Search Results

Search found 96184 results on 3848 pages for 'recent file list'.

Page 44/3848 | < Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • parsing a list and producing a structure of that

    - by qzar
    ;; structure representing homework points ;; nr: number - the number of the homework ;; points: number - the number of points reached (define-struct homework (nr points)) ;; parse-homework: (list of number pairs) -> (list of homework) ;; The procedure takes a list of number pairs and produces a list of homework structures ;; Example: (parse-homework (list (list 1 6) (list 2 7) (list 3 0))) should produce (list (make-homework 1 6) (make-homework 2 7) (make-homework 3 0)) (define (parse-homework homework-entries) (if (and (= (length (first homework-entries) 2))(= (length (parse-homework (rest homework-entries)) 2))) (make-homework (first homework-entries) (parse-homework (rest homework-entries))) (error 'Non-valid-input "entered list is not of length two")) ) (parse-homework (list (list 1 6) (list 2 7) (list 3 0))) This code produces the error length: expects 1 argument, given 2: (list 1 6) 2 I really appreciate every explanation that you can give me to get in in this scheme-stuff... Thank you very much

    Read the article

  • How do I aggregate results from an Adjacency list using PHP's SPL

    - by Stephen J. Fuhry
    I've tried using nested sets, and they become very difficult to maintain when dealing with multiple trees and lots of other complications.. I'd like to give PHP's SPL library a stab at this (btw, we are PHP 5.3, MySQL 5.1). Given two datasets: The Groups: +-------+--------+---------------------+---------------+ | id | parent | Category Name | child_key | +-------+--------+---------------------+---------------+ | 11133 | 7707 | Really Cool Products| 47054 | | 7709 | 7708 | 24" Monitors | 57910 | | 7713 | 7710 | Hot Tubs | 35585 | | 7716 | 7710 | Hot Dogs | 00395 | | 11133 | 7707 | Really Cool Products| 66647 | | 7715 | 7710 | Suction Cups | 08396 | +-------+--------+---------------------+---------------+ The Items +------------+------------+-----------+----------+---------+ | child_key | totalprice | totalcost | totalqty | onorder | (jan, feb, mar..) +------------+------------+-----------+----------+---------+ | 24171 | 10.50 | 20.10 | 200 | 100 | | 35685 | 10.50 | 20.10 | 200 | 100 | | 76505 | 10.50 | 20.10 | 200 | 100 | | 04365 | 10.50 | 20.10 | 200 | 100 | | 01975 | 10.50 | 20.10 | 200 | 100 | | 12150 | 10.50 | 20.10 | 200 | 100 | | 40060 | 10.50 | 20.10 | 200 | 100 | | 08396 | 10.50 | 20.10 | 200 | 100 | +------------+------------+-----------+----------+---------+ The figures are actually much more complicated than this (I am actually aggregating a variable amount of months or years over the past 15yrs, so there may need to be 20 columns of aggregated results). I have been trying to figure out RecursiveIterator and IteratorAggregate, but I am having a difficult time finding real world examples that are generic enough to really wrap my head around these classes. Can someone give me a head start?

    Read the article

  • Creating generic list of instances of a class.

    - by Jim Branson
    I have several projects where I build a dictionary from a small class. I'm using C# 2008, Visual studio 2008 and .net 3.5 This is the code: namespace ReportsTest { class Junk { public static Dictionary<string, string> getPlatKeys() { Dictionary<string, string> retPlatKeys = new Dictionary<string, string>(); SqlConnection conn = new SqlConnection("Data Source=JB55LTARL;Initial Catalog=HldiReports;Integrated Security=True"); SqlDataReader Dr = null; conn.Open(); SqlCommand cmnd = new SqlCommand("SELECT Make, Series, RedesignYear, SeriesName FROM CompPlatformKeys", conn); Dr = cmnd.ExecuteReader(); while (Dr.Read()) { utypPlatKeys rec = new utypPlatKeys(Dr); retPlatKeys.Add(rec.Make + rec.Series + rec.RedesignYear, rec.SeriesName); } conn = null; Dr = null; return retPlatKeys; } } public class utypPlatKeys { public string Make { get; set; } public string Series { get; set; } public string RedesignYear { get; set; } public string SeriesName { get; set; } public utypPlatKeys(SqlDataReader dr) { this.Make = dr.GetInt16(dr.GetOrdinal("Make")).ToString("D3"); this.Series = dr.GetInt16(dr.GetOrdinal("Series")).ToString("D3"); this.RedesignYear = dr.GetInt16(dr.GetOrdinal("RedesignYear")).ToString(); this.SeriesName = dr["SeriesName"].ToString(); } } } The immediate window shows all of the entries in retPlatKeys and if you hover over retPlatKeys after loading it indicates the number of elements like this: "retPlatKeys| Count = 923 which is correct. I went to create a new project using this pattern only now the immediate window says retPlatKeys is out of scope and hovering over retPlatKeys after loading I get something like retPlatKeys|0x0000000002578900. Any help is greatly appreciated.

