeof(si_other)); memset(&pkt, 0, sizeof(struct dhcp_packet)); define SERVER_AND_CLIENT_PORTS ((67 << 16) + 68) static const struct sock_filter filter_instr[] = { /* check for udp */ BPF_STMT(BPF_LD|BPF_B|BPF_ABS, 9), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, IPPROTO_UDP, 0, 4), /* L5, L1, is UDP? */ /* skip IP header */ BPF_STMT(BPF_LDX|BPF_B|BPF_MSH, 0), /* L5: */ /* check udp source and destination ports */ BPF_STMT(BPF_LD|BPF_W|BPF_IND, 0), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, SERVER_AND_CLIENT_PORTS, 0, 1), /* L3, L4 */ /* returns */ BPF_STMT(BPF_RET|BPF_K, 0x0fffffff ), /* L3: pass */ BPF_STMT(BPF_RET|BPF_K, 0), /* L4: reject */ }; static const struct sock_fprog filter_prog = { .len = sizeof(filter_instr) / sizeof(filter_instr[0]), /* casting const away: */ .filter = (struct sock_filter *) filter_instr, }; printf("opening raw socket on ifindex %d\n", info->interf.if_index); if (-1==(fd = socket(PF_PACKET, SOCK_DGRAM, htons(ETH_P_IP)))) { perror("packet_receive_renew::socket"); return -1; } printf("got raw socket fd %d\n", fd); /* Use only if standard ports are in use */ /* Ignoring error (kernel may lack support for this) */ if (-1==setsockopt(fd, SOL_SOCKET, SO_ATTACH_FILTER, &filter_prog, sizeof(filter_prog))) perror("packet_receive_renew::setsockopt"); sock.sll_family = AF_PACKET; sock.sll_protocol = htons(ETH_P_IP); //sock.sll_pkttype = PACKET_BROADCAST; sock.sll_ifindex = info->interf.if_index; if (-1 == bind(fd, (struct sockaddr *) &sock, sizeof(sock))) { perror("packet_receive_renew::bind"); close(fd); return -3; } if (-1 == setsockopt(fd, SOL_SOCKET, SO_BROADCAST, &bcast, sizeof(bcast))) { perror("packet_receive_renew::setsockopt"); close(fd); return -1; } FD_ZERO(&rfds); FD_SET(fd, &rfds); tv.tv_sec = TIMEOUT; tv.tv_usec = 0; ret = time(&start); if (-1 == ret) { perror("packet_receive_renew::time"); close(fd); return -1; } while(1) { ret = select(fd + 1, &rfds, NULL, NULL, &tv); time(&end); if (TOTAL_PENDING <= (end - start)) { fprintf(stderr, "End receiving\n"); break; } if (-1 == ret) { perror("packet_receive_renew::select"); close(fd); return -4; } else if (ret) { new_dhcps = (struct dhcps*)calloc(1, sizeof(struct dhcps)); if (-1 == recvfrom(fd, buf, 1500, 0, (struct sockaddr*)&si_other, &slen)) { perror("packet_receive_renew::recvfrom"); close(fd); return -4; } deref_packet((unsigned char*)buf, &pkt, info); if (-1!=(ret=get_option_val(pkt.options, DHO_DHCP_SERVER_IDENTIFIER, tmp))) { sprintf((char*)tmp, "%d.%d.%d.%d", tmp[0],tmp[1],tmp[2],tmp[3]); fprintf(stderr, "Received renew from %s\n", tmp); } else { fprintf(stderr, "Couldnt get DHO_DHCP_SERVER_IDENTIFIER%s\n", tmp); close(fd); return -5; } new_dhcps->dhcps_addr = strdup((char*)tmp); //add to list if (info->dhcps_list) info->dhcps_list->next = new_dhcps; else info->dhcps_list = new_dhcps; new_dhcps->next = NULL; } else { try++; tv.tv_sec = TOTAL_PENDING - try * TIMEOUT; tv.tv_usec = 0; fprintf(stderr, "Timeout occured\n"); } } close(fd); printf("close fd:%d\n", fd); return 0; }

    Read the article

  • Center footer fixed at the bottom IE

    - by Mirko
    I am coding a web interface for a University project and I have been dealing with this issue: I want my footer fixed at the bottom so it is in place no matter which screen I am using or if I toggle the full screen mode It works in all the other browsers except IE7 (I do not have to support previous versions) HTML <div id="menu"> <a href="information.html" rel="shadowbox;height=500;width=650" title="INFORMATION" > <img src="images/info.png" alt="information icon" /> </a> <a href="images/bricks_of_destiny.jpg" rel="shadowbox[gallery]" title="IMAGES" > <img src="images/image.png" alt="image icon" /> </a> <a href="music_player.swf" title="MUSIC" rel="shadowbox;height=400;width=600" > <img src="images/music.png" alt="music icon" /> </a> <a href="#" title="MOVIES"><img src="images/television.png" alt="movies icon" /></a> <a href="quotes.html" title="QUOTES" rel="shadowbox;height=300;width=650" > <img src="images/male_user.png" alt="male user icon" /> </a> <a href="#" title="REFERENCES"> <img src="images/search_globe.png" alt="search globe icon" /> </a> </div> <a href="images/destiny_1.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/destiny_carma_jewell.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/destiny-joan-marie.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <a href="images/pursuing_destiny.jpg" rel="shadowbox[gallery]" title="IMAGES"></a> <div class="clear"></div> <div id="destiny"> Discover more about the word <span class="strong">DESTINY </span>! Click one of the icon above! (F11 Toggle Full / Standard screen) </div> <div id="footer"> <ul id="breadcrumbs"> <li>Disclaimer</li> <li> | Icons by: <a href="http://dryicons.com/" rel="shadowbox">dryicons.com</a></li> <li> | Website by: <a href="http://www.eezzyweb.com/" rel="shadowbox">eezzyweb</a></li> <li> | <a href="http://jquery.com/" rel="shadowbox">jQuery</a></li> </ul> </div> </div> CSS: #wrapper{ text-align:center; margin:0 auto; width:750px; height:430px; border:1px solid #fff; } #menu{ position:relative; margin:0 auto; top:350px; width:450px; height:60px; } #destiny{ position:relative; top:380px; color:#FFF; font-size:1.5em; font-weight:bold; border:1px solid #fff; } #breadcrumbs{ list-style:none; } #breadcrumbs li{ display:inline; color:#FFF; } #footer{ position:absolute; width:750px; height:60px; margin:0 auto; text-align:center; border:1px solid #fff; bottom:0; } .clear{ clear:both; } The white borders are there only for debugging purposes The application is hosted at http://www.eezzyweb.com/destiny/ Any suggestion is appreciated

    Read the article

  • Link List Implementation Help - Visual C++

    - by Greenhouse Gases
    Hi there I'm trying to implement a link list which stores the city name (though you will see this commented out as I need to resolve the issue of not being able to use string and needing to use a primitive data type instead during the declaration), longitude, latitude and of course a pointer to the next node in the chain. I am new to the Visual C++ environment and my brain is somewhat scrambled after coding for several straight hours today so I wondered if anyone could help resolve the 2 errors I am getting (ignore the #include syntax as I had to change them to avoid the browser interpreting html!): 1U08221.obj : error LNK2028: unresolved token (0A000298) "public: __thiscall Locations::Locations(void)" (??0Locations@@$$FQAE@XZ) referenced in function "int __clrcall main(cli::array^)" (?main@@$$HYMHP$01AP$AAVString@System@@@Z) 1U08221.obj : error LNK2019: unresolved external symbol "public: __thiscall Locations::Locations(void)" (??0Locations@@$$FQAE@XZ) referenced in function "int __clrcall main(cli::array^)" (?main@@$$HYMHP$01AP$AAVString@System@@@Z) The code for my header file is here: include string struct locationNode { //char[10] nodeCityName; double nodeLati; double nodeLongi; locationNode* Next; }; class Locations { private: int size; public: Locations(); // constructor for the class locationNode* Head; int Add(locationNode* Item); }; and here is the code for the file containing the main method: // U08221.cpp : main project file. include "stdafx.h" include "Locations.h" include iostream include string using namespace std; int n = 0; int x; string cityNameInput; bool acceptedInput = false; int Locations::Add(locationNode *NewItem) { locationNode *Sample = new locationNode; Sample = NewItem; Sample-Next = Head; Head = Sample; return size++; } void CorrectCase(string name) // Correct upper and lower case letters of input { x = name.size(); int firstLetVal = name[0], letVal; n = 1; // variable for name index from second letter onwards if((name[0] 90) && (name[0] < 123)) // First letter is lower case { firstLetVal = firstLetVal - 32; // Capitalise first letter name[0] = firstLetVal; } while(n <= x - 1) { if((name[n] = 65) && (name[n] <= 90)) { letVal = name[n] + 32; name[n] = letVal; } n++; } cityNameInput = name; } void nameValidation(string name) { n = 0; // start from first letter x = name.size(); while(!acceptedInput) { if((name[n] = 65) && (name[n] <= 122)) // is in the range of letters { while(n <= x - 1) { while((name[n] =91) && (name[n] <=97)) // ERROR!! { cout << "Please enter a valid city name" << endl; cin name; } n++; } } else { cout << "Please enter a valid city name" << endl; cin name; } if(n <= x - 1) { acceptedInput = true; } } cityNameInput = name; } int main(array ^args) { cout << "Enter a city name" << endl; cin cityNameInput; nameValidation(cityNameInput); // check is made up of valid characters CorrectCase(cityNameInput); // corrects name to standard format of capitalised first letter, and lower case subsequent letters cout << cityNameInput; cin cityNameInput; Locations::Locations(); Locations *Parts = new Locations(); locationNode *Part; Part = new locationNode; //Part-nodeCityName = "London"; Part-nodeLati = 87; Part-nodeLongi = 80; Parts-Add(Part); } I am familiar with the concepts but somewhat inexperienced with OOP so am making some silly errors that you can never find when you've stared at something too long. Any help you can offer will be appreciated! Thanks

    Read the article

  • Php mail pulling form data from previous page

    - by Mark
    So I have a form being filled out on one php like so: <p> <label for="first_name">First Name: </label> <input type="text" size="30" name="first_name" id="first_name"/> </p> <p> <label for="last_name"> Last Name:</label> <input type="text" size="30" name="last_name" id="last_name"/> </p> <p> <label for="address_street">Street:</label> <input type="text" size="30" name="address_street" id="address_street"/> </p> <p> <label for="address_city">City:</label> <input type="text" size="30" name="address_city" id="address_city"/> </p> <p> <label for="address_state">State/Province:</label> <input type="text" size="30" name="address_state" id="address_state"/> </p> <p> <label for="email">Your e-mail: </label> <input type="text" size="30" name="email" id="email"/> </p> <p> <label for="phone">Your phone number: </label> <input type="text" size="30" name="phone" id="phone"/> </p> This is on one php page. From here, it goes to another php which part of it contains script to send a html email to recipient. Problem is, I cannot seem to get it to pull the variables even though I thought I declared them correctly and mixed them into the html correctly. <?php $first_name = $_POST['first_name']; $last_name = $_POST['last_name']; $to = "[email protected], [email protected]"; $subject = "HTML email for ALPS"; $message .= ' <html> <body> <div style="display: inline-block; width: 28%; float: left;"> <img src="http://englishintheusa.com/images/alps-logo.jpg" alt="ALPS Language School" /> </div> <div style="display: inline-block; width: 68%; float: right;"> <p style="color: #4F81BD; font-size: 20px; text-decoration: underline;">Thanks You For Your Inquiry!</p> </div> <div style="padding-left: 20px; color: #666666; font-size: 16.8px; clear: both;"> <p>Dear $first_name $last_name ,</p> </br > <p>Thank you for the following inquiry:</p> </br > </br > </br > </br > <p>****Comment goes here****</p> </br > </br > <p>We will contact you within 2 business days. Our office is open Monday-Friday, 8:30 AM - 5:00 PM Pacific Standard Time.</p> </br > <p>Thank you for your interest!</p> </br > </br > <p>Best Regards,</p> </br > </br > <p>ALPS Language School</p> </br > </br > <p>430 Broadway East</p> <p>Seattle WA 98102</p> <p>Phone: 206.720.6363</p> <p>Fax: 206. 720.1806</p> <p>Email: [email protected]</p> </div> </body> </html>'; // Always set content-type when sending HTML email $headers .= "MIME-Version: 1.0" . "\r\n"; $headers .= "Content-type:text/html;charset=UTF-8" . "\r\n"; // More headers mail($to,$subject,$message,$headers); ?> So you see where I am trying to get first_name and last_name. Well it doesn't come out correctly. Can someone help here?

    Read the article

  • How to detect crashing tabed webbrowser and handle it?

    - by David Eaton
    I have a desktop application (forms) with a tab control, I assign a tab and a new custom webrowser control. I open up about 10 of these tabs. Each one visits about 100 - 500 different pages. The trouble is that if 1 webbrowser control has a problem it shuts down the entire program. I want to be able to close the offending webbrowser control and open a new one in it's place. Is there any event that I need to subscribe to catch a crashing or unresponsive webbrowser control ? I am using C# on windows 7 (Forms), .NET framework v4 =============================================================== UPDATE: 1 - The Tabbed WebBrowser Example Here is the code I have and How I use the webbrowser control in the most basic way. Create a new forms project and name it SimpleWeb Add a new class and name it myWeb.cs, here is the code to use. using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Windows.Forms; using System.Security.Policy; namespace SimpleWeb { //inhert all of webbrowser class myWeb : WebBrowser { public myWeb() { //no javascript errors this.ScriptErrorsSuppressed = true; //Something we want set? AssignEvents(); } //keep near the top private void AssignEvents() { //assign WebBrowser events to our custom methods Navigated += myWeb_Navigated; DocumentCompleted += myWeb_DocumentCompleted; Navigating += myWeb_Navigating; NewWindow += myWeb_NewWindow; } #region Events //List of events:http://msdn.microsoft.com/en-us/library/system.windows.forms.webbrowser_events%28v=vs.100%29.aspx //Fired when a new windows opens private void myWeb_NewWindow(object sender, System.ComponentModel.CancelEventArgs e) { //cancel all popup windows e.Cancel = true; //beep to let you know canceled new window Console.Beep(9000, 200); } //Fired before page is navigated (not sure if its before or during?) private void myWeb_Navigating(object sender, System.Windows.Forms.WebBrowserNavigatingEventArgs args) { } //Fired after page is navigated (but not loaded) private void myWeb_Navigated(object sender, System.Windows.Forms.WebBrowserNavigatedEventArgs args) { } //Fired after page is loaded (Catch 22 - Iframes could be considered a page, can fire more than once. Ads are good examples) private void myWeb_DocumentCompleted(System.Object sender, System.Windows.Forms.WebBrowserDocumentCompletedEventArgs args) { } #endregion //Answer supplied by mo. (modified)? public void OpenUrl(string url) { try { //this.OpenUrl(url); this.Navigate(url); } catch (Exception ex) { MessageBox.Show("Your App Crashed! Because = " + ex.ToString()); //MyApplication.HandleException(ex); } } //Keep near the bottom private void RemoveEvents() { //Remove Events Navigated -= myWeb_Navigated; DocumentCompleted -= myWeb_DocumentCompleted; Navigating -= myWeb_Navigating; NewWindow -= myWeb_NewWindow; } } } On Form1 drag a standard tabControl and set the dock to fill, you can go into the tab collection and delete the pre-populated tabs if you like. Right Click on Form1 and Select "View Code" and replace it with this code. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using mshtml; namespace SimpleWeb { public partial class Form1 : Form { public Form1() { InitializeComponent(); //Load Up 10 Tabs for (int i = 0; i <= 10; i++) { newTab("Test_" + i, "http://wwww.yahoo.com"); } } private void newTab(string Title, String Url) { //Create a new Tab TabPage newTab = new TabPage(); newTab.Name = Title; newTab.Text = Title; //create webbrowser Instance myWeb newWeb = new myWeb(); //Add webbrowser to new tab newTab.Controls.Add(newWeb); newWeb.Dock = DockStyle.Fill; //Add New Tab to Tab Pages tabControl1.TabPages.Add(newTab); newWeb.OpenUrl(Url); } } } Save and Run the project. Using the answer below by mo. , you can surf the first url with no problem, but what about all the urls the user clicks on? How do we check those? I prefer not to add events to every single html element on a page, there has to be a way to run the new urls thru the function OpenUrl before it navigates without having an endless loop. Thanks.

    Read the article

  • Implicit constructor available for all types derived from Base excepted the current type?

    - by Vincent
    The following code sum up my problem : template<class Parameter> class Base {}; template<class Parameter1, class Parameter2, class Parameter> class Derived1 : public Base<Parameter> { }; template<class Parameter1, class Parameter2, class Parameter> class Derived2 : public Base<Parameter> { public : // Copy constructor Derived2(const Derived2& x); // An EXPLICIT constructor that does a special conversion for a Derived2 // with other template parameters template<class OtherParameter1, class OtherParameter2, class OtherParameter> explicit Derived2( const Derived2<OtherParameter1, OtherParameter2, OtherParameter>& x ); // Now the problem : I want an IMPLICIT constructor that will work for every // type derived from Base EXCEPT // Derived2<OtherParameter1, OtherParameter2, OtherParameter> template<class Type, class = typename std::enable_if</* SOMETHING */>::type> Derived2(const Type& x); }; How to restrict an implicit constructor to all classes derived from the parent class excepted the current class whatever its template parameters, considering that I already have an explicit constructor as in the example code ? EDIT : For the implicit constructor from Base, I can obviously write : template<class OtherParameter> Derived2(const Base<OtherParameter>& x); But in that case, do I have the guaranty that the compiler will not use this constructor as an implicit constructor for Derived2<OtherParameter1, OtherParameter2, OtherParameter> ? EDIT2: Here I have a test : (LWS here : http://liveworkspace.org/code/cd423fb44fb4c97bc3b843732d837abc) #include <iostream> template<typename Type> class Base {}; template<typename Type> class Other : public Base<Type> {}; template<typename Type> class Derived : public Base<Type> { public: Derived() {std::cout<<"empty"<<std::endl;} Derived(const Derived<Type>& x) {std::cout<<"copy"<<std::endl;} template<typename OtherType> explicit Derived(const Derived<OtherType>& x) {std::cout<<"explicit"<<std::endl;} template<typename OtherType> Derived(const Base<OtherType>& x) {std::cout<<"implicit"<<std::endl;} }; int main() { Other<int> other0; Other<double> other1; std::cout<<"1 = "; Derived<int> dint1; // <- empty std::cout<<"2 = "; Derived<int> dint2; // <- empty std::cout<<"3 = "; Derived<double> ddouble; // <- empty std::cout<<"4 = "; Derived<double> ddouble1(ddouble); // <- copy std::cout<<"5 = "; Derived<double> ddouble2(dint1); // <- explicit std::cout<<"6 = "; ddouble = other0; // <- implicit std::cout<<"7 = "; ddouble = other1; // <- implicit std::cout<<"8 = "; ddouble = ddouble2; // <- nothing (normal : default assignment) std::cout<<"\n9 = "; ddouble = Derived<double>(dint1); // <- explicit std::cout<<"10 = "; ddouble = dint2; // <- implicit : WHY ?!?! return 0; } The last line worry me. Is it ok with the C++ standard ? Is it a bug of g++ ?

    Read the article

  • how to avoid temporaries when copying weakly typed object

    - by Truncheon
    Hi. I'm writing a series classes that inherit from a base class using virtual. They are INT, FLOAT and STRING objects that I want to use in a scripting language. I'm trying to implement weak typing, but I don't want STRING objects to return copies of themselves when used in the following way (instead I would prefer to have a reference returned which can be used in copying): a = "hello "; b = "world"; c = a + b; I have written the following code as a mock example: #include <iostream> #include <string> #include <cstdio> #include <cstdlib> std::string dummy("<int object cannot return string reference>"); struct BaseImpl { virtual bool is_string() = 0; virtual int get_int() = 0; virtual std::string get_string_copy() = 0; virtual std::string const& get_string_ref() = 0; }; struct INT : BaseImpl { int value; INT(int i = 0) : value(i) { std::cout << "constructor called\n"; } INT(BaseImpl& that) : value(that.get_int()) { std::cout << "copy constructor called\n"; } bool is_string() { return false; } int get_int() { return value; } std::string get_string_copy() { char buf[33]; sprintf(buf, "%i", value); return buf; } std::string const& get_string_ref() { return dummy; } }; struct STRING : BaseImpl { std::string value; STRING(std::string s = "") : value(s) { std::cout << "constructor called\n"; } STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } bool is_string() { return true; } int get_int() { return atoi(value.c_str()); } std::string get_string_copy() { return value; } std::string const& get_string_ref() { return value; } }; struct Base { BaseImpl* impl; Base(BaseImpl* p = 0) : impl(p) {} ~Base() { delete impl; } }; int main() { Base b1(new INT(1)); Base b2(new STRING("Hello world")); Base b3(new INT(*b1.impl)); Base b4(new STRING(*b2.impl)); std::cout << "\n"; std::cout << b1.impl->get_int() << "\n"; std::cout << b2.impl->get_int() << "\n"; std::cout << b3.impl->get_int() << "\n"; std::cout << b4.impl->get_int() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_ref() << "\n"; std::cout << b2.impl->get_string_ref() << "\n"; std::cout << b3.impl->get_string_ref() << "\n"; std::cout << b4.impl->get_string_ref() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_copy() << "\n"; std::cout << b2.impl->get_string_copy() << "\n"; std::cout << b3.impl->get_string_copy() << "\n"; std::cout << b4.impl->get_string_copy() << "\n"; return 0; } It was necessary to add an if check in the STRING class to determine whether its safe to request a reference instead of a copy: Script code: a = "test"; b = a; c = 1; d = "" + c; /* not safe to request reference by standard */ C++ code: STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } If was hoping there's a way of moving that if check into compile time, rather than run time.

    Read the article

  • Why does decorating a class break the descriptor protocol, thus preventing staticmethod objects from behaving as expected?

    - by Robru
    I need a little bit of help understanding the subtleties of the descriptor protocol in Python, as it relates specifically to the behavior of staticmethod objects. I'll start with a trivial example, and then iteratively expand it, examining it's behavior at each step: class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" At this point, this behaves as expected, but what's going on here is a bit subtle: When you call Stub.do_things(), you are not invoking do_things directly. Instead, Stub.do_things refers to a staticmethod instance, which has wrapped the function we want up inside it's own descriptor protocol such that you are actually invoking staticmethod.__get__, which first returns the function that we want, and then gets called afterwards. >>> Stub <class __main__.Stub at 0x...> >>> Stub.do_things <function do_things at 0x...> >>> Stub.__dict__['do_things'] <staticmethod object at 0x...> >>> Stub.do_things() Doing things! So far so good. Next, I need to wrap the class in a decorator that will be used to customize class instantiation -- the decorator will determine whether to allow new instantiations or provide cached instances: def deco(cls): def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory @deco class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" Now, naturally this part as-is would be expected to break staticmethods, because the class is now hidden behind it's decorator, ie, Stub not a class at all, but an instance of factory that is able to produce instances of Stub when you call it. Indeed: >>> Stub <function factory at 0x...> >>> Stub.do_things Traceback (most recent call last): File "<stdin>", line 1, in <module> AttributeError: 'function' object has no attribute 'do_things' >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! So far I understand what's happening here. My goal is to restore the ability for staticmethods to function as you would expect them to, even though the class is wrapped. As luck would have it, the Python stdlib includes something called functools, which provides some tools just for this purpose, ie, making functions behave more like other functions that they wrap. So I change my decorator to look like this: def deco(cls): @functools.wraps(cls) def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory Now, things start to get interesting: >>> Stub <function Stub at 0x...> >>> Stub.do_things <staticmethod object at 0x...> >>> Stub.do_things() Traceback (most recent call last): File "<stdin>", line 1, in <module> TypeError: 'staticmethod' object is not callable >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! Wait.... what? functools copies the staticmethod over to the wrapping function, but it's not callable? Why not? What did I miss here? I was playing around with this for a bit and I actually came up with my own reimplementation of staticmethod that allows it to function in this situation, but I don't really understand why it was necessary or if this is even the best solution to this problem. Here's the complete example: class staticmethod(object): """Make @staticmethods play nice with decorated classes.""" def __init__(self, func): self.func = func def __call__(self, *args, **kwargs): """Provide the expected behavior inside decorated classes.""" return self.func(*args, **kwargs) def __get__(self, obj, objtype=None): """Re-implement the standard behavior for undecorated classes.""" return self.func def deco(cls): @functools.wraps(cls) def factory(*args, **kwargs): # pretend there is some logic here determining # whether to make a new instance or not return cls(*args, **kwargs) return factory @deco class Stub: @staticmethod def do_things(): """Call this like Stub.do_things(), with no arguments or instance.""" print "Doing things!" Indeed it works exactly as expected: >>> Stub <function Stub at 0x...> >>> Stub.do_things <__main__.staticmethod object at 0x...> >>> Stub.do_things() Doing things! >>> Stub() <__main__.Stub instance at 0x...> >>> Stub().do_things <function do_things at 0x...> >>> Stub().do_things() Doing things! What approach would you take to make a staticmethod behave as expected inside a decorated class? Is this the best way? Why doesn't the builtin staticmethod implement __call__ on it's own in order for this to just work without any fuss? Thanks.