    Read the article

  • Big problem with Dijkstra algorithm in a linked list graph implementation

    - by Nazgulled
    Hi, I have my graph implemented with linked lists, for both vertices and edges and that is becoming an issue for the Dijkstra algorithm. As I said on a previous question, I'm converting this code that uses an adjacency matrix to work with my graph implementation. The problem is that when I find the minimum value I get an array index. This index would have match the vertex index if the graph vertexes were stored in an array instead. And the access to the vertex would be constant. I don't have time to change my graph implementation, but I do have an hash table, indexed by a unique number (but one that does not start at 0, it's like 100090000) which is the problem I'm having. Whenever I need, I use the modulo operator to get a number between 0 and the total number of vertices. This works fine for when I need an array index from the number, but when I need the number from the array index (to access the calculated minimum distance vertex in constant time), not so much. I tried to search for how to inverse the modulo operation, like, 100090000 mod 18000 = 10000 and, 10000 invmod 18000 = 100090000 but couldn't find a way to do it. My next alternative is to build some sort of reference array where, in the example above, arr[10000] = 100090000. That would fix the problem, but would require to loop the whole graph one more time. Do I have any better/easier solution with my current graph implementation?

    Read the article

  • How do I implement a remove by index method for a singly linked list in Java?

    - by Lars Flyger
    Hi, I'm a student in a programming class, and I need some help with this code I've written. So far I've written an entire linked list class (seen below), yet for some reason the "removeByIndex" method won't work. I can't seem to figure out why, the logic seems sound to me. Is there some problem I don't know about? public class List<T> { //private sub-class Link private class Link { private T value; private Link next; //constructors of Link: public Link (T val) { this.value = val; this.next = null; } public Link (T val, Link next) { this.value = val; this.next = next; } @SuppressWarnings("unused") public T getValue() { return value; } } private static final Exception NoSuchElementException = null; private static final Exception IndexOutOfBoundsException = null; private Link chain = null; //constructors of List: public List() { this.chain = null; } //methods of List: /** * Preconditions: none * Postconditions: returns true if list is empty */ public boolean isEmpty() { return this.chain == null; } /** * Preconditions: none * Postconditions: A new Link is added via add-aux * @param element */ public void add(T element) { this.add_aux(element, this.chain); } /** * Preconditions: none * Postconditions: A new Link is added to the current chain * @param element * @param chain */ private void add_aux(T element, Link chain) { if (chain == null) { //if chain is null set chain to a new Link with a value of //element this.chain = new Link(element); } else if (chain.next != null) { //if chain.next is not null, go to next item in chain and //try //to add element add_aux(element, chain.next); } else { //if chain.next is null, set chain.next equal to a new Link //with value of element. chain.next = new Link(element); } } /** * Preconditions: none * Postconditions: returns the link at the defined index via nthlink_aux * @param index * @return */ private Link nthLink (int index) { return nthLink_aux(index, this.chain); } /** * Preconditions: none * Postconditions: returns the link at the defined index in the specified *chain * @param i * @param c * @return */ private Link nthLink_aux (int i, Link c) { if (i == 0) { return c; } else return nthLink_aux(i-1, c.next); } /** * Preconditions: the specified element is present in the list * Postconditions: the specified element is removed from the list * @param element * @throws Exception */ public void removeElement(T element) throws Exception { if (chain == null) { throw NoSuchElementException; } //while chain's next is not null and the value of chain.next is not //equal to element, //set chain equal to chain.next //use this iteration to go through the linked list. else while ((chain.next != null) && !