    Read the article

  • Integrating JavaScript Unit Tests with Visual Studio

    - by Stephen Walther
    Modern ASP.NET web applications take full advantage of client-side JavaScript to provide better interactivity and responsiveness. If you are building an ASP.NET application in the right way, you quickly end up with lots and lots of JavaScript code. When writing server code, you should be writing unit tests. One big advantage of unit tests is that they provide you with a safety net that enable you to safely modify your existing code – for example, fix bugs, add new features, and make performance enhancements -- without breaking your existing code. Every time you modify your code, you can execute your unit tests to verify that you have not broken anything. For the same reason that you should write unit tests for your server code, you should write unit tests for your client code. JavaScript is just as susceptible to bugs as C#. There is no shortage of unit testing frameworks for JavaScript. Each of the major JavaScript libraries has its own unit testing framework. For example, jQuery has QUnit, Prototype has UnitTestJS, YUI has YUI Test, and Dojo has Dojo Objective Harness (DOH). The challenge is integrating a JavaScript unit testing framework with Visual Studio. Visual Studio and Visual Studio ALM provide fantastic support for server-side unit tests. You can easily view the results of running your unit tests in the Visual Studio Test Results window. You can set up a check-in policy which requires that all unit tests pass before your source code can be committed to the source code repository. In addition, you can set up Team Build to execute your unit tests automatically. Unfortunately, Visual Studio does not provide “out-of-the-box” support for JavaScript unit tests. MS Test, the unit testing framework included in Visual Studio, does not support JavaScript unit tests. As soon as you leave the server world, you are left on your own. The goal of this blog entry is to describe one approach to integrating JavaScript unit tests with MS Test so that you can execute your JavaScript unit tests side-by-side with your C# unit tests. The goal is to enable you to execute JavaScript unit tests in exactly the same way as server-side unit tests. You can download the source code described by this project by scrolling to the end of this blog entry. Rejected Approach: Browser Launchers One popular approach to executing JavaScript unit tests is to use a browser as a test-driver. When you use a browser as a test-driver, you open up a browser window to execute and view the results of executing your JavaScript unit tests. For example, QUnit – the unit testing framework for jQuery – takes this approach. The following HTML page illustrates how you can use QUnit to create a unit test for a function named addNumbers(). <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title>Using QUnit</title> <link rel="stylesheet" href="http://github.com/jquery/qunit/raw/master/qunit/qunit.css" type="text/css" /> </head> <body> <h1 id="qunit-header">QUnit example</h1> <h2 id="qunit-banner"></h2> <div id="qunit-testrunner-toolbar"></div> <h2 id="qunit-userAgent"></h2> <ol id="qunit-tests"></ol> <div id="qunit-fixture">test markup, will be hidden</div> <script type="text/javascript" src="http://code.jquery.com/jquery-latest.js"></script> <script type="text/javascript" src="http://github.com/jquery/qunit/raw/master/qunit/qunit.js"></script> <script type="text/javascript"> // The function to test function addNumbers(a, b) { return a+b; } // The unit test test("Test of addNumbers", function () { equals(4, addNumbers(1,3), "1+3 should be 4"); }); </script> </body> </html> This test verifies that calling addNumbers(1,3) returns the expected value 4. When you open this page in a browser, you can see that this test does, in fact, pass. The idea is that you can quickly refresh this QUnit HTML JavaScript test driver page in your browser whenever you modify your JavaScript code. In other words, you can keep a browser window open and keep refreshing it over and over while you are developing your application. That way, you can know very quickly whenever you have broken your JavaScript code. While easy to setup, there are several big disadvantages to this approach to executing JavaScript unit tests: You must view your JavaScript unit test results in a different location than your server unit test results. The JavaScript unit test results appear in the browser and the server unit test results appear in the Visual Studio Test Results window. Because all of your unit test results don’t appear in a single location, you are more likely to introduce bugs into your code without noticing it. Because your unit tests are not integrated with Visual Studio – in particular, MS Test -- you cannot easily include your JavaScript unit tests when setting up check-in policies or when performing automated builds with Team Build. A more sophisticated approach to using a browser as a test-driver is to automate the web browser. Instead of launching the browser and loading the test code yourself, you use a framework to automate this process. There are several different testing frameworks that support this approach: · Selenium – Selenium is a very powerful framework for automating browser tests. You can create your tests by recording a Firefox session or by writing the test driver code in server code such as C#. You can learn more about Selenium at http://seleniumhq.org/. LTAF – The ASP.NET team uses the Lightweight Test Automation Framework to test JavaScript code in the ASP.NET framework. You can learn more about LTAF by visiting the project home at CodePlex: http://aspnet.codeplex.com/releases/view/35501 jsTestDriver – This framework uses Java to automate the browser. jsTestDriver creates a server which can be used to automate multiple browsers simultaneously. This project is located at http://code.google.com/p/js-test-driver/ TestSwam – This framework, created by John Resig, uses PHP to automate the browser. Like jsTestDriver, the framework creates a test server. You can open multiple browsers that are automated by the test server. Learn more about TestSwarm by visiting the following address: https://github.com/jeresig/testswarm/wiki Yeti – This is the framework introduced by Yahoo for automating browser tests. Yeti uses server-side JavaScript and depends on Node.js. Learn more about Yeti at http://www.yuiblog.com/blog/2010/08/25/introducing-yeti-the-yui-easy-testing-interface/ All of these frameworks are great for integration tests – however, they are not the best frameworks to use for unit tests. In one way or another, all of these frameworks depend on executing tests within the context of a “living and breathing” browser. If you create an ASP.NET Unit Test then Visual Studio will launch a web server before executing the unit test. Why is launching a web server so bad? It is not the worst thing in the world. However, it does introduce dependencies that prevent your code from being tested in isolation. One of the defining features of a unit test -- versus an integration test – is that a unit test tests code in isolation. Another problem with launching a web server when performing unit tests is that launching a web server can be slow. If you cannot execute your unit tests quickly, you are less likely to execute your unit tests each and every time you make a code change. You are much more likely to fall into the pit of failure. Launching a browser when performing a JavaScript unit test has all of the same disadvantages as launching a web server when performing an ASP.NET unit test. Instead of testing a unit of JavaScript code in isolation, you are testing JavaScript code within the context of a particular browser. Using the frameworks listed above for integration tests makes perfect sense. However, I want to consider a different approach for creating unit tests for JavaScript code. Using Server-Side JavaScript for JavaScript Unit Tests A completely different approach to executing JavaScript unit tests is to perform the tests outside of any browser. If you really want to test JavaScript then you should test JavaScript and leave the browser out of the testing process. There are several ways that you can execute JavaScript on the server outside the context of any browser: Rhino – Rhino is an implementation of JavaScript written in Java. The Rhino project is maintained by the Mozilla project. Learn more about Rhino at http://www.mozilla.org/rhino/ V8 – V8 is the open-source Google JavaScript engine written in C++. This is the JavaScript engine used by the Chrome web browser. You can download V8 and embed it in your project by visiting http://code.google.com/p/v8/ JScript – JScript is the JavaScript Script Engine used by Internet Explorer (up to but not including Internet Explorer 9), Windows Script Host, and Active Server Pages. Internet Explorer is still the most popular web browser. Therefore, I decided to focus on using the JScript Script Engine to execute JavaScript unit tests. Using the Microsoft Script Control There are two basic ways that you can pass JavaScript to the JScript Script Engine and execute the code: use the Microsoft Windows Script Interfaces or use the Microsoft Script Control. The difficult and proper way to execute JavaScript using the JScript Script Engine is to use the Microsoft Windows Script Interfaces. You can learn more about the Script Interfaces by visiting http://msdn.microsoft.com/en-us/library/t9d4xf28(VS.85).aspx The main disadvantage of using the Script Interfaces is that they are difficult to use from .NET. There is a great series of articles on using the Script Interfaces from C# located at http://www.drdobbs.com/184406028. I picked the easier alternative and used the Microsoft Script Control. The Microsoft Script Control is an ActiveX control that provides a higher level abstraction over the Window Script Interfaces. You can download the Microsoft Script Control from here: http://www.microsoft.com/downloads/en/details.aspx?FamilyID=d7e31492-2595-49e6-8c02-1426fec693ac After you download the Microsoft Script Control, you need to add a reference to it to your project. Select the Visual Studio menu option Project, Add Reference to open the Add Reference dialog. Select the COM tab and add the Microsoft Script Control 1.0. Using the Script Control is easy. You call the Script Control AddCode() method to add JavaScript code to the Script Engine. Next, you call the Script Control Run() method to run a particular JavaScript function. The reference documentation for the Microsoft Script Control is located at the MSDN website: http://msdn.microsoft.com/en-us/library/aa227633%28v=vs.60%29.aspx Creating the JavaScript Code to Test To keep things simple, let’s imagine that you want to test the following JavaScript function named addNumbers() which simply adds two numbers together: MvcApplication1\Scripts\Math.js function addNumbers(a, b) { return 5; } Notice that the addNumbers() method always returns the value 5. Right-now, it will not pass a good unit test. Create this file and save it in your project with the name Math.js in your MVC project’s Scripts folder (Save the file in your actual MVC application and not your MVC test application). Creating the JavaScript Test Helper Class To make it easier to use the Microsoft Script Control in unit tests, we can create a helper class. This class contains two methods: LoadFile() – Loads a JavaScript file. Use this method to load the JavaScript file being tested or the JavaScript file containing the unit tests. ExecuteTest() – Executes the JavaScript code. Use this method to execute a JavaScript unit test. Here’s the code for the JavaScriptTestHelper class: JavaScriptTestHelper.cs   using System; using System.IO; using Microsoft.VisualStudio.TestTools.UnitTesting; using MSScriptControl; namespace MvcApplication1.Tests { public class JavaScriptTestHelper : IDisposable { private ScriptControl _sc; private TestContext _context; /// <summary> /// You need to use this helper with Unit Tests and not /// Basic Unit Tests because you need a Test Context /// </summary> /// <param name="testContext">Unit Test Test Context</param> public JavaScriptTestHelper(TestContext testContext) { if (testContext == null) { throw new ArgumentNullException("TestContext"); } _context = testContext; _sc = new ScriptControl(); _sc.Language = "JScript"; _sc.AllowUI = false; } /// <summary> /// Load the contents of a JavaScript file into the /// Script Engine. /// </summary> /// <param name="path">Path to JavaScript file</param> public void LoadFile(string path) { var fileContents = File.ReadAllText(path); _sc.AddCode(fileContents); } /// <summary> /// Pass the path of the test that you want to execute. /// </summary> /// <param name="testMethodName">JavaScript function name</param> public void ExecuteTest(string testMethodName) { dynamic result = null; try { result = _sc.Run(testMethodName, new object[] { }); } catch { var error = ((IScriptControl)_sc).Error; if (error != null) { var description = error.Description; var line = error.Line; var column = error.Column; var text = error.Text; var source = error.Source; if (_context != null) { var details = String.Format("{0} \r\nLine: {1} Column: {2}", source, line, column); _context.WriteLine(details); } } throw new AssertFailedException(error.Description); } } public void Dispose() { _sc = null; } } }     Notice that the JavaScriptTestHelper class requires a Test Context to be instantiated. For this reason, you can use the JavaScriptTestHelper only with a Visual Studio Unit Test and not a Basic Unit Test (These are two different types of Visual Studio project items). Add the JavaScriptTestHelper file to your MVC test application (for example, MvcApplication1.Tests). Creating the JavaScript Unit Test Next, we need to create the JavaScript unit test function that we will use to test the addNumbers() function. Create a folder in your MVC test project named JavaScriptTests and add the following JavaScript file to this folder: MvcApplication1.Tests\JavaScriptTests\MathTest.js /// <reference path="JavaScriptUnitTestFramework.js"/> function testAddNumbers() { // Act var result = addNumbers(1, 3); // Assert assert.areEqual(4, result, "addNumbers did not return right value!"); }   The testAddNumbers() function takes advantage of another JavaScript library named JavaScriptUnitTestFramework.js. This library contains all of the code necessary to make assertions. Add the following JavaScriptnitTestFramework.js to the same folder as the MathTest.js file: MvcApplication1.Tests\JavaScriptTests\JavaScriptUnitTestFramework.js var assert = { areEqual: function (expected, actual, message) { if (expected !== actual) { throw new Error("Expected value " + expected + " is not equal to " + actual + ". " + message); } } }; There is only one type of assertion supported by this file: the areEqual() assertion. Most likely, you would want to add additional types of assertions to this file to make it easier to write your JavaScript unit tests. Deploying the JavaScript Test Files This step is non-intuitive. When you use Visual Studio to run unit tests, Visual Studio creates a new folder and executes a copy of the files in your project. After you run your unit tests, your Visual Studio Solution will contain a new folder named TestResults that includes a subfolder for each test run. You need to configure Visual Studio to deploy your JavaScript files to the test run folder or Visual Studio won’t be able to find your JavaScript files when you execute your unit tests. You will get an error that looks something like this when you attempt to execute your unit tests: You can configure Visual Studio to deploy your JavaScript files by adding a Test Settings file to your Visual Studio Solution. It is important to understand that you need to add this file to your Visual Studio Solution and not a particular Visual Studio project. Right-click your Solution in the Solution Explorer window and select the menu option Add, New Item. Select the Test Settings item and click the Add button. After you create a Test Settings file for your solution, you can indicate that you want a particular folder to be deployed whenever you perform a test run. Select the menu option Test, Edit Test Settings to edit your test configuration file. Select the Deployment tab and select your MVC test project’s JavaScriptTest folder to deploy. Click the Apply button and the Close button to save the changes and close the dialog. Creating the Visual Studio Unit Test The very last step is to create the Visual Studio unit test (the MS Test unit test). Add a new unit test to your MVC test project by selecting the menu option Add New Item and selecting the Unit Test project item (Do not select the Basic Unit Test project item): The difference between a Basic Unit Test and a Unit Test is that a Unit Test includes a Test Context. We need this Test Context to use the JavaScriptTestHelper class that we created earlier. Enter the following test method for the new unit test: [TestMethod] public void TestAddNumbers() { var jsHelper = new JavaScriptTestHelper(this.TestContext); // Load JavaScript files jsHelper.LoadFile("JavaScriptUnitTestFramework.js"); jsHelper.LoadFile(@"..\..\..\MvcApplication1\Scripts\Math.js"); jsHelper.LoadFile("MathTest.js"); // Execute JavaScript Test jsHelper.ExecuteTest("testAddNumbers"); } This code uses the JavaScriptTestHelper to load three files: JavaScripUnitTestFramework.js – Contains the assert functions. Math.js – Contains the addNumbers() function from your MVC application which is being tested. MathTest.js – Contains the JavaScript unit test function. Next, the test method calls the JavaScriptTestHelper ExecuteTest() method to execute the testAddNumbers() JavaScript function. Running the Visual Studio JavaScript Unit Test After you complete all of the steps described above, you can execute the JavaScript unit test just like any other unit test. You can use the keyboard combination CTRL-R, CTRL-A to run all of the tests in the current Visual Studio Solution. Alternatively, you can use the buttons in the Visual Studio toolbar to run the tests: (Unfortunately, the Run All Impacted Tests button won’t work correctly because Visual Studio won’t detect that your JavaScript code has changed. Therefore, you should use either the Run Tests in Current Context or Run All Tests in Solution options instead.) The results of running the JavaScript tests appear side-by-side with the results of running the server tests in the Test Results window. For example, if you Run All Tests in Solution then you will get the following results: Notice that the TestAddNumbers() JavaScript test has failed. That is good because our addNumbers() function is hard-coded to always return the value 5. If you double-click the failing JavaScript test, you can view additional details such as the JavaScript error message and the line number of the JavaScript code that failed: Summary The goal of this blog entry was to explain an approach to creating JavaScript unit tests that can be easily integrated with Visual Studio and Visual Studio ALM. I described how you can use the Microsoft Script Control to execute JavaScript on the server. By taking advantage of the Microsoft Script Control, we were able to execute our JavaScript unit tests side-by-side with all of our other unit tests and view the results in the standard Visual Studio Test Results window. You can download the code discussed in this blog entry from here: http://StephenWalther.com/downloads/Blog/JavaScriptUnitTesting/JavaScriptUnitTests.zip Before running this code, you need to first install the Microsoft Script Control which you can download from here: http://www.microsoft.com/downloads/en/details.aspx?FamilyID=d7e31492-2595-49e6-8c02-1426fec693ac

    Read the article

  • WCF WS-Security and WSE Nonce Authentication

    - by Rick Strahl
    WCF makes it fairly easy to access WS-* Web Services, except when you run into a service format that it doesn't support. Even then WCF provides a huge amount of flexibility to make the service clients work, however finding the proper interfaces to make that happen is not easy to discover and for the most part undocumented unless you're lucky enough to run into a blog, forum or StackOverflow post on the matter. This is definitely true for the Password Nonce as part of the WS-Security/WSE protocol, which is not natively supported in WCF. Specifically I had a need to create a WCF message on the client that includes a WS-Security header that looks like this from their spec document:<soapenv:Header> <wsse:Security soapenv:mustUnderstand="1" xmlns:wsse="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <wsse:UsernameToken wsu:Id="UsernameToken-8" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> <wsse:Username>TeStUsErNaMe1</wsse:Username> <wsse:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText" >TeStPaSsWoRd1</wsse:Password> <wsse:Nonce EncodingType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary" >f8nUe3YupTU5ISdCy3X9Gg==</wsse:Nonce> <wsu:Created>2011-05-04T19:01:40.981Z</wsu:Created> </wsse:UsernameToken> </wsse:Security> </soapenv:Header> Specifically, the Nonce and Created keys are what WCF doesn't create or have a built in formatting for. Why is there a nonce? My first thought here was WTF? The username and password are there in clear text, what does the Nonce accomplish? The Nonce and created keys are are part of WSE Security specification and are meant to allow the server to detect and prevent replay attacks. The hashed nonce should be unique per request which the server can store and check for before running another request thus ensuring that a request is not replayed with exactly the same values. Basic ServiceUtl Import - not much Luck The first thing I did when I imported this service with a service reference was to simply import it as a Service Reference. The Add Service Reference import automatically detects that WS-Security is required and appropariately adds the WS-Security to the basicHttpBinding in the config file:<?xml version="1.0" encoding="utf-8" ?> <configuration> <system.serviceModel> <bindings> <basicHttpBinding> <binding name="RealTimeOnlineSoapBinding"> <security mode="Transport" /> </binding> <binding name="RealTimeOnlineSoapBinding1" /> </basicHttpBinding> </bindings> <client> <endpoint address="https://notarealurl.com:443/services/RealTimeOnline" binding="basicHttpBinding" bindingConfiguration="RealTimeOnlineSoapBinding" contract="RealTimeOnline.RealTimeOnline" name="RealTimeOnline" /> </client> </system.serviceModel> </configuration> If if I run this as is using code like this:var client = new RealTimeOnlineClient(); client.ClientCredentials.UserName.UserName = "TheUsername"; client.ClientCredentials.UserName.Password = "ThePassword"; … I get nothing in terms of WS-Security headers. The request is sent, but the the binding expects transport level security to be applied, rather than message level security. To fix this so that a WS-Security message header is sent the security mode can be changed to: <security mode="TransportWithMessageCredential" /> Now if I re-run I at least get a WS-Security header which looks like this:<s:Envelope xmlns:s="http://schemas.xmlsoap.org/soap/envelope/" xmlns:u="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> <s:Header> <o:Security s:mustUnderstand="1" xmlns:o="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <u:Timestamp u:Id="_0"> <u:Created>2012-11-24T02:55:18.011Z</u:Created> <u:Expires>2012-11-24T03:00:18.011Z</u:Expires> </u:Timestamp> <o:UsernameToken u:Id="uuid-18c215d4-1106-40a5-8dd1-c81fdddf19d3-1"> <o:Username>TheUserName</o:Username> <o:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText" >ThePassword</o:Password> </o:UsernameToken> </o:Security> </s:Header> Closer! Now the WS-Security header is there along with a timestamp field (which might not be accepted by some WS-Security expecting services), but there's no Nonce or created timestamp as required by my original service. Using a CustomBinding instead My next try was to go with a CustomBinding instead of basicHttpBinding as it allows a bit more control over the protocol and transport configurations for the binding. Specifically I can explicitly specify the message protocol(s) used. Using configuration file settings here's what the config file looks like:<?xml version="1.0"?> <configuration> <system.serviceModel> <bindings> <customBinding> <binding name="CustomSoapBinding"> <security includeTimestamp="false" authenticationMode="UserNameOverTransport" defaultAlgorithmSuite="Basic256" requireDerivedKeys="false" messageSecurityVersion="WSSecurity10WSTrustFebruary2005WSSecureConversationFebruary2005WSSecurityPolicy11BasicSecurityProfile10"> </security> <textMessageEncoding messageVersion="Soap11"></textMessageEncoding> <httpsTransport maxReceivedMessageSize="2000000000"/> </binding> </customBinding> </bindings> <client> <endpoint address="https://notrealurl.com:443/services/RealTimeOnline" binding="customBinding" bindingConfiguration="CustomSoapBinding" contract="RealTimeOnline.RealTimeOnline" name="RealTimeOnline" /> </client> </system.serviceModel> <startup> <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.0"/> </startup> </configuration> This ends up creating a cleaner header that's missing the timestamp field which can cause some services problems. The WS-Security header output generated with the above looks like this:<s:Header> <o:Security s:mustUnderstand="1" xmlns:o="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <o:UsernameToken u:Id="uuid-291622ca-4c11-460f-9886-ac1c78813b24-1"> <o:Username>TheUsername</o:Username> <o:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText" >ThePassword</o:Password> </o:UsernameToken> </o:Security> </s:Header> This is closer as it includes only the username and password. The key here is the protocol for WS-Security:messageSecurityVersion="WSSecurity10WSTrustFebruary2005WSSecureConversationFebruary2005WSSecurityPolicy11BasicSecurityProfile10" which explicitly specifies the protocol version. There are several variants of this specification but none of them seem to support the nonce unfortunately. This protocol does allow for optional omission of the Nonce and created timestamp provided (which effectively makes those keys optional). With some services I tried that requested a Nonce just using this protocol actually worked where the default basicHttpBinding failed to connect, so this is a possible solution for access to some services. Unfortunately for my target service that was not an option. The nonce has to be there. Creating Custom ClientCredentials As it turns out WCF doesn't have support for the Digest Nonce as part of WS-Security, and so as far as I can tell there's no way to do it just with configuration settings. I did a bunch of research on this trying to find workarounds for this, and I did find a couple of entries on StackOverflow as well as on the MSDN forums. However, none of these are particularily clear and I ended up using bits and pieces of several of them to arrive at a working solution in the end. http://stackoverflow.com/questions/896901/wcf-adding-nonce-to-usernametoken http://social.msdn.microsoft.com/Forums/en-US/wcf/thread/4df3354f-0627-42d9-b5fb-6e880b60f8ee The latter forum message is the more useful of the two (the last message on the thread in particular) and it has most of the information required to make this work. But it took some experimentation for me to get this right so I'll recount the process here maybe a bit more comprehensively. In order for this to work a number of classes have to be overridden: ClientCredentials ClientCredentialsSecurityTokenManager WSSecurityTokenizer The idea is that we need to create a custom ClientCredential class to hold the custom properties so they can be set from the UI or via configuration settings. The TokenManager and Tokenizer are mainly required to allow the custom credentials class to flow through the WCF pipeline and eventually provide custom serialization. Here are the three classes required and their full implementations:public class CustomCredentials : ClientCredentials { public CustomCredentials() { } protected CustomCredentials(CustomCredentials cc) : base(cc) { } public override System.IdentityModel.Selectors.SecurityTokenManager CreateSecurityTokenManager() { return new CustomSecurityTokenManager(this); } protected override ClientCredentials CloneCore() { return new CustomCredentials(this); } } public class CustomSecurityTokenManager : ClientCredentialsSecurityTokenManager { public CustomSecurityTokenManager(CustomCredentials cred) : base(cred) { } public override System.IdentityModel.Selectors.SecurityTokenSerializer CreateSecurityTokenSerializer(System.IdentityModel.Selectors.SecurityTokenVersion version) { return new CustomTokenSerializer(System.ServiceModel.Security.SecurityVersion.WSSecurity11); } } public class CustomTokenSerializer : WSSecurityTokenSerializer { public CustomTokenSerializer(SecurityVersion sv) : base(sv) { } protected override void WriteTokenCore(System.Xml.XmlWriter writer, System.IdentityModel.Tokens.SecurityToken token) { UserNameSecurityToken userToken = token as UserNameSecurityToken; string tokennamespace = "o"; DateTime created = DateTime.Now; string createdStr = created.ToString("yyyy-MM-ddThh:mm:ss.fffZ"); // unique Nonce value - encode with SHA-1 for 'randomness' // in theory the nonce could just be the GUID by itself string phrase = Guid.NewGuid().ToString(); var nonce = GetSHA1String(phrase); // in this case password is plain text // for digest mode password needs to be encoded as: // PasswordAsDigest = Base64(SHA-1(Nonce + Created + Password)) // and profile needs to change to //string password = GetSHA1String(nonce + createdStr + userToken.Password); string password = userToken.Password; writer.WriteRaw(string.Format( "<{0}:UsernameToken u:Id=\"" + token.Id + "\" xmlns:u=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd\">" + "<{0}:Username>" + userToken.UserName + "</{0}:Username>" + "<{0}:Password Type=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText\">" + password + "</{0}:Password>" + "<{0}:Nonce EncodingType=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary\">" + nonce + "</{0}:Nonce>" + "<u:Created>" + createdStr + "</u:Created></{0}:UsernameToken>", tokennamespace)); } protected string GetSHA1String(string phrase) { SHA1CryptoServiceProvider sha1Hasher = new SHA1CryptoServiceProvider(); byte[] hashedDataBytes = sha1Hasher.ComputeHash(Encoding.UTF8.GetBytes(phrase)); return Convert.ToBase64String(hashedDataBytes); } } Realistically only the CustomTokenSerializer has any significant code in. The code there deals with actually serializing the custom credentials using low level XML semantics by writing output into an XML writer. I can't take credit for this code - most of the code comes from the MSDN forum post mentioned earlier - I made a few adjustments to simplify the nonce generation and also added some notes to allow for PasswordDigest generation. Per spec the nonce is nothing more than a unique value that's supposed to be 'random'. I'm thinking that this value can be any string that's unique and a GUID on its own probably would have sufficed. Comments on other posts that GUIDs can be potentially guessed are highly exaggerated to say the least IMHO. To satisfy even that aspect though I added the SHA1 encryption and binary decoding to give a more random value that would be impossible to 'guess'. The original example from the forum post used another level of encoding and decoding to string in between - but that really didn't accomplish anything but extra overhead. The header output generated from this looks like this:<s:Header> <o:Security s:mustUnderstand="1" xmlns:o="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <o:UsernameToken u:Id="uuid-f43d8b0d-0ebb-482e-998d-f544401a3c91-1" xmlns:u="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> <o:Username>TheUsername</o:Username> <o:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText">ThePassword</o:Password> <o:Nonce EncodingType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary" >PjVE24TC6HtdAnsf3U9c5WMsECY=</o:Nonce> <u:Created>2012-11-23T07:10:04.670Z</u:Created> </o:UsernameToken> </o:Security> </s:Header> which is exactly as it should be. Password Digest? In my case the password is passed in plain text over an SSL connection, so there's no digest required so I was done with the code above. Since I don't have a service handy that requires a password digest,  I had no way of testing the code for the digest implementation, but here is how this is likely to work. If you need to pass a digest encoded password things are a little bit trickier. The password type namespace needs to change to: http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#Digest and then the password value needs to be encoded. The format for password digest encoding is this: Base64(SHA-1(Nonce + Created + Password)) and it can be handled in the code above with this code (that's commented in the snippet above): string password = GetSHA1String(nonce + createdStr + userToken.Password); The entire WriteTokenCore method for digest code looks like this:protected override void WriteTokenCore(System.Xml.XmlWriter writer, System.IdentityModel.Tokens.SecurityToken token) { UserNameSecurityToken userToken = token as UserNameSecurityToken; string tokennamespace = "o"; DateTime created = DateTime.Now; string createdStr = created.ToString("yyyy-MM-ddThh:mm:ss.fffZ"); // unique Nonce value - encode with SHA-1 for 'randomness' // in theory the nonce could just be the GUID by itself string phrase = Guid.NewGuid().ToString(); var nonce = GetSHA1String(phrase); string password = GetSHA1String(nonce + createdStr + userToken.Password); writer.WriteRaw(string.Format( "<{0}:UsernameToken u:Id=\"" + token.Id + "\" xmlns:u=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd\">" + "<{0}:Username>" + userToken.UserName + "</{0}:Username>" + "<{0}:Password Type=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#Digest\">" + password + "</{0}:Password>" + "<{0}:Nonce EncodingType=\"http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary\">" + nonce + "</{0}:Nonce>" + "<u:Created>" + createdStr + "</u:Created></{0}:UsernameToken>", tokennamespace)); } I had no service to connect to to try out Digest auth - if you end up needing it and get it to work please drop a comment… How to use the custom Credentials The easiest way to use the custom credentials is to create the client in code. Here's a factory method I use to create an instance of my service client:  public static RealTimeOnlineClient CreateRealTimeOnlineProxy(string url, string username, string password) { if (string.IsNullOrEmpty(url)) url = "https://notrealurl.com:443/cows/services/RealTimeOnline"; CustomBinding binding = new CustomBinding(); var security = TransportSecurityBindingElement.CreateUserNameOverTransportBindingElement(); security.IncludeTimestamp = false; security.DefaultAlgorithmSuite = SecurityAlgorithmSuite.Basic256; security.MessageSecurityVersion = MessageSecurityVersion.WSSecurity10WSTrustFebruary2005WSSecureConversationFebruary2005WSSecurityPolicy11BasicSecurityProfile10; var encoding = new TextMessageEncodingBindingElement(); encoding.MessageVersion = MessageVersion.Soap11; var transport = new HttpsTransportBindingElement(); transport.MaxReceivedMessageSize = 20000000; // 20 megs binding.Elements.Add(security); binding.Elements.Add(encoding); binding.Elements.Add(transport); RealTimeOnlineClient client = new RealTimeOnlineClient(binding, new EndpointAddress(url)); // to use full client credential with Nonce uncomment this code: // it looks like this might not be required - the service seems to work without it client.ChannelFactory.Endpoint.Behaviors.Remove<System.ServiceModel.Description.ClientCredentials>(); client.ChannelFactory.Endpoint.Behaviors.Add(new CustomCredentials()); client.ClientCredentials.UserName.UserName = username; client.ClientCredentials.UserName.Password = password; return client; } This returns a service client that's ready to call other service methods. The key item in this code is the ChannelFactory endpoint behavior modification that that first removes the original ClientCredentials and then adds the new one. The ClientCredentials property on the client is read only and this is the way it has to be added.   Summary It's a bummer that WCF doesn't suport WSE Security authentication with nonce values out of the box. From reading the comments in posts/articles while I was trying to find a solution, I found that this feature was omitted by design as this protocol is considered unsecure. While I agree that plain text passwords are rarely a good idea even if they go over secured SSL connection as WSE Security does, there are unfortunately quite a few services (mosly Java services I suspect) that use this protocol. I've run into this twice now and trying to find a solution online I can see that this is not an isolated problem - many others seem to have struggled with this. It seems there are about a dozen questions about this on StackOverflow all with varying incomplete answers. Hopefully this post provides a little more coherent content in one place. Again I marvel at WCF and its breadth of support for protocol features it has in a single tool. And even when it can't handle something there are ways to get it working via extensibility. But at the same time I marvel at how freaking difficult it is to arrive at these solutions. I mean there's no way I could have ever figured this out on my own. It takes somebody working on the WCF team or at least being very, very intricately involved in the innards of WCF to figure out the interconnection of the various objects to do this from scratch. Luckily this is an older problem that has been discussed extensively online and I was able to cobble together a solution from the online content. I'm glad it worked out that way, but it feels dirty and incomplete in that there's a whole learning path that was omitted to get here… Man am I glad I'm not dealing with SOAP services much anymore. REST service security - even when using some sort of federation is a piece of cake by comparison :-) I'm sure once standards bodies gets involved we'll be right back in security standard hell…© Rick Strahl, West Wind Technologies, 2005-2012Posted in WCF  Web Services   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • E-Business Suite Technology Sessions at OpenWorld 2012