(chain.next.value.equals(element))){ Link testlink = chain.next; if (testlink.next.value.equals(element)) { //if chain.next is equal to element, bypass the //element. chain.next.next = chain.next.next.next; } else if (testlink.next == null) { throw NoSuchElementException; } } } /** * Preconditions: none * Postsconditions: the Link at the specified index is removed * @param index * @throws Exception */ public void removeByIndex(int index) throws Exception { if (index == 0) { //if index is 0, set chain equal to chain.next chain = chain.next; } else if (index > 0) { Link target = nthLink(index); while (target != null) { if (target.next != null) { target = target.next; } //if target.next is null, set target to null else { target = null; } } return; } else throw IndexOutOfBoundsException; } /** * Preconditions: none * Postconditions: the specified link's value is printed * @param link */ public void printLink (Link link) { if(link != null) { System.out.println(link.value.toString()); } } /** * Preconditions: none * Postconditions: all of the links' values in the list are printed. */ public void print() { //copy chain to a new variable Link head = this.chain; //while head is not null while (!(head == null)) { //print the current link this.printLink(head); //set head equal to the next link head = head.next; } } /** * Preconditions: none * Postconditions: The chain is set to null */ public void clear() { this.chain = null; } /** * Preconditions: none * Postconditions: Places the defined link at the defined index of the list * @param index * @param val */ public void splice(int index, T val) { //create a new link with value equal to val Link spliced = new Link(val); if (index <= 0) { //copy chain Link copy = chain; //set chain equal to spliced chain = spliced; //set chain.next equal to copy chain.next = copy; } else if (index > 0) { //create a target link equal to the link before the index Link target = nthLink(index - 1); //set the target's next equal to a new link with a next //equal to the target's old next target.next = new Link(val, target.next); } } /** * Preconditions: none * Postconditions: Check to see if element is in the list, returns true * if it is and false if it isn't * @param element * @return */ public boolean Search(T element) { if (chain == null) { //return false if chain is null return false; } //while chain's next is not null and the value of chain.next is not //equal to element, //set chain equal to chain.next //use this iteration to go through the linked list. else while ((chain.next != null) && !(chain.next.value.equals(element))) { Link testlink = chain.next; if (testlink.next.value.equals(element)) { //if chain.next is equal to element, return true return true; } else if (testlink.next == null) { return false; } } return false; } /** * Preconditions: none * Postconditions: order of the links in the list is reversed. */ public void reverse() { //copy chain Link current = chain; //set chain equal to null chain = null; while (current != null) { Link save = current; current = current.next; save.next = chain; chain = save; } } }'

    Read the article

  • create graph using adjacency list

    - by sum1needhelp
    #include<iostream> using namespace std; class TCSGraph{ public: void addVertex(int vertex); void display(); TCSGraph(){ head = NULL; } ~TCSGraph(); private: struct ListNode { string name; struct ListNode *next; }; ListNode *head; } void TCSGraph::addVertex(int vertex){ ListNode *newNode; ListNode *nodePtr; string vName; for(int i = 0; i < vertex ; i++ ){ cout << "what is the name of the vertex"<< endl; cin >> vName; newNode = new ListNode; newNode->name = vName; if (!head) head = newNode; else nodePtr = head; while(nodePtr->next) nodePtr = nodePtr->next; nodePtr->next = newNode; } } void TCSGraph::display(){ ListNode *nodePtr; nodePtr = head; while(nodePtr){ cout << nodePtr->name<< endl; nodePtr = nodePtr->next; } } int main(){ int vertex; cout << " how many vertex u wan to add" << endl; cin >> vertex; TCSGraph g; g.addVertex(vertex); g.display(); return 0; }