    - by Max Arderius
    Oracle OpenWorld 2012 is almost here! We're looking forward to updating you on our products, strategy, and roadmaps. This year, the E-Business Suite Applications Technology Group (ATG) will participate in 25 speaker sessions, two Meet the Experts round-table discussions, five demoground booths and seven Special Interest Group meetings as guest speakers. We hope to see you at our sessions.  Please join us to hear the latest news and connect with senior ATG development staff. Here's a downloadable listing of all Applications Technology Group-related sessions with times and locations: FOCUS ON Oracle E-Business Suite - Applications Tools and Technology (PDF) General Sessions GEN8474 - Oracle E-Business Suite - Strategy, Update, and RoadmapCliff Godwin, SVP, Oracle Monday, Oct 1, 12:15 PM - 1:15 PM - Moscone West 2002/2004 In this session, hear Oracle E-Business Suite General Manager Cliff Godwin deliver an update on the Oracle E-Business Suite product line. This session covers the value delivered by the current release of Oracle E-Business Suite, the momentum, and how Oracle E-Business Suite applications integrate into Oracle’s overall applications strategy. You’ll come away with an understanding of the value Oracle E-Business Suite applications deliver now and will deliver in the future. GEN9173 - Optimize and Extend Oracle Applications - The Path to Oracle Fusion ApplicationsNadia Bendjedou, Oracle; Corre Curtice, Bhavish Madurai (CSC) Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 3002/3004 One of the main objectives of this session is to help organizations build their IT roadmap for the next five years and be aligned with the Oracle Applications strategy in general and the Oracle Fusion Applications strategy in particular. Come hear about some of the common sense, practical steps you can take to optimize the performance of your Oracle Applications today and prepare your path to Oracle Fusion Applications for when your organization is ready to embrace them. Each step you take in adopting Oracle Fusion technology gets you partway to Oracle Fusion Applications. Conference Sessions CON9024 - Oracle E-Business Suite Technology: Latest Features and Roadmap Lisa Parekh, Oracle Monday, Oct 1, 10:45 AM - 11:45 AM - Moscone West 2016 This Oracle development session provides a comprehensive overview of Oracle’s product strategy for Oracle E-Business Suite technology, the capabilities and associated business benefits of recent releases, and a review of capabilities on the product roadmap. This is the cornerstone session for the Oracle E-Business Suite technology stack. Come hear about the latest new usability enhancements of the user interface; systems administration and configuration management tools; security-related updates; and tools and options for extending, customizing, and integrating Oracle E-Business Suite with other applications. CON9021 - Oracle E-Business Suite Future Directions: Deployment and System AdministrationMax Arderius, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2016  What’s coming in the next major version of Oracle E-Business Suite 12? This Oracle Development session covers the latest technology stack, including the use of Oracle WebLogic Server (Oracle Fusion Middleware 11g) and Oracle Database 11g Release 2 (11.2). Topics include an architectural overview of the latest updates, installation and upgrade options, new configuration options, and new tools for hot cloning and automated “lights-out” cloning. Come learn how online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature) will reduce your database patching downtimes to however long it takes to bounce your database server. CON9017 - Desktop Integration in Oracle E-Business Suite 12.1 Padmaprabodh Ambale, Gustavo Jimenez, Oracle Monday, Oct 1, 4:45 PM - 5:45 PM - Moscone West 2016 This presentation covers the latest functional enhancements in Oracle Web Applications Desktop Integrator and Oracle Report Manager, enhanced Microsoft Office support, and greater support for building custom desktop integration solutions. The session also presents tips and tricks for upgrading from Oracle Applications Desktop Integrator to Oracle Web Applications Desktop Integrator and Oracle Report Manager. CON9023 - Oracle E-Business Suite Technology Certification Primer and Roadmap Steven Chan, Oracle Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 2016  Is your Oracle E-Business Suite technology stack up to date? Are you taking advantage of all the latest options and capabilities? This Oracle development session summarizes the latest certifications and roadmap for the Oracle E-Business Suite technology stack, including elements such as database releases and options, Java, Oracle Forms, Oracle Containers for J2EE, desktop operating systems, browsers, JRE releases, development and Web authoring tools, user authentication and management, business intelligence, Oracle Application Management Packs, security options, clouds, Oracle VM, and virtualization. The session also covers the most commonly asked questions about tech stack component support dates and upgrade implications. CON9028 - Minimizing Oracle E-Business Suite Maintenance DowntimesSantiago Bastidas, Elke Phelps, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2016 This Oracle development session features a survey of the best techniques sysadmins can use to minimize patching downtimes. It starts with an architectural-level review of Oracle E-Business Suite fundamentals and then moves to a practical view of the various tools and approaches for downtimes. Topics include patching shortcuts, merging patches, distributing worker processes across multiple servers, running ADPatch in noninteractive mode, staged APPL_TOPs, shared file systems, deferring systemwide database tasks, avoiding resource bottlenecks, and more. An added bonus: hear about the upcoming Oracle E-Business Suite 12 online patching capabilities based on the groundbreaking Oracle Database 11g Release 2 Edition-Based Redefinition feature. CON9116 - Extending the Use of Oracle E-Business Suite with the Oracle Endeca PlatformOsama Elkady, Muhannad Obeidat, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2018 The Oracle Endeca platform includes a leading unstructured data correlation and analytics engine, together with a best-in class catalog search and guided navigation solution, to improve the productivity of all types of users in your enterprise. This development session focuses on the details behind the Oracle Endeca platform’s integration into Oracle E-Business Suite. It demonstrates how easily you can extend the use of the Oracle Endeca platform into other areas of Oracle E-Business Suite and how you can bring in your own data and build new Oracle Endeca applications for Oracle E-Business Suite. CON9005 - Oracle E-Business Suite Integration Best PracticesVeshaal Singh, Oracle, Jeffrey Hand, Zebra Technologies Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2018 Oracle is investing across applications and technologies to make the application integration experience easier for customers. Today Oracle has certified Oracle E-Business Suite on Oracle Fusion Middleware 11g and provides a comprehensive set of integration technologies. Learn about Oracle’s integration offering across data- and process-centric integrations. These technologies can be used to address various application integration challenges and styles. In this session, you will get an understanding of how, when, and where you can leverage Oracle’s integration technologies to connect end-to-end business processes across your enterprise, including your Oracle Applications portfolio.  CON9026 - Latest Oracle E-Business Suite 12.1 User Interface and Usability EnhancementsPadmaprabodh Ambale, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2016 This Oracle development session details the latest UI enhancements to Oracle Application Framework in Oracle E-Business Suite 12.1. Developers will get a detailed look at new features to enhance usability, offer more capabilities for personalization and extensions, and support the development and use of dashboards and Web services. Topics include new rich UI capabilities such as new home page features, Navigator and Favorites pull-down menus, REST interface, embedded widgets for analytics content, Oracle Application Development Framework (Oracle ADF) task flows, third-party widgets, a look-ahead list of values, inline attachments, pop-ups, personalization and extensibility enhancements, business layer extensions, Oracle ADF integration, and mobile devices. CON8805 - Planning Your Oracle E-Business Suite Upgrade from 11i to Release 12.1 and BeyondAnne Carlson, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 3002/3004 Attend this session to hear the latest Oracle E-Business Suite 12.1 upgrade planning tips from Oracle’s support, consulting, development, and IT organizations. You’ll get specific cross-product advice on how to understand the factors that affect your project’s duration, decide on your project’s scope, develop a robust testing strategy, leverage Oracle Support resources, and more. In a nutshell, this session tells you things you need to know before embarking upon your Release 12.1 upgrade project. CON9053 - Advanced Management of Oracle E-Business Suite with Oracle Enterprise ManagerAngelo Rosado, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 2016 The task of managing and monitoring Oracle E-Business Suite environments can be very challenging. Oracle Enterprise Manager is the only product on the market that is designed to monitor and manage all the different technologies that constitute Oracle E-Business Suite applications, including end user, midtier, configuration, host, and database management—to name just a few. Customers that have implemented Oracle Enterprise Manager have experienced dramatic improvements in system visibility and diagnostic capability as well as administrator productivity. The purpose of this session is to highlight the key features and benefits of Oracle Enterprise Manager and Oracle Application Management Suite for Oracle E-Business Suite. CON8809 - Oracle E-Business Suite 12.1 Upgrade Best Practices: Technical InsightIsam Alyousfi, Udayan Parvate, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3011 This session is ideal for organizations thinking about upgrading to Oracle E-Business Suite 12.1. It covers the fundamentals of upgrading to Release 12.1, including the technology stack components and supported upgrade paths. Hear from Oracle Development about the set of best practices for patching in general and executing the Release 12.1 technical upgrade, with special considerations for minimizing your downtime. Also get to know about relatively recent upgrade resources. CON9032 - Upgrading Your Customizations of Oracle E-Business Suite 12.1Sara Woodhull, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2016 Have you personalized Oracle Forms or Oracle Application Framework screens in Oracle E-Business Suite? Have you used mod_plsql in Release 11i? Have you extended or customized your Release 11i environment with other tools? The technical options for upgrading these customizations as part of your Oracle E-Business Suite Release 12.1 upgrade can be bewildering. Come to this Oracle development session to learn about selecting the best upgrade approach for your existing customizations. The session will help you understand customization scenarios and use cases, tools, and technologies to ensure that your Oracle E-Business Suite Release 12.1 environment fits your users’ needs closely and that any future customizations will be easy to upgrade. CON9259 - Oracle E-Business Suite Internationalization and Multilingual FeaturesMaher Al-Nubani, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2018 Oracle E-Business Suite supports more countries, languages, and regions than ever. Come to this Oracle development session to get an overview of internationalization features and capabilities and see new Release 12 features such as calendar support for Hijra and Thai, new group separators, lightweight multilingual support (MLS) setup, new character sets such as AL32UTF, newly supported languages, Mac certifications, Oracle iSetup support for moving MLS setups, new file export options for Unicode, new MLS number spelling options, and more. CON7188 - Mobile Apps for Oracle E-Business Suite with Oracle ADF Mobile and Oracle SOA SuiteSrikant Subramaniam, Joe Huang, Veshaal Singh, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3001 Follow your mobile customers, employees, and partners with Oracle Fusion Middleware. See how native iPhone and iPad applications can easily be built for Oracle E-Business Suite with the new Oracle ADF Mobile and Oracle SOA Suite. Using Oracle ADF Mobile, developers can quickly develop native applications for Apple iOS and other mobile platforms. The Oracle SOA Suite/Oracle ADF Mobile combination can execute business transactions on Oracle E-Business Suite. This session includes a demo in which a mobile user approves a business transaction in Oracle E-Business Suite and a demo of the tools used to build a native on-device solution. These concepts for mobile applications also apply to other Oracle applications.CON9029 - Oracle E-Business Suite Directions: Slashing Downtimes with Online PatchingKevin Hudson, Oracle Wednesday, Oct 3, 11:45 AM - 12:45 PM - Moscone West 2016 Oracle E-Business Suite will soon include online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature), which will reduce your database patching downtimes to however long it takes to bounce your database server. This Oracle development session details how online patching works, with special attention to what’s happening at a database object level when database patches are applied to an Oracle E-Business Suite environment that’s still running. Come learn about the operational and system management implications for minimizing maintenance downtimes when applying database patches with this new technology and the related impact on customizations you might have built on top of Oracle E-Business Suite. CON8806 - Upgrading to Oracle E-Business Suite 12.1: Technical and Functional PanelAndrew Katz, Komori America Corporation; Sandra Vucinic, VLAD Group, Inc. ;Srini Chavali, Cummins Inc.; Amrita Mehrok, Nadia Bendjedou, Anne Carlson Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2018 In this panel discussion, Oracle experts, customers, and partners share their experiences in upgrading to the latest release of Oracle E-Business Suite, Release 12.1. The panelists cover aspects of a typical Release 12 upgrade, technical (upgrading the technical infrastructure) as well as functional (upgrading to the new financial infrastructure). Hear directly from the experts who either develop the product or support, implement, or upgrade it, and find out how to apply their lessons learned to your organization. CON9027 - Personalize and Extend Oracle E-Business Suite Applications with Rich MashupsGustavo Jimenez, Padmaprabodh Ambale, Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2016 This session covers the use of several Oracle Fusion Middleware technologies to personalize and extend your existing Oracle E-Business Suite applications. The Oracle Fusion Middleware technologies covered include Oracle Application Development Framework (Oracle ADF), Oracle WebCenter, Oracle Endeca applications, and Oracle Business Intelligence Enterprise Edition with Oracle E-Business Suite Oracle Application Framework applications. CON9036 - Advanced Oracle E-Business Suite Architectures: Maximum Availability, Security, and MoreElke Phelps, Oracle Wednesday, Oct 3, 3:30 PM - 4:30 PM - Moscone West 2016 This session includes architecture diagrams and configuration instructions for building a maximum availability architecture (MAA) that will help you design a disaster recovery solution that fits the needs of your business. Database and application high-availability features it describes include Oracle Data Guard, Oracle Real Application Clusters (Oracle RAC), Oracle Active Data Guard, load-balancing Web and forms services, parallel concurrent processing, and the use of Oracle Exalogic and Oracle Exadata to provide a highly available environment. The session also covers the latest updates to systems management tools, AutoConfig, cloud computing, virtualization, and Oracle WebLogic Server and provides sneak previews of upcoming functionality. CON9047 - Efficiently Scaling Oracle E-Business Suite on Oracle Exadata and Oracle ExalogicIsam Alyousfi, Nishit Rao, Oracle Wednesday, Oct 3, 5:00 PM - 6:00 PM - Moscone West 2016 Oracle Exadata and Oracle Exalogic are designed from the ground up with optimizations in software and hardware to deliver superfast performance for mission-critical applications such as Oracle E-Business Suite. Oracle E-Business Suite applications run three to eight times as fast on the Oracle Exadata/Oracle Exalogic platform in standard benchmark tests. Besides performance, customers benefit from simplified support, enhanced manageability, and the ability to consolidate multiple Oracle E-Business Suite instances. Attend this session to understand best practices for Oracle E-Business Suite deployment on Oracle Exalogic and Oracle Exadata through customer case studies. Learn how adopting the Exa* platform increases efficiency, simplifies scaling, and boosts performance for peak loads. CON8716 - Web Services and SOA Integration Options for Oracle E-Business SuiteRekha Ayothi, Veshaal Singh, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2016 This Oracle development session provides a deep dive into a subset of the Web services and SOA-related integration options available to Oracle E-Business Suite systems integrators. It offers a technical look at Oracle E-Business Suite Integrated SOA Gateway, Oracle SOA Suite, Oracle Application Adapters for Data Integration for Oracle E-Business Suite, and other Web services options for integrating Oracle E-Business Suite with other applications. Systems integrators and developers will get an overview of the latest integration capabilities and technologies available out of the box with Oracle E-Business Suite and possibly a sneak preview of upcoming functionality and features. CON9030 - Recommendations for Oracle E-Business Suite Performance TuningIsam Alyousfi, Samer Barakat, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2018 Need to squeeze more performance out of your existing servers? This packed Oracle development session summarizes practical tips and lessons learned from performance-tuning and benchmarking the world’s largest Oracle E-Business Suite environments. Apps sysadmins will learn concrete tips and techniques for identifying and resolving performance bottlenecks on all layers, with special attention to application- and database-tier servers. Learn about tuning Oracle Forms, Oracle Concurrent Manager, Apache, and Oracle Discoverer. Track down memory leaks and other issues at the Java and JVM layers. The session also covers Oracle E-Business Suite product-level tuning, including Oracle Workflow, Oracle Order Management, Oracle Payroll, and other modules. CON3429 - Using Oracle ADF with Oracle E-Business Suite: The Full Integration ViewSiva Puthurkattil, Lake County; Juan Camilo Ruiz, Sara Woodhull, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 3003 Oracle E-Business Suite delivers functionality for handling the core business of your organization. However, user requirements and new technologies are driving an emerging need to implement new types of user interfaces for these applications. This session provides an overview of how to use Oracle Application Development Framework (Oracle ADF) to deliver cutting-edge Web 2.0 and mobile rich user interfaces that front existing Oracle E-Business Suite processes, and it also explores all the existing types of integration between the two worlds. CON9020 - Integrating Oracle E-Business Suite with Oracle Identity Management SolutionsSunil Ghosh, Elke Phelps, Oracle Thursday, Oct 4, 12:45 PM - 1:45 PM - Moscone West 2016 Need to integrate Oracle E-Business Suite with Microsoft Windows Kerberos, Active Directory, CA Netegrity SiteMinder, or other third-party authentication systems? Want to understand your options when Oracle Premier Support for Oracle Single Sign-On ends in December 2011? This Oracle Development session covers the latest certified integrations with Oracle Access Manager 11g and Oracle Internet Directory 11g, which can be used individually or as bridges for integrating with third-party authentication solutions. The session presents an architectural overview of how Oracle Access Manager, its WebGate and AccessGate components, and Oracle Internet Directory work together, with implications for Oracle Discoverer, Oracle Portal, and other Oracle Fusion identity management products. CON9019 - Troubleshooting, Diagnosing, and Optimizing Oracle E-Business Suite TechnologyGustavo Jimenez, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2016 This session covers how you can proactively diagnose Oracle E-Business Suite applications, including extensions built with Oracle Fusion Middleware technologies such as Oracle Application Development Framework (Oracle ADF) and Oracle WebCenter to catch potential issues in the middle tier before they become more serious. Topics include debugging, logging infrastructure, warning signs, performance tuning, information required when logging service requests, general JVM optimization, and an overall picture of all the moving parts that make it possible for Oracle E-Business Suite to isolate and fix problems. Also learn how Oracle Diagnostics Framework will help prevent downtime caused by failures. CON9031 - The Top 10 Things You Can Do to Secure Your Oracle E-Business Suite InstanceEric Bing, Erik Graversen, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2018 Learn the top 10 things you can do to secure your applications and your sensitive data. This Oracle development session for system administrators and security professionals explores some of the most important and overlooked things you can do to secure your Oracle E-Business Suite instance. It also covers data masking and other mechanisms for protecting sensitive data. Special Interest Groups (SIG) Some of our most senior staff have been invited to participate on the following SIG meetings as guest speakers: SIG10525 - OAUG - Archive & Purge SIGBrian Bent - Pre-Sales Engineer, TierData, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3011 The Archive and Purge SIG is an organization in which users can share their experiences and solicit functional and technical advice on archiving and purging data in Oracle E-Business Suite. This session provides an opportunity for users to network and share best practices, tips, and tricks. Guest: Oracle E-Business Suite Database Performance, Archive & Purging - Q&A SessionIsam Alyousfi, Senior Director, Applications Performance, Oracle SIG10547 - OAUG - Oracle E-Business (EBS) Applications Technology SIGSrini Chavali - IT Director, Cummins Inc Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3018 The general purpose of the EBS Applications Technology SIG is to inform and educate its members about current and future components of the tech stack as they relate to Oracle E-Business Suite. Attend this meeting for networking and education and to share best practices. Guest: Oracle E-Business Suite Technology Certification Roadmap - Presentation and Q&ASteven Chan, Sr. Director, Applications Technology Group, Oracle SIG10559 - OAUG - User Management SIGSusan Behn - VP of Oracle Delivery, Infosemantics, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3024 The E-Business Suite User Management SIG focuses on the components of user management that enable Oracle E-Business Suite users to define administrative functions and manage users’ access to functions and data based on roles within an organization—rather than the user’s individual identity—which is referred to as role-based access control (RBAC). This meeting includes an introduction to Oracle User Management that covers the Oracle User Management building blocks and presents an example of creating a security policy.Guest: Security and User Management - Q&A SessionEric Bing, Sr. Director, EBS Security, OracleSara Woodhull, Principal Product Manager, Applications Technology Group, Oracle SIG10515 - OAUG – Upgrade SIGBarbara Matthews - Consultant, On Call DBASandra Vucinic, VLAD Group, Inc. Sunday, Sep 30, 12:00 PM - 2:00 PM - Moscone West 3009 This Upgrade SIG session starts with a business meeting and then features a Q&A panel discussion on Oracle E-Business Suite upgrade topics. The session• Reviews Upgrade SIG goals and objectives• Provides answers, during the Q&A session, to questions related to Oracle E-Business Suite upgrades• Shares “real world” experiences, tips, and techniques for Oracle E-Business Suite upgrades to Release 12.1. Guest: Oracle E-Business Suite Upgrade - Q&A SessionAnne Carlson - Sr. Director, Oracle E-Business Suite Product Strategy, OracleUdayan Parvate - Director, EBS Release Engineering, OracleSuzana Ferrari, Sr. Principal Consultant, OracleIsam Alyousfi, Sr. Director, Applications Performance, Oracle SIG10552 - OAUG - Oracle E-Business Suite SIGDonna Rosentrater - Manager, Global Sourcing & Procurement Systems, TJX Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3020 The E-Business Suite SIG, affiliated with OAUG, supports Oracle E-Business Suite users through networking, education, and sharing of best practices. This SIG meeting will feature a general discussion of Oracle E-Business Suite product strategies in Release 12 and migration to Oracle Fusion Applications. Guest: Oracle E-Business Suite - Q&A SessionJeanne Lowell, Vice President, EBS Product Strategy, OracleNadia Bendjedou, Sr. Director, Product Strategy, Oracle SIG10556 - OAUG - SysAdmin SIGRandy Giefer - Sr Systems and Security Architect, Solution Beacon, LLC Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3022 The SysAdmin SIG provides a forum in which OAUG members and participants can share updates, tips, and successful practices relating to system administration in an Oracle applications environment. The SysAdmin SIG strives to enable system administrators to become more effective and efficient in their jobs by providing them with access to people and information that can increase their system administration knowledge and experience. Attend this meeting to network, share best practices, and benefit from educational content. Guest: Oracle E-Business Suite 12.2 Online Patching- Presentation and Q&AKevin Hudson, Sr. Director, Applications Technology Group, Oracle SIG10553 - OAUG - Database SIGMichael Brown - Senior DBA, COLIBRI LTD LC Sunday, Sep 30, 2:00 PM - 3:15 PM - Moscone West 3020 The OAUG Database SIG provides an opportunity for applications database administrators to learn from and share their experiences with supporting the various Oracle applications environments. This session will include a brief business meeting followed by a short presentation. It will end with an open discussion among the attendees about items of interest to those present. Guest: Oracle E-Business Suite Database Performance - Presentation and Q&AIsam Alyousfi, Sr. Director, Applications Performance, Oracle Meet the Experts We're planning two round-table discussions where you can review your questions with senior E-Business Suite ATG staff: MTE9648 - Meet the Experts for Oracle E-Business Suite: Planning Your Upgrade Jeanne Lowell - VP, EBS Product Strategy, Oracle John Abraham - Sr. Principal Product Manager, Oracle Nadia Bendjedou - Sr. Director - Product Strategy, Oracle Anne Carlson - Sr. Director, Applications Technology Group, Oracle Udayan Parvate - Director, EBS Release Engineering, Oracle Isam Alyousfi, Sr. Director, Applications Performance, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite upgrade best practices. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. MTE9649 - Meet the Oracle E-Business Suite Tools and Technology Experts Lisa Parekh - Vice President, Technology Integration, Oracle Steven Chan - Sr. Director, Oracle Elke Phelps - Sr. Principal Product Manager, Applications Technology Group, Oracle Max Arderius - Manager, Applications Technology Group, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite technology. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. Demos We have five booths in the exhibition demogrounds this year, where you can try ATG technologies firsthand and get your questions answered. Please stop by and meet our staff at the following locations: Advanced Architecture and Technology Stack for Oracle E-Business Suite (W-067) New User Productivity Capabilities in Oracle E-Business Suite (W-065) End-to-End Management of Oracle E-Business Suite (W-063) Oracle E-Business Suite 12.1 Technical Upgrade Best Practices (W-066) SOA-Based Integration for Oracle E-Business Suite (W-064)

    Read the article

  • Quick guide to Oracle IRM 11g: Configuring SSL

    - by Simon Thorpe
    Quick guide to Oracle IRM 11g index So far in this guide we have an IRM Server up and running, however I skipped over SSL configuration in the previous article because I wanted to focus in more detail now. You can, if you wish, not bother with setting up SSL, but considering this is a security technology it is worthwhile doing. Contents Setting up a one way, self signed SSL certificate in WebLogic Setting up an official SSL certificate in Apache 2.x Configuring Apache to proxy traffic to the IRM server There are two common scenarios in which an Oracle IRM server is configured. For a development or evaluation system, people usually communicate directly to the WebLogic Server running the IRM service. However in a production environment and for some proof of concept evaluations that require a setup reflecting a production system, the traffic to the IRM server travels via a web server proxy, commonly Apache. In this guide we are building an Oracle Enterprise Linux based IRM service and this article will go over the configuration of SSL in WebLogic and also in Apache. Like in the past articles, we are going to use two host names in the configuration below,irm.company.com will refer to the public Apache server irm.company.internal will refer to the internal WebLogic IRM server Setting up a one way, self signed SSL certificate in WebLogic First lets look at creating just a simple self signed SSL certificate to be used in WebLogic. This is a quick and easy way to get SSL working in your environment, however the downside is that no browsers are going to trust this certificate you create and you'll need to manually install the certificate onto any machine's communicating with the server. This is fine for development or when you have only a few users evaluating the system, but for any significant use it's usually better to have a fully trusted certificate in use and I explain that in the next section. But for now lets go through creating, installing and testing a self signed certificate. We use a library in Java to create the certificates, open a console and running the following commands. Note you should choose your own secure passwords whenever you see password below. [oracle@irm /] source /oracle/middleware/wlserver_10.3/server/bin/setWLSEnv.sh [oracle@irm /] cd /oracle/middleware/user_projects/domains/irm_domain/config/fmwconfig/ [oracle@irm /] java utils.CertGen -selfsigned -certfile MyOwnSelfCA.cer -keyfile MyOwnSelfKey.key -keyfilepass password -cn "irm.oracle.demo" [oracle@irm /] java utils.ImportPrivateKey -keystore MyOwnIdentityStore.jks -storepass password -keypass password -alias trustself -certfile MyOwnSelfCA.cer.pem -keyfile MyOwnSelfKey.key.pem -keyfilepass password [oracle@irm /] keytool -import -trustcacerts -alias trustself -keystore TrustMyOwnSelf.jks -file MyOwnSelfCA.cer.der -keyalg RSA We now have two Java Key Stores, MyOwnIdentityStore.jks and TrustMyOwnSelf.jks. These contain keys and certificates which we will use in WebLogic Server. Now we need to tell the IRM server to use these stores when setting up SSL connections for incoming requests. Make sure the Admin server is running and login into the WebLogic Console at http://irm.company.intranet:7001/console and do the following; In the menu on the left, select the + next to Environment to expose the submenu, then click on Servers. You will see two servers in the list, AdminServer(admin) and IRM_server1. If the IRM server is running, shut it down either by hitting CONTROL + C in the console window it was started from, or you can switch to the CONTROL tab, select IRM_server1 and then select the Shutdown menu and then Force Shutdown Now. In the Configuration tab select IRM_server1 and switch to the Keystores tab. By default WebLogic Server uses it's own demo identity and trust. We are now going to switch to the self signed one's we've just created. So select the Change button and switch to Custom Identity and Custom Trust and hit save. Now we have to complete the resulting fields, the setting's i've used in my evaluation server are below. IdentityCustom Identity Keystore: /oracle/middleware/user_projects/domains/irm_domain/config/fmwconfig/MyOwnIdentityStore.jks Custom Identity Keystore Type: JKS Custom Identity Keystore Passphrase: password Confirm Custom Identity Keystore Passphrase: password TrustCustom Trust Keystore: /oracle/middleware/user_projects/domains/irm_domain/config/fmwconfig/TrustMyOwnSelf.jks Custom Trust Keystore Type: JKS Custom Trust Keystore Passphrase: password Confirm Custom Trust Keystore Passphrase: password Now click on the SSL tab for the IRM_server1 and enter in the alias and passphrase, in my demo here the details are; IdentityPrivate Key Alias: trustself Private Key Passphrase: password Confirm Private Key Passphrase: password And hit save. Now lets test a connection to the IRM server over HTTPS using SSL. Go back to a console window and start the IRM server, a quick reminder on how to do this is... [oracle@irm /] cd /oracle/middleware/user_projects/domains/irm_domain/bin [oracle@irm /] ./startManagedWeblogic IRM_server1 Once running, open a browser and head to the SSL port of the server. By default the IRM server will be listening on the URL https://irm.company.intranet:16101/irm_rights. Note in the example image on the right the port is 7002 because it's a system that has the IRM services installed on the Admin server, this isn't typical (or advisable). Your system is going to have a separate managed server which will be listening on port 16101. Once you open this address you will notice that your browser is going to complain that the server certificate is untrusted. The images on the right show how Firefox displays this error. You are going to be prompted every time you create a new SSL session with the server, both from the browser and more annoyingly from the IRM Desktop. If you plan on always using a self signed certificate, it is worth adding it to the Windows certificate store so that when you are accessing sealed content you do not keep being informed this certificate is not trusted. Follow these instructions (which are for Internet Explorer 8, they may vary for your version of IE.) Start Internet Explorer and open the URL to your IRM server over SSL, e.g. https://irm.company.intranet:16101/irm_rights. IE will complain that about the certificate, click on Continue to this website (not recommended). From the IE Tools menu select Internet Options and from the resulting dialog select Security and then click on Trusted Sites and then the Sites button. Add to the list of trusted sites a URL which mates the server you are accessing, e.g. https://irm.company.intranet/ and select OK. Now refresh the page you were accessing and next to the URL you should see a red cross and the words Certificate Error. Click on this button and select View Certificates. You will now see a dialog with the details of the self signed certificate and the Install Certificate... button should be enabled. Click on this to start the wizard. Click next and you'll be asked where you should install the certificate. Change the option to Place all certificates in the following store. Select browse and choose the Trusted Root Certification Authorities location and hit OK. You'll then be prompted to install the certificate and answer yes. You also need to import the root signed certificate into the same location, so once again select the red Certificate Error option and this time when viewing the certificate, switch to the Certification Path tab and you should see a CertGenCAB certificate. Select this and then click on View Certificate and go through the same process as above to import the certificate into the store. Finally close all instances of the IE browser and re-access the IRM server URL again, this time you should not receive any errors. Setting up an official SSL certificate in Apache 2.x At this point we now have an IRM server that you can communicate with over SSL. However this certificate isn't trusted by any browser because it's path of trust doesn't end in a recognized certificate authority (CA). Also you are communicating directly to the WebLogic Server over a non standard SSL port, 16101. In a production environment it is common to have another device handle the initial public internet traffic and then proxy this to the WebLogic server. The diagram below shows a very simplified view of this type of deployment. What i'm going to walk through next is configuring Apache to proxy traffic to a WebLogic server and also to use a real SSL certificate from an official CA. First step is to configure Apache to handle incoming requests over SSL. In this guide I am configuring the IRM service in Oracle Enterprise Linux 5 update 3 and Apache 2.2.3 which came with OpenSSL and mod_ssl components. Before I purchase an SSL certificate, I need to generate a certificate request from the server. Oracle.com uses Verisign and for my own personal needs I use cheaper certificates from GoDaddy. The following instructions are specific to Apache, but there are many references out there for other web servers. For Apache I have OpenSSL and the commands are; [oracle@irm /] cd /usr/bin [oracle@irm bin] openssl genrsa -des3 -out irm-apache-server.key 2048 Generating RSA private key, 2048 bit long modulus ............................+++ .........+++ e is 65537 (0x10001) Enter pass phrase for irm-apache-server.key: Verifying - Enter pass phrase for irm-apache-server.key: [oracle@irm bin] openssl req -new -key irm-apache-server.key -out irm-apache-server.csr Enter pass phrase for irm-apache-server.key: You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. ----- Country Name (2 letter code) [GB]:US State or Province Name (full name) [Berkshire]:CA Locality Name (eg, city) [Newbury]:San Francisco Organization Name (eg, company) [My Company Ltd]:Oracle Organizational Unit Name (eg, section) []:Security Common Name (eg, your name or your server's hostname) []:irm.company.com Email Address []:[email protected] Please enter the following 'extra' attributes to be sent with your certificate request A challenge password []:testing An optional company name []: You must make sure to remember the pass phrase you used in the initial key generation, you will need this when later configuring Apache. In the /usr/bin directory there are now two new files. The irm-apache-server.csr contains our certificate request and is what you cut and paste, or upload, to your certificate authority when you purchase and validate your SSL certificate. In response you will typically get two files. Your server certificate and another certificate file that will likely contain a set of certificates from your CA which validate your certificate's trust. Next we need to configure Apache to use these files. Typically there is an ssl.conf file which is where all the SSL configuration is done. On my Oracle Enterprise Linux server this file is located in /etc/httpd/conf.d/ssl.conf and i've added the following lines. <VirtualHost irm.company.com> # Setup SSL for irm.company.com ServerName irm.company.com SSLEngine On SSLCertificateFile /oracle/secure/irm.company.com.crt SSLCertificateKeyFile /oracle/secure/irm.company.com.key SSLCertificateChainFile /oracle/secure/gd_bundle.crt </VirtualHost> Restarting Apache (apachectl restart) and I can now attempt to connect to the Apache server in a web browser, https://irm.company.com/. If all is configured correctly I should now see an Apache test page delivered to me over HTTPS. Configuring Apache to proxy traffic to the IRM server Final piece in setting up SSL is to have Apache proxy requests for the IRM server but do so securely. So the requests to Apache will be over HTTPS using a legitimate certificate, but we can also configure Apache to proxy these requests internally across to the IRM server using SSL with the self signed certificate we generated at the start of this article. To do this proxying we use the WebLogic Web Server plugin for Apache which you can download here from Oracle. Download the zip file and extract onto the server. The file extraction reveals a set of zip files, each one specific to a supported web server. In my instance I am using Apache 2.2 32bit on an Oracle Enterprise Linux, 64 bit server. If you are not sure what version your Apache server is, run the command /usr/sbin/httpd -V and you'll see version and it its 32 or 64 bit. Mine is a 32bit server so I need to extract the file WLSPlugin1.1-Apache2.2-linux32-x86.zip. The from the resulting lib folder copy the file mod_wl.so into /usr/lib/httpd/modules/. First we want to test that the plug in will work for regular HTTP traffic. Edit the httpd.conf for Apache and add the following section at the bottom. LoadModule weblogic_module modules/mod_wl.so <IfModule mod_weblogic.c>    WebLogicHost irm.company.internal    WebLogicPort 16100    WLLogFile /tmp/wl-proxy.log </IfModule> <Location /irm_rights>    SetHandler weblogic-handler </Location> <Location /irm_desktop>    SetHandler weblogic-handler </Location> <Location /irm_sealing>    SetHandler weblogic-handler </Location> <Location /irm_services>    SetHandler weblogic-handler </Location> Now restart Apache again (apachectl restart) and now open a browser to http://irm.company.com/irm_rights. Apache will proxy the HTTP traffic from the port 80 of your Apache server to the IRM service listening on port 16100 of the WebLogic Managed server. Note above I have included all four of the Locations you might wish to proxy. http://irm.company.internalirm_rights is the URL to the management website, /irm_desktop is the URL used for the IRM Desktop to communicate. irm_sealing is for web services based document sealing and irm_services is for IRM server web services. The last two are typically only used when you have the IRM server integrated with another application and it is unlikely you'd be accessing these resources from the public facing Apache server. However, just in case, i've mentioned them above. Now let's enable SSL communication from Apache to WebLogic. In the ZIP file we extracted were some more modules we need to copy into the Apache folder. Looking back in the lib that we extracted, there are some more files. Copy the following into the /usr/lib/httpd/modules/ folder. libwlssl.so libnnz11.so libclntsh.so.11.1 Now the documentation states that should only need to do this, but I found that I also needed to create an environment variable called LD_LIBRARY_PATH and point this to the folder /usr/lib/httpd/modules/. If I didn't do this, starting Apache with the WebLogic module configured to SSL would throw the error. [crit] (20014)Internal error: WL SSL Init failed for server: (null) on 0 So I had to edit the file /etc/profile and add the following lines at the bottom. You may already have the LD_LIBRARY_PATH variable defined, therefore simply add this path to it. LD_LIBRARY_PATH=/usr/lib/httpd/modules/ export LD_LIBRARY_PATH Now the WebLogic plug in uses an Oracle Wallet to store the required certificates.You'll need to copy the self signed certificate from the IRM server over to the Apache server. Copy over the MyOwnSelfCA.cer.der into the same folder where you are storing your public certificates, in my example this is /oracle/secure. It's worth mentioning these files should ONLY be readable by root (the user Apache runs as). Now lets create an Oracle Wallet and import the self signed certificate from the IRM server. The file orapki was included in the bin folder of the Apache 1.1 plugin zip you extracted. orapki wallet create -wallet /oracle/secure/my-wallet -auto_login_only orapki wallet add -wallet /oracle/secure/my-wallet -trusted_cert -cert MyOwnSelfCA.cer.der -auto_login_only Finally change the httpd.conf to reflect that we want the WebLogic Apache plug-in to use HTTPS/SSL and not just plain HTTP. <IfModule mod_weblogic.c>    WebLogicHost irm.company.internal    WebLogicPort 16101    SecureProxy ON    WLSSLWallet /oracle/secure/my-wallet    WLLogFile /tmp/wl-proxy.log </IfModule> Then restart Apache once more and you can go back to the browser to test the communication. Opening the URL https://irm.company.com/irm_rights will proxy your request to the WebLogic server at https://irm.company.internal:16101/irm_rights. At this point you have a fully functional Oracle IRM service, the next step is to create a sealed document and test the entire system.

    Read the article

  • Announcing release of ASP.NET MVC 3, IIS Express, SQL CE 4, Web Farm Framework, Orchard, WebMatrix

    - by ScottGu
    I’m excited to announce the release today of several products: ASP.NET MVC 3 NuGet IIS Express 7.5 SQL Server Compact Edition 4 Web Deploy and Web Farm Framework 2.0 Orchard 1.0 WebMatrix 1.0 The above products are all free. They build upon the .NET 4 and VS 2010 release, and add a ton of additional value to ASP.NET (both Web Forms and MVC) and the Microsoft Web Server stack. ASP.NET MVC 3 Today we are shipping the final release of ASP.NET MVC 3.  You can download and install ASP.NET MVC 3 here.  The ASP.NET MVC 3 source code (released under an OSI-compliant open source license) can also optionally be downloaded here. ASP.NET MVC 3 is a significant update that brings with it a bunch of great features.  Some of the improvements include: Razor ASP.NET MVC 3 ships with a new view-engine option called “Razor” (in addition to continuing to support/enhance the existing .aspx view engine).  Razor minimizes the number of characters and keystrokes required when writing a view template, and enables a fast, fluid coding workflow. Unlike most template syntaxes, with Razor you do not need to interrupt your coding to explicitly denote the start and end of server blocks within your HTML. The Razor parser is smart enough to infer this from your code. This enables a compact and expressive syntax which is clean, fast and fun to type.  You can learn more about Razor from some of the blog posts I’ve done about it over the last 6 months Introducing Razor New @model keyword in Razor Layouts with Razor Server-Side Comments with Razor Razor’s @: and <text> syntax Implicit and Explicit code nuggets with Razor Layouts and Sections with Razor Today’s release supports full code intellisense support for Razor (both VB and C#) with Visual Studio 2010 and the free Visual Web Developer 2010 Express. JavaScript Improvements ASP.NET MVC 3 enables richer JavaScript scenarios and takes advantage of emerging HTML5 capabilities. The AJAX and Validation helpers in ASP.NET MVC 3 now use an Unobtrusive JavaScript based approach.  Unobtrusive JavaScript avoids injecting inline JavaScript into HTML, and enables cleaner separation of behavior using the new HTML 5 “data-“ attribute convention (which conveniently works on older browsers as well – including IE6). This keeps your HTML tight and clean, and makes it easier to optionally swap out or customize JS libraries.  ASP.NET MVC 3 now includes built-in support for posting JSON-based parameters from client-side JavaScript to action methods on the server.  This makes it easier to exchange data across the client and server, and build rich JavaScript front-ends.  We think this capability will be particularly useful going forward with scenarios involving client templates and data binding (including the jQuery plugins the ASP.NET team recently contributed to the jQuery project).  Previous releases of ASP.NET MVC included the core jQuery library.  ASP.NET MVC 3 also now ships the jQuery Validate plugin (which our validation helpers use for client-side validation scenarios).  We are also now shipping and including jQuery UI by default as well (which provides a rich set of client-side JavaScript UI widgets for you to use within projects). Improved Validation ASP.NET MVC 3 includes a bunch of validation enhancements that make it even easier to work with data. Client-side validation is now enabled by default with ASP.NET MVC 3 (using an onbtrusive javascript implementation).  Today’s release also includes built-in support for Remote Validation - which enables you to annotate a model class with a validation attribute that causes ASP.NET MVC to perform a remote validation call to a server method when validating input on the client. The validation features introduced within .NET 4’s System.ComponentModel.DataAnnotations namespace are now supported by ASP.NET MVC 3.  This includes support for the new IValidatableObject interface – which enables you to perform model-level validation, and allows you to provide validation error messages specific to the state of the overall model, or between two properties within the model.  ASP.NET MVC 3 also supports the improvements made to the ValidationAttribute class in .NET 4.  ValidationAttribute now supports a new IsValid overload that provides more information about the current validation context, such as what object is being validated.  This enables richer scenarios where you can validate the current value based on another property of the model.  We’ve shipped a built-in [Compare] validation attribute  with ASP.NET MVC 3 that uses this support and makes it easy out of the box to compare and validate two property values. You can use any data access API or technology with ASP.NET MVC.  This past year, though, we’ve worked closely with the .NET data team to ensure that the new EF Code First library works really well for ASP.NET MVC applications.  These two posts of mine cover the latest EF Code First preview and demonstrates how to use it with ASP.NET MVC 3 to enable easy editing of data (with end to end client+server validation support).  The final release of EF Code First will ship in the next few weeks. Today we are also publishing the first preview of a new MvcScaffolding project.  It enables you to easily scaffold ASP.NET MVC 3 Controllers and Views, and works great with EF Code-First (and is pluggable to support other data providers).  You can learn more about it – and install it via NuGet today - from Steve Sanderson’s MvcScaffolding blog post. Output Caching Previous releases of ASP.NET MVC supported output caching content at a URL or action-method level. With ASP.NET MVC V3 we are also enabling support for partial page output caching – which allows you to easily output cache regions or fragments of a response as opposed to the entire thing.  This ends up being super useful in a lot of scenarios, and enables you to dramatically reduce the work your application does on the server.  The new partial page output caching support in ASP.NET MVC 3 enables you to easily re-use cached sub-regions/fragments of a page across multiple URLs on a site.  It supports the ability to cache the content either on the web-server, or optionally cache it within a distributed cache server like Windows Server AppFabric or memcached. I’ll post some tutorials on my blog that show how to take advantage of ASP.NET MVC 3’s new output caching support for partial page scenarios in the future. Better Dependency Injection ASP.NET MVC 3 provides better support for applying Dependency Injection (DI) and integrating with Dependency Injection/IOC containers. With ASP.NET MVC 3 you no longer need to author custom ControllerFactory classes in order to enable DI with Controllers.  You can instead just register a Dependency Injection framework with ASP.NET MVC 3 and it will resolve dependencies not only for Controllers, but also for Views, Action Filters, Model Binders, Value Providers, Validation Providers, and Model Metadata Providers that you use within your application. This makes it much easier to cleanly integrate dependency injection within your projects. Other Goodies ASP.NET MVC 3 includes dozens of other nice improvements that help to both reduce the amount of code you write, and make the code you do write cleaner.  Here are just a few examples: Improved New Project dialog that makes it easy to start new ASP.NET MVC 3 projects from templates. Improved Add->View Scaffolding support that enables the generation of even cleaner view templates. New ViewBag property that uses .NET 4’s dynamic support to make it easy to pass late-bound data from Controllers to Views. Global Filters support that allows specifying cross-cutting filter attributes (like [HandleError]) across all Controllers within an app. New [AllowHtml] attribute that allows for more granular request validation when binding form posted data to models. Sessionless controller support that allows fine grained control over whether SessionState is enabled on a Controller. New ActionResult types like HttpNotFoundResult and RedirectPermanent for common HTTP scenarios. New Html.Raw() helper to indicate that output should not be HTML encoded. New Crypto helpers for salting and hashing passwords. And much, much more… Learn More about ASP.NET MVC 3 We will be posting lots of tutorials and samples on the http://asp.net/mvc site in the weeks ahead.  Below are two good ASP.NET MVC 3 tutorials available on the site today: Build your First ASP.NET MVC 3 Application: VB and C# Building the ASP.NET MVC 3 Music Store We’ll post additional ASP.NET MVC 3 tutorials and videos on the http://asp.net/mvc site in the future. Visit it regularly to find new tutorials as they are published. How to Upgrade Existing Projects ASP.NET MVC 3 is compatible with ASP.NET MVC 2 – which means it should be easy to update existing MVC projects to ASP.NET MVC 3.  The new features in ASP.NET MVC 3 build on top of the foundational work we’ve already done with the MVC 1 and MVC 2 releases – which means that the skills, knowledge, libraries, and books you’ve acquired are all directly applicable with the MVC 3 release.  MVC 3 adds new features and capabilities – it doesn’t obsolete existing ones. You can upgrade existing ASP.NET MVC 2 projects by following the manual upgrade steps in the release notes.  Alternatively, you can use this automated ASP.NET MVC 3 upgrade tool to easily update your  existing projects. Localized Builds Today’s ASP.NET MVC 3 release is available in English.  We will be releasing localized versions of ASP.NET MVC 3 (in 9 languages) in a few days.  I’ll blog pointers to the localized downloads once they are available. NuGet Today we are also shipping NuGet – a free, open source, package manager that makes it easy for you to find, install, and use open source libraries in your projects. It works with all .NET project types (including ASP.NET Web Forms, ASP.NET MVC, WPF, WinForms, Silverlight, and Class Libraries).  You can download and install it here. NuGet enables developers who maintain open source projects (for example, .NET projects like Moq, NHibernate, Ninject, StructureMap, NUnit, Windsor, Raven, Elmah, etc) to package up their libraries and register them with an online gallery/catalog that is searchable.  The client-side NuGet tools – which include full Visual Studio integration – make it trivial for any .NET developer who wants to use one of these libraries to easily find and install it within the project they are working on. NuGet handles dependency management between libraries (for example: library1 depends on library2). It also makes it easy to update (and optionally remove) libraries from your projects later. It supports updating web.config files (if a package needs configuration settings). It also allows packages to add PowerShell scripts to a project (for example: scaffold commands). Importantly, NuGet is transparent and clean – and does not install anything at the system level. Instead it is focused on making it easy to manage libraries you use with your projects. Our goal with NuGet is to make it as simple as possible to integrate open source libraries within .NET projects.  NuGet Gallery This week we also launched a beta version of the http://nuget.org web-site – which allows anyone to easily search and browse an online gallery of open source packages available via NuGet.  The site also now allows developers to optionally submit new packages that they wish to share with others.  You can learn more about how to create and share a package here. There are hundreds of open-source .NET projects already within the NuGet Gallery today.  We hope to have thousands there in the future. IIS Express 7.5 Today we are also shipping IIS Express 7.5.  IIS Express is a free version of IIS 7.5 that is optimized for developer scenarios.  It works for both ASP.NET Web Forms and ASP.NET MVC project types. We think IIS Express combines the ease of use of the ASP.NET Web Server (aka Cassini) currently built-into Visual Studio today with the full power of IIS.  Specifically: It’s lightweight and easy to install (less than 5Mb download and a quick install) It does not require an administrator account to run/debug applications from Visual Studio It enables a full web-server feature set – including SSL, URL Rewrite, and other IIS 7.x modules It supports and enables the same extensibility model and web.config file settings that IIS 7.x support It can be installed side-by-side with the full IIS web server as well as the ASP.NET Development Server (they do not conflict at all) It works on Windows XP and higher operating systems – giving you a full IIS 7.x developer feature-set on all Windows OS platforms IIS Express (like the ASP.NET Development Server) can be quickly launched to run a site from a directory on disk.  It does not require any registration/configuration steps. This makes it really easy to launch and run for development scenarios.  You can also optionally redistribute IIS Express with your own applications if you want a lightweight web-server.  The standard IIS Express EULA now includes redistributable rights. Visual Studio 2010 SP1 adds support for IIS Express.  Read my VS 2010 SP1 and IIS Express blog post to learn more about what it enables.  SQL Server Compact Edition 4 Today we are also shipping SQL Server Compact Edition 4 (aka SQL CE 4).  SQL CE is a free, embedded, database engine that enables easy database storage. No Database Installation Required SQL CE does not require you to run a setup or install a database server in order to use it.  You can simply copy the SQL CE binaries into the \bin directory of your ASP.NET application, and then your web application can use it as a database engine.  No setup or extra security permissions are required for it to run. You do not need to have an administrator account on the machine. Just copy your web application onto any server and it will work. This is true even of medium-trust applications running in a web hosting environment. SQL CE runs in-memory within your ASP.NET application and will start-up when you first access a SQL CE database, and will automatically shutdown when your application is unloaded.  SQL CE databases are stored as files that live within the \App_Data folder of your ASP.NET Applications. Works with Existing Data APIs SQL CE 4 works with existing .NET-based data APIs, and supports a SQL Server compatible query syntax.  This means you can use existing data APIs like ADO.NET, as well as use higher-level ORMs like Entity Framework and NHibernate with SQL CE.  This enables you to use the same data programming skills and data APIs you know today. Supports Development, Testing and Production Scenarios SQL CE can be used for development scenarios, testing scenarios, and light production usage scenarios.  With the SQL CE 4 release we’ve done the engineering work to ensure that SQL CE won’t crash or deadlock when used in a multi-threaded server scenario (like ASP.NET).  This is a big change from previous releases of SQL CE – which were designed for client-only scenarios and which explicitly blocked running in web-server environments.  Starting with SQL CE 4 you can use it in a web-server as well. There are no license restrictions with SQL CE.  It is also totally free. Tooling Support with VS 2010 SP1 Visual Studio 2010 SP1 adds support for SQL CE 4 and ASP.NET Projects.  Read my VS 2010 SP1 and SQL CE 4 blog post to learn more about what it enables.  Web Deploy and Web Farm Framework 2.0 Today we are also releasing Microsoft Web Deploy V2 and Microsoft Web Farm Framework V2.  These services provide a flexible and powerful way to deploy ASP.NET applications onto either a single server, or across a web farm of machines. You can learn more about these capabilities from my previous blog posts on them: Introducing the Microsoft Web Farm Framework Automating Deployment with Microsoft Web Deploy Visit the http://iis.net website to learn more and install them. Both are free. Orchard 1.0 Today we are also releasing Orchard v1.0.  Orchard is a free, open source, community based project.  It provides Content Management System (CMS) and Blogging System support out of the box, and makes it possible to easily create and manage web-sites without having to write code (site owners can customize a site through the browser-based editing tools built-into Orchard).  Read these tutorials to learn more about how you can setup and manage your own Orchard site. Orchard itself is built as an ASP.NET MVC 3 application using Razor view templates (and by default uses SQL CE 4 for data storage).  Developers wishing to extend an Orchard site with custom functionality can open and edit it as a Visual Studio project – and add new ASP.NET MVC Controllers/Views to it.  WebMatrix 1.0 WebMatrix is a new, free, web development tool from Microsoft that provides a suite of technologies that make it easier to enable website development.  It enables a developer to start a new site by browsing and downloading an app template from an online gallery of web applications (which includes popular apps like Umbraco, DotNetNuke, Orchard, WordPress, Drupal and Joomla).  Alternatively it also enables developers to create and code web sites from scratch. WebMatrix is task focused and helps guide developers as they work on sites.  WebMatrix includes IIS Express, SQL CE 4, and ASP.NET - providing an integrated web-server, database and programming framework combination.  It also includes built-in web publishing support which makes it easy to find and deploy sites to web hosting providers. You can learn more about WebMatrix from my Introducing WebMatrix blog post this summer.  Visit http://microsoft.com/web to download and install it today. Summary I’m really excited about today’s releases – they provide a bunch of additional value that makes web development with ASP.NET, Visual Studio and the Microsoft Web Server a lot better.  A lot of folks worked hard to share this with you today. On behalf of my whole team – we hope you enjoy them! Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

< Previous Page | 434 435 436 437 438 439 440 441 442 443 444 445  | Next Page >