    Read the article

  • Is this good code? Linked List Stack Implementation

    - by Quik Tester
    I have used the following code for a stack implementation. The top keeps track of the topmost node of the stack. Now since top is a data member of the node function, each node created will have a top member, which ideally we wouldn't want. Firstly, is this good approach to coding? Secondly, will making top as static make it a better coding practice? Or should I have a global declaration of top? #include<iostream> using namespace std; class node { int data; node *top; node *link; public: node() { top=NULL; link=NULL; } void push(int x) { node *n=new node; n->data=x; n->link=top; top=n; cout<<"Pushed "<<n->data<<endl; } void pop() { node *n=new node; n=top; top=top->link; n->link=NULL; cout<<"Popped "<<n->data<<endl; delete n; } void print() { node *n=new node; n=top; while(n!=NULL) { cout<<n->data<<endl; n=n->link; } delete n; } }; int main() { node stack; stack.push(5); stack.push(7); stack.push(9); stack.pop(); stack.print(); } Any other suggestions welcome. I have also seen codes where there are two classes, where the second one has the top member. What about this? Thanks. :)

    Read the article

  • C# generic list <T> how to get the type of T?

    - by Daok
    Hello, Let say I have a List< T > abc = new List< T >; inside a class public class MyClass<T>//.... Later, when I initialize the class the T because MyTypeObject1. So I have a generic list of List< MyTypeObject1 >. I would like to know, what type of object the list of my class contain. Example, the list called abc contain what type of object? I cannot do abc[0].GetType(); because the list might contain 0 element. How can I do it?

    Read the article

  • Declaring an array of linked list in C#

    - by xarzu
    I got the compile error message "Array size cannot be specified in a variable declaration (try initializing with a 'new' expression)" when I tried to declare an array of linked lists. public LinkedList[2] ExistingXMLList; Also, if I wanted to create a small array of strings, isn't this the way: string [2] inputdata;

    Read the article

  • How to get a list of all domains?

    - by AngryHacker
    I'm trying to get all domains that are available in the Windows Login dialog (in the Domain dropdown). I've tried the following code but it only returns the domain I am logged into. Am I missing something? StringCollection domainList = new StringCollection(); try { DirectoryEntry en = new DirectoryEntry("LDAP://"); // Search for objectCategory type "Domain" DirectorySearcher srch = new DirectorySearcher("objectCategory=Domain"); SearchResultCollection coll = srch.FindAll(); // Enumerate over each returned domain. foreach (SearchResult rs in coll) { ResultPropertyCollection resultPropColl = rs.Properties; foreach( object domainName in resultPropColl["name"]) { domainList.Add(domainName.ToString()); } } } catch (Exception ex) { Trace.Write(ex.Message); } return domainList;

    Read the article

  • Query to show images with recent posts in Wordpress sidebar/widget

    - by Peter
    To show recent items from a Wordpress category in a widget I'm using this code... <ul> <?php $recent = new WP_Query("cat=1231&showposts=5"); while($recent->have_posts()) : $recent->the_post();?> <li><a href="<?php the_permalink() ?>" rel="bookmark"> <?php the_title(); ?> </a></li> <?php endwhile; ?> </ul> ...but how can I make this query also display the first image in each post, and is there any way to set a 'default' image in case there is no image? Is there also a way to use thumbnails here, rather than loading the full size image and using HTML to resize?

    Read the article

  • printing reverse in singly link list using pointers

    - by theoneabhinav
    i have been trying this code. i think the logic is ok but the program terminates abruptly when the display_rev function is called here is code of display_rev void display_rev(emp_node *head) { emp_node *p=head, *q; while(p->next != NULL) p=p->next; while(p!=head || p==head){ q=head; display_rec(p); while(q->next != p) q=q->next; p=q; } } here is my whole code #include<stdio.h> #include<stdlib.h> #include<ctype.h> #include<string.h> //Declarations=============================================================== typedef struct //employee record { int emp_id; char name[150]; char mob_no[11]; float salary; int proj[5]; struct emp_node *next; } emp_node; emp_node* add_rec(emp_node*); emp_node* create_db(emp_node*); emp_node* search_db(emp_node*, int); emp_node* delete_rec(emp_node*, int); void read_name(emp_node*); void read_mob(emp_node*); void display_db(emp_node*); void display_rec(emp_node*); void display_rev(emp_node*); void modify_rec(emp_node*); void swtch(emp_node*); //=========================================================================== int main() { char ans; emp_node *head = NULL; head = create_db(head); display_db(head); do { swtch(head); printf("\n\n\tDo you want to continue (y/n) : "); getchar(); scanf("%c", &ans); } while (ans == 'y' || ans == 'Y'); return 0; } //Definitions================================================================ emp_node* create_db(emp_node *head) //database creation { int i = 1, no; emp_node *p; printf("Enter number of employees:"); scanf("%d", &no); printf("\n\n"); head = (emp_node *) malloc(sizeof(emp_node)); head = add_rec(head); head->next = NULL; p = head; while (i < no) { p->next = (emp_node *) malloc(sizeof(emp_node)); p = p->next; p = add_rec(p); p->next = NULL; i++; } return head; } emp_node* add_rec(emp_node *p) //new record { int j; printf("\n\tEmployee ID : "); scanf("%d", &(p->emp_id)); printf("\n\tFirst Name:"); read_name(p); printf("\n\tMobile No.:"); read_mob(p); printf("\n\tSalary :"); scanf("%f", &(p->salary)); printf( "\n\tEnter \"1\" for the projects employee is working on, otherwise enter \"0\": \n"); for (j = 0; j < 5; j++) { printf("\n\t\tProject No. %d : ", j + 1); scanf("%d", &(p->proj[j])); while (p->proj[j] != 1 && p->proj[j] != 0) { printf("\n\nInvalid entry!! Please re-enter."); printf("\n\t\tProject No. %d : ", j + 1); scanf("%d", &(p->proj[j])); } } printf("\n\n\n"); return p; } void read_name(emp_node *p) //validation for name { int j, len; scanf("%s", p->name); len = strlen(p->name); for (j = 0; j < len; j++) { if (!isalpha(p->name[j])) { printf( "\n\n\tInvalid name!!Can contain only characters. Please Re-enter.\n"); printf("\n\tName : "); read_name(p); } } } void read_mob(emp_node *p) //validation for mobile no. { int j; scanf("%s", p->mob_no); while (strlen(p->mob_no) != 10) { printf("\n\nInvalid Mobile No!!Please Re-enter"); printf("\n\n\tMobile No.:"); read_mob(p); } for (j = 0; j < 10; j++) { if (!(48 <= p->mob_no[j] && p->mob_no[j] <= 57)) { printf( "\n\nInvalid Mobile No!!Can contain only digits. Please Re-enter."); printf("\n\n\tMobile No.:"); read_mob(p); } } } void display_db(emp_node *head) //displaying whole database { emp_node *p; p = head; printf("\n\n\t\t****** EMPLOYEE DATABASE ******\n"); printf( "\n=============================================================================="); printf("\n Id.\t Name\t\t Mobile No\t Salary\t Projects\n"); while (p != NULL) { display_rec(p); p = p->next; printf("\n\n\n"); } printf( "\n=============================================================================="); } void swtch(emp_node *head) //function for menu and switch case { int cho, x; emp_node *p; printf("\n\n\t\t****** MENU ******"); printf( "\n\n\t1. insert Record\n\t2. Search Record\n\t3. Modify Record\n\t4. Delete Record\n\t5. Display Reverse\n\t6. Exit"); printf("\n\tWhich operation do you want to perform? "); scanf("%d", &cho); switch (cho) { case 1: p=head; while(p->next != NULL) p=p->next; p->next = (emp_node *) malloc(sizeof(emp_node)); p=p->next; p = add_rec(p); p->next = NULL; display_db(head); break; case 2: printf("\n\n\tEnter employee ID whose record is to be Searched :"); scanf("%d", &x); p = search_db(head, x); if (p == NULL) printf("\n\nRecord not found."); else display_rec(p); break; case 3: printf("\n\n\tEnter employee ID whose record is to be modified :"); scanf("%d", &x); p = search_db(head, x); if (p == NULL) printf("\n\nRecord not found."); else modify_rec(p); display_db(head); break; case 4: printf("\n\n\tEnter employee ID whose record is to be deleted :"); scanf("%d", &x); head = delete_rec(head, x); display_db(head); break; case 5: display_rev(head); case 6: exit(0); default: printf("Invalid Choice!! Please try again."); } } emp_node* search_db(emp_node *head, int id) //search database { emp_node *p = head; while (p != NULL) { if (p->emp_id == id) return p; p = p->next; } return NULL; } void display_rec(emp_node *p) //display a single record { int j; printf("\n %d", p->emp_id); printf("\t %10s", p->name); printf("\t %10s", p->mob_no); printf("\t %05.2f", p->salary); printf("\t "); for (j = 0; j < 5; j++) { if (p->proj[j] == 1) printf(" %d,", j + 1); } } void modify_rec(emp_node *p) //modifying a record { int j, cho; char ch1, edt; do { printf( "\n\t1. Name\n\t2. Email Address\n\t3. Mobile No.\n\t4. Salary\n\t5. Date of birth\n\t6. Projects\n"); printf("Enter your choice : "); scanf("%d", &cho); switch (cho) { case 1: printf("\n\tPrevious name:%s", p->name); printf("\n\tDo you want to edit ? (y/n)"); getchar(); scanf("%c", &ch1); if (ch1 == 'y' || ch1 == 'Y') { printf("\n\tEnter New Name:"); read_name(p); } break; case 2: printf("\n\tPrevious Mobile No. : %s", p->mob_no); printf("\n\tDo you want to edit ? (y/n)"); getchar(); scanf("%c", &ch1); if (ch1 == 'y' || ch1 == 'Y') { printf("\n\tEnter New Mobile No. :"); read_mob(p); } break; case 3: printf("\n\tPrevious salary is : %f", p->salary); printf("\n\tDo you want to edit ? (y/n)"); getchar(); scanf("%c", &ch1); if (ch1 == 'y' || ch1 == 'Y') { printf("\n\tEnter New salary:"); scanf("%f", &(p->salary)); } break; case 4: printf("the employee is currently working on project no. "); for (j = 0; j < 5; j++) { if (p->proj[j] == 1) printf(" %d,", j + 1); } printf("\n\tDo you want to edit ? (y/n)"); getchar(); scanf("%c", &ch1); if (ch1 == 'y' || ch1 == 'Y') { printf( "\n\tEnter \"1\" for the projects employee is working on : \n"); for (j = 0; j < 5; j++) { printf("\n\t\tProject No. %d : ", j + 1); scanf("%d", &(p->proj[j])); while (p->proj[j] != 1) { printf("\n\nInvalid entry!! Please re-enter."); printf("\n\t\tProject No. %d : ", j + 1); scanf("%d", &(p->proj[j])); } } } break; default: printf("\n\nInvalid Choice!! Please Try again."); } printf("\n\nDo you want to edit any other fields ?(y/n)"); getchar(); scanf("%c", &edt); } while (edt == 'y' || edt == 'Y'); } emp_node* delete_rec(emp_node *head, int id) //physical deletion of record { emp_node *p = head, *q; if (head->emp_id == id) { head = head->next; free(p); return head; } else { q = p->next; while (q->emp_id != id) { p = p->next; q = q->next; } if (q->next == NULL) p->next = NULL; else p->next = q->next; free(q); return head; } } void display_rev(emp_node *head) { emp_node *p=head, *q; while(p->next != NULL) p=p->next; while(p!=head || p==head){ q=head; display_rec(p); while(q->next != p) q=q->next; p=q; } }

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • Python directory list returned to Django template

    - by Shu
    Total Python newb here. I have a images directory and I need to return the names and urls of those files to a django template that I can loop through for links. I know it will be the server path, but I can modify it via JS. I've tried os.walk, but I keep getting empty results.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • efficient list mapping in python

    - by Joey
    Hi everyone, I have the following input: input = [(dog, dog, cat, mouse), (cat, ruby, python, mouse)] and trying to have the following output: outputlist = [[0, 0, 1, 2], [1, 3, 4, 2]] outputmapping = {0:dog, 1:cat, 2:mouse, 3:ruby, 4:python, 5:mouse} Any tips on how to handle given with scalability in mind (var input can get really large).

    Read the article

< Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >