Search Results

Search found 11318 results on 453 pages for 'josh close'.

Page 443/453 | < Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >

  • C Language: Why I cannot transfer file from server to client?

    - by user275753
    I want to ask, why I cannot transfer file from server to client? When I start to send the file from server, the client side program will have problem. So, I spend some times to check the code, But I still cannot find out the problem Can anyone point out the problem for me? thanks a lot! [client side code] include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 define true 1 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET sockfd; int number,message; char outbuff[MAXLEN],inbuff[MAXLEN]; char PWD_buffer[_MAX_PATH]; struct sockaddr_in servaddr; FILE *fp; int numbytes; char buf[2048]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); if (argc != 2) errexit("client IPaddress"); if ( (sockfd = socket(AF_INET, SOCK_STREAM, 0)) == INVALID_SOCKET ) errexit("socket error: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_port = htons(S_PORT); if ( (servaddr.sin_addr.s_addr = inet_addr(argv[1])) == INADDR_NONE) errexit("inet_addr error: error number %d\n", WSAGetLastError()); if (connect(sockfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("connect error: error number %d\n", WSAGetLastError()); if ( (fp = fopen("C:\\users\\pc\\desktop\\COPY.c", "wb")) == NULL){ perror("fopen"); exit(1); } printf("Still NO PROBLEM!\n"); //Receive file from server while(1){ numbytes = read(sockfd, buf, sizeof(buf)); printf("read %d bytes, ", numbytes); if(numbytes == 0){ printf("\n"); break; } numbytes = fwrite(buf, sizeof(char), numbytes, fp); printf("fwrite %d bytes\n", numbytes); } fclose(fp); close(sockfd); return 0; } server side code include include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET listenfd, connfd; int number, message, numbytes; int h, i, j, alen; int nread; struct sockaddr_in servaddr, cliaddr; FILE *in_file, *out_file, *fp; char buf[4096]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); listenfd = socket(AF_INET, SOCK_STREAM, 0); if (listenfd == INVALID_SOCKET) errexit("cannot create socket: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_addr.s_addr = htonl(INADDR_ANY); servaddr.sin_port = htons(S_PORT); if (bind(listenfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("can't bind to port %d: error number %d\n", S_PORT, WSAGetLastError()); if (listen(listenfd, 5) == SOCKET_ERROR) errexit("can't listen on port %d: error number %d\n", S_PORT, WSAGetLastError()); alen = sizeof(SA); connfd = accept(listenfd, (SA *) &cliaddr, &alen); if (connfd == INVALID_SOCKET) errexit("accept failed: error number %d\n", WSAGetLastError()); printf("accept one client from %s!\n", inet_ntoa(cliaddr.sin_addr)); fp = fopen ("client.c", "rb"); // open file stored in server if (fp == NULL) { printf("\nfile NOT exist"); } //Sending file while(!feof(fp)){ numbytes = fread(buf, sizeof(char), sizeof(buf), fp); printf("fread %d bytes, ", numbytes); numbytes = write(connfd, buf, numbytes); printf("Sending %d bytes\n",numbytes); } fclose (fp); closesocket(listenfd); closesocket(connfd); return 0; }

    Read the article

  • Servlet dispatcher is currently unavailable

    - by theJava
    <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd"> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver" p:prefix="/WEB-INF/jsp/" p:suffix=".jsp" /> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName" value="com.mysql.jdbc.Driver"/> <property name="url" value="jdbc:mysql://127.0.0.1:3306/spring"/> <property name="username" value="monty"/> <property name="password" value="indian"/> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="myDataSource" /> <property name="annotatedClasses"> <list> <value>uk.co.vinoth.spring.domain.User</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.MySQLDialect</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.hbm2ddl.auto">create</prop> </props> </property> </bean> <bean id="myUserDAO" class="uk.co.vinoth.spring.dao.UserDAOImpl"> <property name="sessionFactory" ref="mySessionFactory"/> </bean> <bean name="/user/*.htm" class="uk.co.vinoth.spring.web.UserController" > <property name="userDAO" ref="myUserDAO" /> </bean> </beans> The above is my bean configuration, why do i get error when i run my application. My logs folder is empty... org.apache.catalina.loader.StandardClassLoader@122c9df org.springframework.web.servlet.DispatcherServlet java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.catalina.core.StandardContext loadOnStartup SEVERE: Servlet /interMedix threw load() exception java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.coyote.http11.Http11BaseProtocol start INFO: Starting Coyote HTTP/1.1 on http-8181 Dec 22, 2010 3:44:48 PM org.apache.jk.common.ChannelSocket init INFO: JK: ajp13 listening on /0.0.0.0:8009 Dec 22, 2010 3:44:48 PM org.apache.jk.server.JkMain start INFO: Jk running ID=0 time=0/27 config=null Dec 22, 2010 3:44:48 PM org.apache.catalina.storeconfig.StoreLoader load INFO: Find registry server-registry.xml at classpath resource Dec 22, 2010 3:44:49 PM org.apache.catalina.startup.Catalina start INFO: Server startup in 558 ms Dec 22, 2010 3:44:50 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable Dec 22, 2010 3:50:18 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable But i have added spring-web-mvc to my class path which does contain this class file.

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • Where would you document standardized complex data that is passed between many objects and methods?

    - by Eli
    Hi All, I often find myself with fairly complex data that represents something that my objects will be working on. For example, in a task-list app, several objects might work with an array of tasks, each of which has attributes, temporal expressions, sub tasks and sub sub tasks, etc. One object will collect data from web forms, standardize it into a format consumable by the class that will save them to the database, another object will pull them from the database, put them in the standard format and pass them to the display object, or the update object, etc. The data itself can become a fairly complex series of arrays and sub arrays, representing a 'task' or list of tasks. For example, the below might be one entry in a task list, in the format that is consumable by the various objects that will work on it. Normally, I just document this in a file somewhere with an example. However, I am thinking about the best way to add it to something like PHPDoc, or another standard doc system. Where would you document your consumable data formats that are for many or all of the objects / methods in your app? Array ( [Meta] => Array ( //etc. ) [Sched] => Array ( [SchedID] => 32 [OwnerID] => 2 [StatusID] => 1 [DateFirstTask] => 2011-02-28 [DateLastTask] => [MarginMonths] => 3 ) [TemporalExpressions] => Array ( [0] => Array ( [type] => dw [TemporalExpID] => 3 [ord] => 2 [day] => 6 [month] => 4 ) [1] => Array ( [type] => dm [TemporalExpID] => 32 [day] => 28 [month] => 2 ) ) [Task] => Array ( [SchedTaskID] => 32 [SchedID] => 32 [OwnerID] => 2 [UserID] => 5 [ClientID] => 9 [Title] => Close Prior Year [Body] => [DueTime] => ) [SubTasks] => Array ( [101] => Array ( [SchedSubTaskID] => 101 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Review Profit and Loss by Class [Body] => [DueDiff] => 0 ) [102] => Array ( [SchedSubTaskID] => 102 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Review Balance Sheet [Body] => [DueDiff] => 0 ) [103] => Array ( [SchedSubTaskID] => 103 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Review Current Year for Prior Year Expenses to Accrue [Body] => Look at Journal Entries that are templates as well. [DueDiff] => 0 ) [104] => Array ( [SchedSubTaskID] => 104 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Review Prior Year Membership from 11/1 - 12/31 to Accrue to Current Year [Body] => [DueDiff] => 0 ) [105] => Array ( [SchedSubTaskID] => 105 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Enter Vacation Accrual [Body] => [DueDiff] => 0 ) [106] => Array ( [SchedSubTaskID] => 106 [ParentST] => 105 [RootT] => 32 [UserID] => 2 [Title] => Email Peter requesting Vacation Status of Employees at Year End [Body] => We need Employee Name, Rate and Days of Vacation left to use. We also need to know if the employee used any of the prior year's vacation. [DueDiff] => 43 ) [107] => Array ( [SchedSubTaskID] => 107 [ParentST] => [RootT] => 32 [UserID] => 2 [Title] => Grants Receivable at Year End [Body] => [DueDiff] => 0 ) [108] => Array ( [SchedSubTaskID] => 108 [ParentST] => 107 [RootT] => 32 [UserID] => 2 [Title] => Email Peter Requesting if there were and Grants Receivable at year end [Body] => [DueDiff] => 43 ) ) )

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • Exception Error in c#

    - by Kumu
    using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.IO; using System.Runtime.Serialization.Formatters.Binary; namespace FoolballLeague { public partial class MainMenu : Form { FootballLeagueDatabase footballLeagueDatabase; Game game; Login login; public MainMenu() { InitializeComponent(); changePanel(1); } public MainMenu(FootballLeagueDatabase footballLeagueDatabaseIn) { InitializeComponent(); footballLeagueDatabase = footballLeagueDatabaseIn; } private void Form_Loaded(object sender, EventArgs e) { } private void gameButton_Click(object sender, EventArgs e) { int option = 0; changePanel(option); } private void scoreboardButton_Click(object sender, EventArgs e) { int option = 1; changePanel(option); } private void changePanel(int optionIn) { gamePanel.Hide(); scoreboardPanel.Hide(); string title = "Football League System"; switch (optionIn) { case 0: gamePanel.Show(); this.Text = title + " - Game Menu"; break; case 1: scoreboardPanel.Show(); this.Text = title + " - Display Menu"; break; } } private void logoutButton_Click(object sender, EventArgs e) { login = new Login(); login.Show(); this.Hide(); } private void addGameButton_Click(object sender, EventArgs e) { if ((homeTeamTxt.Text.Length) == 0) MessageBox.Show("You must enter a Home Team"); else if (homeScoreUpDown.Value > 9 || homeScoreUpDown.Minimum < 0) MessageBox.Show("You must enter one digit between 0 and 9"); else if ((awayTeamTxt.Text.Length) == 0) MessageBox.Show("You must enter a Away Team"); else if (homeScoreUpDown.Value > 9 || homeScoreUpDown.Value < 0) MessageBox.Show("You must enter one digit between 0 to 9"); else { //checkGameInputFields(); game = new Game(homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); MessageBox.Show("Home Team -" + '\t' + homeTeamTxt.Text + '\t' + "and" + '\r' + "Away Team -" + '\t' + awayTeamTxt.Text + '\t' + "created"); footballLeagueDatabase.AddGame(game); //clearCreateStudentInputFields(); } } private void timer1_Tick(object sender, EventArgs e) { displayDateAndTime(); } private void displayDateAndTime() { dateLabel.Text = DateTime.Today.ToLongDateString(); timeLabel.Text = DateTime.Now.ToShortTimeString(); } private void displayResultsButton_Click(object sender, EventArgs e) { Game game = new Game(homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); gameResultsListView.Items.Clear(); gameResultsListView.View = View.Details; ListViewItem row = new ListViewItem(); row.SubItems.Add(game.HomeTeam.ToString()); row.SubItems.Add(game.HomeScore.ToString()); row.SubItems.Add(game.AwayTeam.ToString()); row.SubItems.Add(game.AwayScore.ToString()); gameResultsListView.Items.Add(row); } private void displayGamesButton_Click(object sender, EventArgs e) { Game game = new Game("Home", 2, "Away", 4);//homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); modifyGamesListView.Items.Clear(); modifyGamesListView.View = View.Details; ListViewItem row = new ListViewItem(); row.SubItems.Add(game.HomeTeam.ToString()); row.SubItems.Add(game.HomeScore.ToString()); row.SubItems.Add(game.AwayTeam.ToString()); row.SubItems.Add(game.AwayScore.ToString()); modifyGamesListView.Items.Add(row); } } } This is the whole code and I got same error like previous question. Unhandled Exception has occurred in you application.If you click...............click Quit.the application will close immediately. Object reference not set to an instance of an object. And the following details are in the error message. ***** Exception Text ******* System.NullReferenceException: Object reference not set to an instance of an object. at FoolballLeague.MainMenu.addGameButton_Click(Object sender, EventArgs e) in C:\Users\achini\Desktop\FootballLeague\FootballLeague\MainMenu.cs:line 91 at System.Windows.Forms.Control.OnClick(EventArgs e) at System.Windows.Forms.Button.OnMouseUp(MouseEventArgs mevent) at System.Windows.Forms.Control.WmMouseUp(Message& m, MouseButtons button, Int32 clicks) at System.Windows.Forms.Control.WndProc(Message& m) at System.Windows.Forms.ButtonBase.WndProc(Message& m) at System.Windows.Forms.Button.WndProc(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.WndProc(Message& m) at System.Windows.Forms.NativeWindow.Callback(IntPtr hWnd, Int32 msg, IntPtr wparam, IntPtr lparam) I need to add the games to using the addGameButton and the save those added games and display them in the list view (gameResultsListView). Now I can add a game and display in the list view.But when I pressed the button addGameButton I got the above error message. If you can please give me a solution to this problem.

    Read the article

  • deadlock when using WCF Duplex Polling with Silverlight

    - by Kobi Hari
    Hi all. I have followed Tomek Janczuk's demonstration on silverlight tv to create a chat program that uses WCF Duplex Polling web service. The client subscribes to the server, and then the server initiates notifications to all connected clients to publish events. The Idea is simple, on the client, there is a button that allows the client to connect. A text box where the client can write a message and publish it, and a bigger text box that presents all the notifications received from the server. I connected 3 clients (in different browsers - IE, Firefox and Chrome) and it all works nicely. They send messages and receive them smoothly. The problem starts when I close one of the browsers. As soon as one client is out, the other clients get stuck. They stop getting notifications. I am guessing that the loop in the server that goes through all the clients and sends them the notifications is stuck on the client that is now missing. I tried catching the exception and removing it from the clients list (see code) but it still does not help. any ideas? The server code is as follows: using System; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Activation; using System.Collections.Generic; using System.Runtime.Remoting.Channels; namespace ChatDemo.Web { [ServiceContract] public interface IChatNotification { // this will be used as a callback method, therefore it must be one way [OperationContract(IsOneWay=true)] void Notify(string message); [OperationContract(IsOneWay = true)] void Subscribed(); } // define this as a callback contract - to allow push [ServiceContract(Namespace="", CallbackContract=typeof(IChatNotification))] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] [ServiceBehavior(InstanceContextMode=InstanceContextMode.Single)] public class ChatService { SynchronizedCollection<IChatNotification> clients = new SynchronizedCollection<IChatNotification>(); [OperationContract(IsOneWay=true)] public void Subscribe() { IChatNotification cli = OperationContext.Current.GetCallbackChannel<IChatNotification>(); this.clients.Add(cli); // inform the client it is now subscribed cli.Subscribed(); Publish("New Client Connected: " + cli.GetHashCode()); } [OperationContract(IsOneWay = true)] public void Publish(string message) { SynchronizedCollection<IChatNotification> toRemove = new SynchronizedCollection<IChatNotification>(); foreach (IChatNotification channel in this.clients) { try { channel.Notify(message); } catch { toRemove.Add(channel); } } // now remove all the dead channels foreach (IChatNotification chnl in toRemove) { this.clients.Remove(chnl); } } } } The client code is as follows: void client_NotifyReceived(object sender, ChatServiceProxy.NotifyReceivedEventArgs e) { this.Messages.Text += string.Format("{0}\n\n", e.Error != null ? e.Error.ToString() : e.message); } private void MyMessage_KeyDown(object sender, KeyEventArgs e) { if (e.Key == Key.Enter) { this.client.PublishAsync(this.MyMessage.Text); this.MyMessage.Text = ""; } } private void Button_Click(object sender, RoutedEventArgs e) { this.client = new ChatServiceProxy.ChatServiceClient(new PollingDuplexHttpBinding { DuplexMode = PollingDuplexMode.MultipleMessagesPerPoll }, new EndpointAddress("../ChatService.svc")); // listen for server events this.client.NotifyReceived += new EventHandler<ChatServiceProxy.NotifyReceivedEventArgs>(client_NotifyReceived); this.client.SubscribedReceived += new EventHandler<System.ComponentModel.AsyncCompletedEventArgs>(client_SubscribedReceived); // subscribe for the server events this.client.SubscribeAsync(); } void client_SubscribedReceived(object sender, System.ComponentModel.AsyncCompletedEventArgs e) { try { Messages.Text += "Connected!\n\n"; gsConnect.Color = Colors.Green; } catch { Messages.Text += "Failed to Connect!\n\n"; } } And the web config is as follows: <system.serviceModel> <extensions> <bindingExtensions> <add name="pollingDuplex" type="System.ServiceModel.Configuration.PollingDuplexHttpBindingCollectionElement, System.ServiceModel.PollingDuplex, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35"/> </bindingExtensions> </extensions> <behaviors> <serviceBehaviors> <behavior name=""> <serviceMetadata httpGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="false"/> </behavior> </serviceBehaviors> </behaviors> <bindings> <pollingDuplex> <binding name="myPollingDuplex" duplexMode="MultipleMessagesPerPoll"/> </pollingDuplex> </bindings> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <services> <service name="ChatDemo.Web.ChatService"> <endpoint address="" binding="pollingDuplex" bindingConfiguration="myPollingDuplex" contract="ChatDemo.Web.ChatService"/> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange"/> </service> </services> </system.serviceModel>

    Read the article

  • JTabbedPane: only first tab is drawn, the second is always empty (newbie Q)

    - by paul
    I created a very simple JTabbedPane by first creating an empty JTabbedPane object, then 2 JPanels that I later add. Each JPanel is holding a object that extends JButton and implements MouseListener. Each of these holds a different image loaded from a file; the image is held locally as a buffered image and as an image icon, etc., all of which works great. The point of all that is to allow resizing of the image when the button is resized (using getscaledinstance()), because the panel is resized, because the JTabbedPane is resized, etc., within the JFrame that holds everything. I override paintComponent() to accomplish this in the class that extends JButton. I am using MigLayout Manager, and all is well on that front controlling layout constraints, growing, filling, initial sizes, preferred sizes, etc. The images the buttons hold are of different sizes and proportions, but this caused no trouble before. Up until 2 days ago everything worked fairly well. I made some changes trying to tweak some resizing issues as I was picking up MigLayout manager. At the time I was playing around with setting various min, max, and preferred sizes using the methods provided for by the components, not the layout manager. I also fooled a bit with pack(), validate(), visible(), opaque() etc., and yes I read the article about Swing and AWT painting here: http://java.sun.com/products/jfc/tsc/articles/painting/ , and I switched to relying more and more on MigLayout. On an unrelated note, it appears JFrame's do not honor maxsize? Somehow, today, with and without using any of these methods provided by swing, with or without using MigLayout manager to handle some of these matters instead, I now have a JTabbedPane that correctly displays the FIRST JPanel I add, but NOT THE SECOND JPanel--which, while present as a tab--does not show when selected. I have switched the order of which panel is added first, and this still holds true regardless of which JPanel I add first, telling me the JPanels are ok, and the problem is most likely in the JTabbedPane. I click on the second tab, the JTabbedPane switches, but I have what appears to be a blank button in the JPanel. A few console system-out statements reveal the following: a) that the second panel and its button are constructed b) no mouse events are being captured when I click on where the second panel and button should reside, as if it didn't exist at that point; c) when I switch to the second tab, the overrided paintComponent() method of the button within that second JPanel is never called, so it is in fact never being painted despite the tab in which it resides becoming visible; d) the JTabbpedPane getComponentCount() returns a correct value of 2 after adding the 2nd panel; e) MigLayout manager actually rocks, but I digress... I cannot now revert to my older code, and despite my best efforts to undo whatever changes caused this, I cannot fix my new problem. I've commented out everything but the most essential calls: constructors for each object--with MigLayout; add() for placing the buttons on the panels using string-arguments appropriate for MigLayout; add() for placing the panels on the JTabbedPane, also with MigLayout string arguments; setting the default op on close for the JFrame; and setting the JFrame visible. This means I do not fiddle with optimization settings, double buffering settings, opaque settings, but leave them as default, and still, no fix; the second panel will not show itself. Each panel, I should add, when it is the first to be loaded, works fine, again re-affirming that the panels and buttons are themselves ok. Here is part of what I am doing: //Note: BuildaButton is a class that merely constructs my instances File f = new File("/foo.jpg"); button1 = new BuildaButton().BuildaButton(f).buildfoo1Button(); f = new File("/foo2.jpg"); button2 = new BuildaButton().BuildaButton(f).buildfoo2Button(); MigLayout ml = new MigLayout("wrap 1", "[fill, grow]0[fill, grow]", "[fill, grow]0[fill, grow]"); MigLayout ml2 = new MigLayout("wrap 2", "[fill, grow]5[fill, grow]", "[fill, grow]0[fill, grow]"); foo1panel = new JPanel(ml); foo1panel.add(button1, "w 234:945:, h 200:807:"); foo2panel = new JPanel(ml); foo2panel.add(button2, "w 186:752:, h 200:807:"); tabs.add("foo1", foo1panel); tabs.add("foo2", foo2panel); System.out.println("contents of tabs: " + tabs.getComponentCount() + " elements"); mainframe.setLayout(ml2); mainframe.setMinimumSize(new Dimension(850,800)); mainframe.add(tabs, "w 600:800:, h 780:780:"); //controlpanel is a still blank jpanel that holds nothing--it is a space holder for now & will be utilized mainframe.add(controlpanel, "w 200:200:200, h 780:780:"); mainframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); mainframe.setVisible(true); Thank you in advance for any help you can give.

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • How should I delete a child object from within a parent's slot? Possibly boost::asio specific.

    - by kaliatech
    I have written a network server class that maintains a std::set of network clients. The network clients emit a signal to the network server on disconnect (via boost::bind). When a network client disconnects, the client instance needs to be removed from the Set and eventually deleted. I would think this is a common pattern, but I am having problems that might, or might not, be specific to ASIO. I've tried to trim down to just the relevant code: /** NetworkServer.hpp **/ class NetworkServices : private boost::noncopyable { public: NetworkServices(void); ~NetworkServices(void); private: void run(); void onNetworkClientEvent(NetworkClientEvent&); private: std::set<boost::shared_ptr<const NetworkClient>> clients; }; /** NetworkClient.cpp **/ void NetworkServices::run() { running = true; boost::asio::io_service::work work(io_service); //keeps service running even if no operations // This creates just one thread for the boost::asio async network services boost::thread iot(boost::bind(&NetworkServices::run_io_service, this)); while (running) { boost::system::error_code err; try { tcp::socket* socket = new tcp::socket(io_service); acceptor->accept(*socket, err); if (!err) { NetworkClient* networkClient = new NetworkClient(io_service, boost::shared_ptr<tcp::socket>(socket)); networkClient->networkClientEventSignal.connect(boost::bind(&NetworkServices::onNetworkClientEvent, this, _1)); clients.insert(boost::shared_ptr<NetworkClient>(networkClient)); networkClient->init(); //kicks off 1st asynch_read call } } // etc... } } void NetworkServices::onNetworkClientEvent(NetworkClientEvent& evt) { switch(evt.getType()) { case NetworkClientEvent::CLIENT_ERROR : { boost::shared_ptr<const NetworkClient> clientPtr = evt.getClient().getSharedPtr(); // ------ THIS IS THE MAGIC LINE ----- // If I keep this, the io_service hangs. If I comment it out, // everything works fine (but I never delete the disconnected NetworkClient). // If actually deleted the client here I might expect problems because it is the caller // of this method via boost::signal and bind. However, The clientPtr is a shared ptr, and a // reference is being kept in the client itself while signaling, so // I would the object is not going to be deleted from the heap here. That seems to be the case. // Never-the-less, this line makes all the difference, most likely because it controls whether or not the NetworkClient ever gets deleted. clients.erase(clientPtr); //I should probably put this socket clean-up in NetworkClient destructor. Regardless by doing this, // I would expect the ASIO socket stuff to be adequately cleaned-up after this. tcp::socket& socket = clientPtr->getSocket(); try { socket.shutdown(boost::asio::socket_base::shutdown_both); socket.close(); } catch(...) { CommServerContext::error("Error while shutting down and closing socket."); } break; } default : { break; } } } /** NetworkClient.hpp **/ class NetworkClient : public boost::enable_shared_from_this<NetworkClient>, Client { NetworkClient(boost::asio::io_service& io_service, boost::shared_ptr<tcp::socket> socket); virtual ~NetworkClient(void); inline boost::shared_ptr<const NetworkClient> getSharedPtr() const { return shared_from_this(); }; boost::signal <void (NetworkClientEvent&)> networkClientEventSignal; void onAsyncReadHeader(const boost::system::error_code& error, size_t bytes_transferred); }; /** NetworkClient.cpp - onAsyncReadHeader method called from io_service.run() thread as result of an async_read operation. Error condition usually result of an unexpected client disconnect.**/ void NetworkClient::onAsyncReadHeader( const boost::system::error_code& error, size_t bytes_transferred) { if (error) { //Make sure this instance doesn't get deleted from parent/slot deferencing //Alternatively, somehow schedule for future delete? boost::shared_ptr<const NetworkClient> clientPtr = getSharedPtr(); //Signal to service that this client is disconnecting NetworkClientEvent evt(*this, NetworkClientEvent::CLIENT_ERROR); networkClientEventSignal(evt); networkClientEventSignal.disconnect_all_slots(); return; } I believe it's not safe to delete the client from within the slot handler because the function return would be ... undefined? (Interestingly, it doesn't seem to blow up on me though.) So I've used boost:shared_ptr along with shared_from_this to make sure the client doesn't get deleted until all slots have been signaled. It doesn't seem to really matter though. I believe this question is not specific to ASIO, but the problem manifests in a peculiar way when using ASIO. I have one thread executing io_service.run(). All ASIO read/write operations are performed asynchronously. Everything works fine with multiple clients connecting/disconnecting UNLESS I delete my client object from the Set per the code above. If I delete my client object, the io_service seemingly deadlocks internally and no further asynchronous operations are performed unless I start another thread. I have try/catches around the io_service.run() call and have not been able to detect any errors. Questions: Are there best practices for deleting child objects, that are also signal emitters, from within parent slots? Any ideas as to why the io_service is hanging when I delete my network client object?

    Read the article

  • jQuery not refreshing tabs content in IE

    - by iddimu
    Hi all! I have a page that is using jQuery tabs. Within one of my tabs I have a div that contains a form (initially hidden) that I want to use to add content to the tab. What I have works perfectly in Chrome, Firefox, and Safari. But, in IE 7 the tab will not refresh. The post works and the data gets added to the database, but it simply will not show the new content after submitting it. I don't think it matters - but, just for information I am using the Codeigniter PHP framework as well. Here is my javascript: <script type="text/javascript"> $(document).ready(function(){ // initialize the addChild form as hidden until user requests it open $('#addChild').hide(); // open the form $('#openDialog').click( function(){ $('#addChild').slideToggle(); return false; }); // close the form $('#closeDialog').click( function(){ $('#addChild').slideToggle(); return false; }); // submit the form $('#frmAddChild').submit( function(){ $('#addChild').slideToggle(); $.ajax({ url: '/children/add', type: 'POST', data: $('#frmAddChild').serialize() //cache: false }); //reload the children tab $('#tabs').tabs('load',3); return false; }); }); </script> And, here is my PHP/HTML: <?php // initialize the elements of the form $frmAddChild = array( 'name' => 'frmAddChild', 'id' => 'frmAddChild', 'method' => 'post' ); $child_name = array( 'name' => 'child_name', 'id' => 'child_name', ); $child_dob = array( 'name' => 'child_dob', 'id' => 'child_dob' ); $btnOpenDialog = array( 'name' => 'openDialog', 'id' => 'openDialog', 'value' => 'true', 'content' => 'Add Child' ); $btnCloseDialog = array( 'name' => 'closeDialog', 'id' => 'closeDialog', 'value' => 'true', 'content' => 'Cancel' ); // button that shows the drop down to add echo form_button($btnOpenDialog); ?> <div id="addChild" title="Add Child"> <?php echo form_open('children/add/',$frmAddChild); ?> <table> <tr> <td> <?php echo form_label('Child\'s Name', 'child_name'); ?>: </td> <td> <?php echo form_input($child_name); ?> </td> </tr> <tr> <td> <?php echo form_label('Date of Birth','child_dob'); ?>: </td> <td> <?php echo form_input($child_dob); ?> </td> </tr> <tr> <td colspan="2" align="right"> <?php echo form_submit('submit', 'Add'); ?> <?php echo form_button($btnCloseDialog); ?> </td> </tr> </table> <?php echo form_close(); ?> </div> Does anyone have any ideas how I can get this working correctly in IE? Also, if anyone has any comments about how I have things structured, please let me know. I'm new to Codeigniter and I am by no means a javascript or jQuery expert. Thanks for your help!

    Read the article

  • Service injection into Controller (Spring MVC)

    - by ThaSaleni
    Hi I have a Spring web application, I have built it up to the controller stage and I could inject my Daos, into my Services fine. Now when I want to inject my Service into my controller i get an error for dependency with the Dao and further down the sessionFactory. I don't want to inject these again cause this will ultimately lead me to eventually create a data source but I have my Daos for data access and they already know about sessionFactory. Am I missing something here? here's the sample code snippets My Service: @Service("productService") @Transactional public class ProductServiceImpl implements ProductService { private ProductDao productDao; @Autowired public void setDao(ProductDao productDao) { this.productDao = productDao; } My Controller @Controller @WebServlet(name="controllerServlet", loadOnStartup= urlPatterns=...}) public class ControllerServlet extends HttpServlet { boolean isUserLogedIn =false; @Autowired private ProductService productService; public void setProductService(ProductService productService){ this.productService = productService; } Servlet-context Stack trace javax.servlet.ServletException: Servlet.init() for servlet mvcServlet threw exception org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:472) org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:98) org.apache.catalina.valves.AccessLogValve.invoke(AccessLogValve.java:927) org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:407) org.apache.coyote.http11.AbstractHttp11Processor.process(AbstractHttp11Processor.java:999) org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java: 565) org.apache.tomcat.util.net.AprEndpoint$SocketProcessor.run(AprEndpoint.java:1812) java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) java.lang.Thread.run(Thread.java:662) root cause org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'controllerServlet': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: private com.phumzile.acme.services.ProductService com.phumzile.acme.client.web.controller.ControllerServlet.productService; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No matching bean of type [com.phumzile.acme.services.ProductService] found for dependency: expected at least 1 bean which qualifies as autowire candidate for this dependency. Dependency annotations: {@org.springframework.beans.factory.annotation.Autowired(required=true)} org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor.p ostProcessPropertyValues(AutowiredAnnotationBeanPostProcessor.java:287) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1106) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:294) org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:225) SERVLET-CONTEXT <context:component-scan base-package="com.phumzile.acme.client" /> <!-- Enables the Spring MVC @Controller programming model --> <mvc:annotation-driven /> </beans> APP-CONFIG <bean id="propertyConfigurer" class="org.springframework.beans.factory.config.PropertyPlaceholderConfigurer"> <property name="locations"> <list> <value>configuration.properties</value> </list> </property> </bean> <context:annotation-config/> <context:component-scan base-package="com.phumzile.acme" /> <import resource="db-config.xml" /> </beans> DB-CONFIG <bean id="dataSource" class="com.mchange.v2.c3p0.ComboPooledDataSource" destroy-method="close"> <property name="idleConnectionTestPeriod" value="10800"/> <property name="maxIdleTime" value="21600"/> <property name="driverClass"> <value>${jdbc.driver.className}</value> </property> <property name="jdbcUrl"> <value>${jdbc.url}</value> </property> <property name="user"> <value>${jdbc.username}</value> </property> <property name="password"> <value>${jdbc.password}</value> </property> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.a nnotation.AnnotationSessionFactoryBean"> <property name="dataSource"> <ref bean="dataSource" /> </property> <property name="annotatedClasses"> <list> <!-- Entities --> <value>com.phumzile.acme.model.User</value> <value>com.phumzile.acme.model.Person</value> <value>com.phumzile.acme.model.Company</value> <value>com.phumzile.acme.model.Product</value> <value>com.phumzile.acme.model.Game</value> <value>com.phumzile.acme.model.Book</value> <!-- Entities --> </list> </property> <property name="packagesToScan" value="com.phumzile.acme" /> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">${jdbc.hibernate.dialect </prop> <prop key="hibernate.hbm2ddl.auto">validate</prop> <prop key="hibernate.show_sql">true</prop> </props> </property> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory"> <ref bean="sessionFactory" /> </property> </bean> <tx:annotation-driven /> </beans> CONFIGURATION.PROPERTIES jdbc.driver.className=com.mysql.jdbc.Driver jdbc.url=jdbc:mysql://localhost:3306/mydb jdbc.username=root jdbc.password=root jdbc.hibernate.dialect=org.hibernate.dialect.MySQLDialect

    Read the article

  • How do I remove the time from printpreview dialog?

    - by Albo Best
    Here is my code: Imports System.Data.OleDb Imports System.Drawing.Printing Namespace Print Public Class Form1 Inherits System.Windows.Forms.Form Dim PrintC As PrinterClass Dim conn As OleDb.OleDbConnection Dim connectionString As String = "Provider=Microsoft.Jet.OLEDB.4.0;Data Source=..\\db1.mdb" Dim sql As String = String.Empty Dim ds As DataSet Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load FillDataGrid() '//create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) End Sub Private Sub FillDataGrid() Try Dim dt As New DataTable Dim ds As New DataSet ds.Tables.Add(dt) Dim da As New OleDbDataAdapter con.Open() da = New OleDbDataAdapter("SELECT * from klient ", con) da.Fill(dt) con.Close() dataGrid.DataSource = dt.DefaultView Dim dTable As DataTable For Each dTable In ds.Tables Dim dgStyle As DataGridTableStyle = New DataGridTableStyle dgStyle.MappingName = dTable.TableName dataGrid.TableStyles.Add(dgStyle) Next ' DataGrid settings dataGrid.CaptionText = "TE GJITHE KLIENTET" dataGrid.HeaderFont = New Font("Verdana", 12) dataGrid.TableStyles(0).GridColumnStyles(0).Width = 60 dataGrid.TableStyles(0).GridColumnStyles(1).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(2).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(3).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(4).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(5).HeaderText = "" dataGrid.TableStyles(0).GridColumnStyles(5).Width = -1 Catch ex As Exception MessageBox.Show(ex.Message) End Try End Sub Private Sub btnPrint_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPrint.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) PrintDocument1.Print() End Sub Private Sub btnPreview_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPreview.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) ''preview Dim ps As New PaperSize("A4", 840, 1150) ps.PaperName = PaperKind.A4 PrintDocument1.DefaultPageSettings.PaperSize = ps PrintPreviewDialog1.WindowState = FormWindowState.Normal PrintPreviewDialog1.StartPosition = FormStartPosition.CenterScreen PrintPreviewDialog1.ClientSize = New Size(600, 600) PrintPreviewDialog1.ShowDialog() End Sub Private Sub PrintDocument1_PrintPage(ByVal sender As System.Object, ByVal e As System.Drawing.Printing.PrintPageEventArgs) Handles PrintDocument1.PrintPage 'print grid Dim morepages As Boolean = PrintC.Print(e.Graphics) If (morepages) Then e.HasMorePages = True End If End Sub End Class End Namespace This is how data looks in DataGrid (that's perfect)... and here is how it looks when I click PrintPreview. (I don't want the time to appear there, the "12:00:00" part. in database the date is stored as Short Date (10-Dec-12) Can somebody suggest a way around that? Imports System Imports System.Windows.Forms Imports System.Drawing Imports System.Drawing.Printing Imports System.Collections Imports System.Data Namespace Print Public Class PrinterClass '//clone of Datagrid Dim PrintGrid As Grid '//printdocument for initial printer settings Private PrintDoc As PrintDocument '//defines whether the grid is ordered right to left Private bRightToLeft As Boolean '//Current Top Private CurrentY As Single = 0 '//Current Left Private CurrentX As Single = 0 '//CurrentRow to print Private CurrentRow As Integer = 0 '//Page Counter Public PageCounter As Integer = 0 '/// <summary> '/// Constructor Class '/// </summary> '/// <param name="pdocument"></param> '/// <param name="dgrid"></param> Public Sub New(ByVal pdocument As PrintDocument, ByVal dgrid As DataGrid) 'MyBase.new() PrintGrid = New Grid(dgrid) PrintDoc = pdocument '//The grid columns are right to left bRightToLeft = dgrid.RightToLeft = RightToLeft.Yes '//init CurrentX and CurrentY CurrentY = pdocument.DefaultPageSettings.Margins.Top CurrentX = pdocument.DefaultPageSettings.Margins.Left End Sub Public Function Print(ByVal g As Graphics, ByRef currentX As Single, ByRef currentY As Single) As Boolean '//use predefined area currentX = currentX currentY = currentY PrintHeaders(g) Dim Morepages As Boolean = PrintDataGrid(g) currentY = currentY currentX = currentX Return Morepages End Function Public Function Print(ByVal g As Graphics) As Boolean CurrentX = PrintDoc.DefaultPageSettings.Margins.Left CurrentY = PrintDoc.DefaultPageSettings.Margins.Top PrintHeaders(g) Return PrintDataGrid(g) End Function '/// <summary> '/// Print the Grid Headers '/// </summary> '/// <param name="g"></param> Private Sub PrintHeaders(ByVal g As Graphics) Dim sf As StringFormat = New StringFormat '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = 0 To PrintGrid.Columns - 1 '//set header alignment Select Case (CType(PrintGrid.Headers.GetValue(i), Header).Alignment) Case HorizontalAlignment.Left 'left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX -= PrintGrid.Headers(i).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX += PrintGrid.Headers(i).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY = CurrentY + CType(PrintGrid.Headers.GetValue(0), Header).Height End Sub Private Function PrintDataGrid(ByVal g As Graphics) As Boolean Dim sf As StringFormat = New StringFormat PageCounter = PageCounter + 1 '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = CurrentRow To PrintGrid.Rows - 1 Dim j As Integer For j = 0 To PrintGrid.Columns - 1 '//set cell alignment Select Case (PrintGrid.Cell(i, j).Alignment) '//left Case HorizontalAlignment.Left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center '//right Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX -= PrintGrid.Cell(i, j).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text '//Draw text by alignment g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX += PrintGrid.Cell(i, j).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY += PrintGrid.Cell(i, 0).Height CurrentRow += 1 '//if we are beyond the page margin (bottom) then we need another page, '//return true If (CurrentY > PrintDoc.DefaultPageSettings.PaperSize.Height - PrintDoc.DefaultPageSettings.Margins.Bottom) Then Return True End If Next Return False End Function End Class End Namespace

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • plugin instancing

    - by Hailwood
    Hi guys, I am making a jquery tagging plugin. I have an issue that, When there is multiple instances of the plugin on the page, if you click on any <ul> that the plugin has been called on it will put focus on the <input /> in the last <ul> that the plugin has been called on. Why is this any how can I fix it. $.widget("ui.tagit", { // default options options: { tagSource: [], triggerKeys: ['enter', 'space', 'comma', 'tab'], initialTags: [], minLength: 1 }, //private variables _vars: { lastKey: null, element: null, input: null, tags: [] }, _keys: { backspace: 8, enter: 13, space: 32, comma: 44, tab: 9 }, //initialization function _create: function() { var instance = this; //store reference to the ul this._vars.element = this.element; //add class "tagit" for theming this._vars.element.addClass("tagit"); //add any initial tags added through html to the array this._vars.element.children('li').each(function() { instance.options.initialTags.push($(this).text()); }); //add the html input this._vars.element.html('<li class="tagit-new"><input class="tagit-input" type="text" /></li>'); this._vars.input = this._vars.element.find(".tagit-input"); //setup click handler $(this._vars.element).click(function(e) { if (e.target.tagName == 'A') { // Removes a tag when the little 'x' is clicked. $(e.target).parent().remove(); instance._popTag(); } else { instance._vars.input.focus(); } }); //setup autcomplete handler this.options.appendTo = this._vars.element; this.options.source = this.options.tagSource; this.options.select = function(event, ui) { instance._addTag(ui.item.value); return false; } this._vars.input.autocomplete(this.options); //setup keydown handler this._vars.input.keydown(function(e) { var lastLi = instance._vars.element.children(".tagit-choice:last"); if (e.which == instance._keys.backspace) return instance._backspace(lastLi); if (instance._isInitKey(e.which)) { event.preventDefault(); if ($(this).val().length >= instance.options.minLength) instance._addTag($(this).val()); } if (lastLi.hasClass('selected')) lastLi.removeClass('selected'); instance._vars.lastKey = e.which; }); //setup blur handler this._vars.input.blur(function() { instance._addTag($(this).val()); $(this).val(''); }); //define missing trim function for strings String.prototype.trim = function() { return this.replace(/^\s+|\s+$/g, ""); }; this._initialTags(); }, _popTag: function() { return this._vars.tags.pop(); } , _addTag: function(value) { this._vars.input.val(""); value = value.replace(/,+$/, ""); value = value.trim(); if (value == "" || this._exists(value)) return false; var tag = ""; tag = '<li class="tagit-choice">' + value + '<a class="tagit-close">x</a></li>'; $(tag).insertBefore(this._vars.input.parent()); this._vars.input.val(""); this._vars.tags.push(value); } , _exists: function(value) { if (this._vars.tags.length == 0 || $.inArray(value, this._vars.tags) == -1) return false; return true; } , _isInitKey : function(keyCode) { var keyName = ""; for (var key in this._keys) if (this._keys[key] == keyCode) keyName = key if ($.inArray(keyName, this.options.triggerKeys) != -1) return true; return false; } , _backspace: function(li) { if (this._vars.input.val() == "") { // When backspace is pressed, the last tag is deleted. if (this._vars.lastKey == this._keys.backspace) { this._popTag(); li.remove(); this._vars.lastKey = null; } else { li.addClass('selected'); this._vars.lastKey = this._keys.backspace; } } return true; } , _initialTags: function() { if (this.options.initialTags.length != 0) { for (var i in this.options.initialTags) if (!this._exists(this.options.initialTags[i])) this._addTag(this.options.initialTags[i]); } } , tags: function() { return this._vars.tags; } , destroy: function() { $.Widget.prototype.destroy.apply(this, arguments); // default destroy this._vars['tags'] = []; } }) ;

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • Yet another C# Deadlock Debugging Question

    - by Roo
    Hi All, I have a multi-threaded application build in C# using VS2010 Professional. It's quite a large application and we've experienced the classing GUI cross-threading and deadlock issues before, but in the past month we've noticed the appears to lock up when left idle for around 20-30 minutes. The application is irresponsive and although it will repaint itself when other windows are dragged in front of the application and over it, the GUI still appears to be locked... interstingly (unlike if the GUI thread is being used for a considerable amount of time) the Close, Maximise and minimise buttons are also irresponsive and when clicked the little (Not Responding...) text is not displayed in the title of the application i.e. Windows still seems to think it's running fine. If I break/pause the application using the debugger, and view the threads that are running. There are 3 threads of our managed code that are running, and a few other worker threads whom the source code cannot be displayed for. The 3 threads that run are: The main/GUI thread A thread that loops indefinitely A thread that loops indefinitely If I step into threads 2 and 3, they appear to be looping correctly. They do not share locks (even with the main GUI thread) and they are not using the GUI thread at all. When stepping into the main/GUI thread however, it's broken on Application.Run... This problem screams deadlock to me, but what I don't understand is if it's deadlock, why can't I see the line of code the main/GUI thread is hanging on? Any help will be greatly appreciated! Let me know if you need more information... Cheers, Roo -----------------------------------------------------SOLUTION-------------------------------------------------- Okay, so the problem is now solved. Thanks to everyone for their suggestions! Much appreciated! I've marked the answer that solved my initial problem of determining where on the main/UI thread the application hangs (I handn't turned off the "Enable Just My Code" option). The overall issue I was experiencing was indeed Deadlock, however. After obtaining the call-stack and popping the top half of it into Google I came across this which explains exactly what I was experiencing... http://timl.net/ This references a lovely guide to debugging the issue... http://www.aaronlerch.com/blog/2008/12/15/debugging-ui/ This identified a control I was constructing off the GUI thread. I did know this, however, and was marshalling calls correctly, but what I didn't realise was that behind the scenes this Control was subscribing to an event or set of events that are triggered when e.g. a Windows session is unlocked or the screensaver exits. These calls are always made on the main/UI thread and were blocking when it saw the call was made on the incorrect thread. Kim explains in more detail here... http://krgreenlee.blogspot.com/2007/09/onuserpreferencechanged-hang.html In the end I found an alternative solution which did not require this Control off the main/UI thread. That appears to have solved the problem and the application no longer hangs. I hope this helps anyone who's confronted by a similar problem. Thanks again to everyone on here who helped! (and indirectly, the delightful bloggers I've referenced above!) Roo -----------------------------------------------------SOLUTION II-------------------------------------------------- Aren't threading issues delightful...you think you've solved it, and a month down the line it pops back up again. I still believe the solution above resolved an issue that would cause simillar behaviour, but we encountered the problem again. As we spent a while debugging this, I thought I'd update this question with our (hopefully) final solution: The problem appears to have been a bug in the Infragistics components in the WinForms 2010.1 release (no hot fixes). We had been running from around the time the freeze issue appeared (but had also added a bunch of other stuff too). After upgrading to WinForms 2010.3, we've yet to reproduce the issue (deja vu). See my question here for a bit more information: 'http://stackoverflow.com/questions/4077822/net-4-0-and-the-dreaded-onuserpreferencechanged-hang'. Hans has given a nice summary of the general issue. I hope this adds a little to the suggestions/information surrounding the nutorious OnUserPreferenceChanged Hang (or whatever you'd like to call it). Cheers, Roo

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • jQuery programming style?

    - by Sam Dufel
    I was recently asked to fix something on a site which I haven't worked on before. I haven't really worked with jQuery that much, but I figured I'd take a look and see if I could fix it. I've managed to mostly clear up the problem, but I'm still horrified at the way they chose to build this site. On document load, they replace the click() method of every anchor tag and form element with the same massive function. When clicked, that function then checks if the tag has one of a few different attributes (non-standard attributes, even), and does a variety of different tasks depending on what attributes exist and what their values are. Some hyperlinks have an attribute on them called 'ajaxrel', which makes the click() function look for another (hidden) hyperlink with an ID specified by the ajaxrel attribute, and then calls the click() function for that other hyperlink (which was also modified by this same click() function). On the server side, all the php files are quite long and have absolutely no indentation. This whole site has been a nightmare to debug. Is this standard jQuery practice? This navigation scheme seems terrible. Does anyone else actually use jQuery this way? I'd like to start incorporating it into my projects, but looking at this site is giving me a serious headache. Here's the click() function for hyperlinks: function ajaxBoxA(theElement, urltosend, ajaxbox, dialogbox) { if ($(theElement).attr("href") != undefined) var urltosend = $(theElement).attr("href"); if ($(theElement).attr('toajaxbox') != undefined) var ajaxbox = $(theElement).attr('toajaxbox'); // check to see if dialog box is called for. if ($(theElement).attr('dialogbox') != undefined) var dialogbox = $(theElement).attr('dialogbox'); var dodialog = 0; if (dialogbox != undefined) { // if dialogbox doesn't exist, then flag to create dialog box. var isDiaOpen = $('[ajaxbox="' + ajaxbox + '"]').parent().parent().is(".ui-dialog-container"); dodialog = 1; if (isDiaOpen) { dodialog = 0; } dialogbox = parseUri(dialogbox); dialogoptions = { close: function () { // $("[id^=hierarchy]",this).NestedSortableDestroy(); $(this).dialog('destroy').remove() } }; for ( var keyVar in dialogbox['queryKey'] ) eval( "dialogoptions." + keyVar + " = dialogbox['queryKey'][keyVar]"); }; $("body").append("<div id='TB_load'><img src='"+imgLoader.src+"' /></div>"); $('#TB_load').show(); if (urltosend.search(/\?/) > 0) { urltosend = urltosend + "&-ajax=1"; } else { urltosend = urltosend + "?-ajax=1"; } if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).empty(); }); }; $.ajax({ type: "GET", url: urltosend, data: "", async: false, dataType: "html", success: function (html) { var re = /^<toajaxbox>(.*?)<\/toajaxbox>+(.*)/; if (re.test(html)) { var match = re.exec(html); ajaxbox = match[1]; html = Right(html, String(html).length - String(match[1]).length); } var re = /^<header>(.*?)<\/header>+(.*)/; if (re.test(html)) { var match = re.exec(html); window.location = match[1]; return false; } if (html.length > 0) { var newHtml = $(html); if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).replaceWith(newHtml).ready( function () { ajaxBoxInit(newHtml) if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); }); if ($('[ajaxdialog="' + ajaxbox + '"]').length = 0) { if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } else { $("body").append(newHtml).ready( function () { ajaxBoxInit(newHtml); if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } var rel = $(theElement).attr('ajaxtriggerrel'); if (rel != undefined) $('a[ajaxrel="' + rel + '"]').click(); tb_remove(); return false; }, complete: function () { $("#TB_load").remove(); } }); return false; }

    Read the article

  • c windows connect() fails. error 10049

    - by Joshua Moore
    The following two pieces of code compile, but I get a connect() failed error on the client side. (compiled with MinGW). Client Code: // thanks to cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoClientWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define RCVBUFSIZE 32 // size of receive buffer void DieWithError(char *errorMessage); int main(int argc, char* argv[]) { int sock; struct sockaddr_in echoServAddr; unsigned short echoServPort; char *servIP; char *echoString; char echoBuffer[RCVBUFSIZE]; int echoStringLen; int bytesRcvd, totalBytesRcvd; WSAData wsaData; if((argc < 3) || (argc > 4)){ fprintf(stderr, "Usage: %s <Sever IP> <Echo Word> [<Echo Port>]\n", argv[0]); exit(1); } if (argc==4) echoServPort = atoi(argv[3]); // use given port if any else echoServPort = 7; // echo is well-known port for echo service if(WSAStartup(MAKEWORD(2, 0), &wsaData) != 0){ // load winsock 2.0 dll fprintf(stderr, "WSAStartup() failed"); exit(1); } // create reliable, stream socket using tcp if((sock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP)) < 0) DieWithError("socket() failed"); // construct the server address structure memset(&echoServAddr, 0, sizeof(echoServAddr)); echoServAddr.sin_family = AF_INET; echoServAddr.sin_addr.s_addr = inet_addr(servIP); // server IP address echoServAddr.sin_port = htons(echoServPort); // establish connection to the echo server if(connect(sock, (struct sockaddr*)&echoServAddr, sizeof(echoServAddr)) < 0) DieWithError("connect() failed"); echoStringLen = strlen(echoString); // determine input length // send the string, includeing the null terminator to the server if(send(sock, echoString, echoStringLen, 0)!= echoStringLen) DieWithError("send() sent a different number of bytes than expected"); totalBytesRcvd = 0; printf("Received: "); // setup to print the echoed string while(totalBytesRcvd < echoStringLen){ // receive up to the buffer size (minus 1 to leave space for a null terminator) bytes from the sender if(bytesRcvd = recv(sock, echoBuffer, RCVBUFSIZE-1, 0) <= 0) DieWithError("recv() failed or connection closed prematurely"); totalBytesRcvd += bytesRcvd; // keep tally of total bytes echoBuffer[bytesRcvd] = '\0'; printf("%s", echoBuffer); // print the echo buffer } printf("\n"); closesocket(sock); WSACleanup(); exit(0); } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } Server Code: // thanks cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoServerWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define MAXPENDING 5 // maximum outstanding connection requests #define RCVBUFSIZE 1000 void DieWithError(char *errorMessage); void HandleTCPClient(int clntSocket); // tcp client handling function int main(int argc, char **argv) { int serverSock; int clientSock; struct sockaddr_in echoServerAddr; struct sockaddr_in echoClientAddr; unsigned short echoServerPort; int clientLen; // length of client address data structure WSAData wsaData; if (argc!=2){ fprintf(stderr, "Usage: %s <Server Port>\n", argv[0]); exit(1); } echoServerPort = atoi(argv[1]); if(WSAStartup(MAKEWORD(2, 0), &wsaData)!=0){ fprintf(stderr, "WSAStartup() failed"); exit(1); } // create socket for incoming connections if((serverSock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP))<0) DieWithError("socket() failed"); // construct local address structure memset(&echoServerAddr, 0, sizeof(echoServerAddr)); echoServerAddr.sin_family = AF_INET; echoServerAddr.sin_addr.s_addr = htonl(INADDR_ANY); // any incoming interface echoServerAddr.sin_port = htons(echoServerPort); // local port // bind to the local address if(bind(serverSock, (struct sockaddr*)&echoServerAddr, sizeof(echoServerAddr) )<0) DieWithError("bind() failed"); // mark the socket so it will listen for incoming connections if(listen(serverSock, MAXPENDING)<0) DieWithError("listen() failed"); for (;;){ // run forever // set the size of the in-out parameter clientLen = sizeof(echoClientAddr); // wait for a client to connect if((clientSock = accept(serverSock, (struct sockaddr*)&echoClientAddr, &clientLen)) < 0) DieWithError("accept() failed"); // clientSock is connected to a client printf("Handling client %s\n", inet_ntoa(echoClientAddr.sin_addr)); HandleTCPClient(clientSock); } // NOT REACHED } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } void HandleTCPClient(int clientSocket) { char echoBuffer[RCVBUFSIZE]; // buffer for echostring int recvMsgSize; // size of received message // receive message from client if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0) <0)) DieWithError("recv() failed"); // send received string and receive again until end of transmission while(recvMsgSize > 0){ // echo message back to client if(send(clientSocket, echoBuffer, recvMsgSize, 0)!=recvMsgSize) DieWithError("send() failed"); // see if there's more data to receive if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0)) <0) DieWithError("recv() failed"); } closesocket(clientSocket); // close client socket } How can I fix this?

    Read the article

  • Unable to Calculate Position within Owner-Draw Text

    - by Jonathan Wood
    I'm trying to use Visual Studio 2012 to create a Windows Forms application that can place the caret at the current position within a owner-drawn string. However, I've been unable to find a way to accurately calculate that position. I've done this successfully before in C++. I've now tried numerous methods in C#. Originally, I tried using .NET classes to determine the correct position, but then I tried accessing the Windows API directly. In some cases, I came close, but after some time I still cannot place the caret accurately. I've created a small test program and posted key parts below. I've also posted the entire project here. The exact font used is not important to me; however, my application assumes a mono-spaced font. Any help is appreciated. Form1.cs This is my main form. public partial class Form1 : Form { private string TestString; private int AveCharWidth; private int Position; public Form1() { InitializeComponent(); TestString = "123456789012345678901234567890123456789012345678901234567890"; AveCharWidth = GetFontWidth(); Position = 0; } private void Form1_Load(object sender, EventArgs e) { Font = new Font(FontFamily.GenericMonospace, 12, FontStyle.Regular, GraphicsUnit.Pixel); } protected override void OnGotFocus(EventArgs e) { Windows.CreateCaret(Handle, (IntPtr)0, 2, (int)Font.Height); Windows.ShowCaret(Handle); UpdateCaretPosition(); base.OnGotFocus(e); } protected void UpdateCaretPosition() { Windows.SetCaretPos(Padding.Left + (Position * AveCharWidth), Padding.Top); } protected override void OnLostFocus(EventArgs e) { Windows.HideCaret(Handle); Windows.DestroyCaret(); base.OnLostFocus(e); } protected override void OnPaint(PaintEventArgs e) { e.Graphics.DrawString(TestString, Font, SystemBrushes.WindowText, new PointF(Padding.Left, Padding.Top)); } protected override bool IsInputKey(Keys keyData) { switch (keyData) { case Keys.Right: case Keys.Left: return true; } return base.IsInputKey(keyData); } protected override void OnKeyDown(KeyEventArgs e) { switch (e.KeyCode) { case Keys.Left: Position = Math.Max(Position - 1, 0); UpdateCaretPosition(); break; case Keys.Right: Position = Math.Min(Position + 1, TestString.Length); UpdateCaretPosition(); break; } base.OnKeyDown(e); } protected int GetFontWidth() { int AverageCharWidth = 0; using (var graphics = this.CreateGraphics()) { try { Windows.TEXTMETRIC tm; var hdc = graphics.GetHdc(); IntPtr hFont = this.Font.ToHfont(); IntPtr hOldFont = Windows.SelectObject(hdc, hFont); var a = Windows.GetTextMetrics(hdc, out tm); var b = Windows.SelectObject(hdc, hOldFont); var c = Windows.DeleteObject(hFont); AverageCharWidth = tm.tmAveCharWidth; } catch { } finally { graphics.ReleaseHdc(); } } return AverageCharWidth; } } Windows.cs Here are my Windows API declarations. public static class Windows { [Serializable, StructLayout(LayoutKind.Sequential, CharSet = CharSet.Auto)] public struct TEXTMETRIC { public int tmHeight; public int tmAscent; public int tmDescent; public int tmInternalLeading; public int tmExternalLeading; public int tmAveCharWidth; public int tmMaxCharWidth; public int tmWeight; public int tmOverhang; public int tmDigitizedAspectX; public int tmDigitizedAspectY; public short tmFirstChar; public short tmLastChar; public short tmDefaultChar; public short tmBreakChar; public byte tmItalic; public byte tmUnderlined; public byte tmStruckOut; public byte tmPitchAndFamily; public byte tmCharSet; } [DllImport("user32.dll")] public static extern bool CreateCaret(IntPtr hWnd, IntPtr hBitmap, int nWidth, int nHeight); [DllImport("User32.dll")] public static extern bool SetCaretPos(int x, int y); [DllImport("User32.dll")] public static extern bool DestroyCaret(); [DllImport("User32.dll")] public static extern bool ShowCaret(IntPtr hWnd); [DllImport("User32.dll")] public static extern bool HideCaret(IntPtr hWnd); [DllImport("gdi32.dll", CharSet = CharSet.Auto)] public static extern bool GetTextMetrics(IntPtr hdc, out TEXTMETRIC lptm); [DllImport("gdi32.dll")] public static extern IntPtr SelectObject(IntPtr hdc, IntPtr hgdiobj); [DllImport("GDI32.dll")] public static extern bool DeleteObject(IntPtr hObject); }

    Read the article

  • C++ Linked List - Reading data from a file with a sentinel

    - by Nick
    So I've done quite a bit of research on this and can't get my output to work correctly. I need to read in data from a file and have it stored into a Linked List. The while loop used should stop once it hits the $$$$$ sentinel. Then I am to display the data (by searching by ID Number[user input]) I am not that far yet I just want to properly display the data and get it read in for right now. My problem is when it displays the data is isn't stopping at the $$$$$ (even if I do "inFile.peek() != EOF and omit the $$$$$) I am still getting an extra garbage record. I know it has something to do with my while loop and how I am creating a new Node but I can't get it to work any other way. Any help would be appreciated. students.txt Nick J Cooley 324123 60 70 80 90 Jay M Hill 412254 70 80 90 100 $$$$$ assign6.h file #pragma once #include <iostream> #include <string> using namespace std; class assign6 { public: assign6(); // constructor void displayStudents(); private: struct Node { string firstName; string midIni; string lastName; int idNum; int sco1; //Test score 1 int sco2; //Test score 2 int sco3; //Test score 3 int sco4; //Test score 4 Node *next; }; Node *head; Node *headPtr; }; assign6Imp.cpp // Implementation File #include "assign6.h" #include <fstream> #include <iostream> #include <string> using namespace std; assign6::assign6() //constructor { ifstream inFile; inFile.open("students.txt"); head = NULL; head = new Node; headPtr = head; while (inFile.peek() != EOF) //reading in from file and storing in linked list { inFile >> head->firstName >> head->midIni >> head->lastName; inFile >> head->idNum; inFile >> head->sco1; inFile >> head->sco2; inFile >> head->sco3; inFile >> head->sco4; if (inFile != "$$$$$") { head->next = NULL; head->next = new Node; head = head->next; } } head->next = NULL; inFile.close(); } void assign6::displayStudents() { int average = 0; for (Node *cur = headPtr; cur != NULL; cur = cur->next) { cout << cur->firstName << " " << cur->midIni << " " << cur->lastName << endl; cout << cur->idNum << endl; average = (cur->sco1 + cur->sco2 + cur->sco3 + cur->sco4)/4; cout << cur->sco1 << " " << cur->sco2 << " " << cur->sco3 << " " << cur->sco4 << " " << "average: " << average << endl; } }

    Read the article

  • Collections not read from hibernate/ehcache second-level-cache

    - by Mark van Venrooij
    I'm trying to cache lazy loaded collections with ehcache/hibernate in a Spring project. When I execute a session.get(Parent.class, 123) and browse through the children multiple times a query is executed every time to fetch the children. The parent is only queried the first time and then resolved from the cache. Probably I'm missing something, but I can't find the solution. Please see the relevant code below. I'm using Spring (3.2.4.RELEASE) Hibernate(4.2.1.Final) and ehcache(2.6.6) The parent class: @Entity @Table(name = "PARENT") @Cacheable @Cache(usage = CacheConcurrencyStrategy.READ_WRITE, include = "all") public class ServiceSubscriptionGroup implements Serializable { /** The Id. */ @Id @Column(name = "ID") private int id; @OneToMany(fetch = FetchType.LAZY, mappedBy = "parent") @Cache(usage = CacheConcurrencyStrategy.READ_WRITE) private List<Child> children; public List<Child> getChildren() { return children; } public void setChildren(List<Child> children) { this.children = children; } @Override public boolean equals(Object o) { if (this == o) return true; if (o == null || getClass() != o.getClass()) return false; Parent that = (Parent) o; if (id != that.id) return false; return true; } @Override public int hashCode() { return id; } } The child class: @Entity @Table(name = "CHILD") @Cacheable @Cache(usage = CacheConcurrencyStrategy.READ_WRITE, include = "all") public class Child { @Id @Column(name = "ID") private int id; @ManyToOne(fetch = FetchType.LAZY, cascade = CascadeType.ALL) @JoinColumn(name = "PARENT_ID") @Cache(usage = CacheConcurrencyStrategy.READ_WRITE) private Parent parent; public int getId() { return id; } public void setId(final int id) { this.id = id; } private Parent getParent(){ return parent; } private void setParent(Parent parent) { this.parent = parent; } @Override public boolean equals(final Object o) { if (this == o) { return true; } if (o == null || getClass() != o.getClass()) { return false; } final Child that = (Child) o; return id == that.id; } @Override public int hashCode() { return id; } } The application context: <bean id="sessionFactory" class="org.springframework.orm.hibernate4.LocalSessionFactoryBean"> <property name="dataSource" ref="dataSource" /> <property name="annotatedClasses"> <list> <value>Parent</value> <value>Child</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.SQLServer2008Dialect</prop> <prop key="hibernate.hbm2ddl.auto">validate</prop> <prop key="hibernate.ejb.naming_strategy">org.hibernate.cfg.ImprovedNamingStrategy</prop> <prop key="hibernate.connection.charSet">UTF-8</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.format_sql">true</prop> <prop key="hibernate.use_sql_comments">true</prop> <!-- cache settings ehcache--> <prop key="hibernate.cache.use_second_level_cache">true</prop> <prop key="hibernate.cache.use_query_cache">true</prop> <prop key="hibernate.cache.region.factory_class"> org.hibernate.cache.ehcache.SingletonEhCacheRegionFactory</prop> <prop key="hibernate.generate_statistics">true</prop> <prop key="hibernate.cache.use_structured_entries">true</prop> <prop key="hibernate.cache.use_query_cache">true</prop> <prop key="hibernate.transaction.factory_class"> org.hibernate.engine.transaction.internal.jta.JtaTransactionFactory</prop> <prop key="hibernate.transaction.jta.platform"> org.hibernate.service.jta.platform.internal.JBossStandAloneJtaPlatform</prop> </props> </property> </bean> The testcase I'm running: @Test public void testGetParentFromCache() { for (int i = 0; i <3 ; i++ ) { getEntity(); } } private void getEntity() { Session sess = sessionFactory.openSession() sess.setCacheMode(CacheMode.NORMAL); Transaction t = sess.beginTransaction(); Parent p = (Parent) s.get(Parent.class, 123); Assert.assertNotNull(p); Assert.assertNotNull(p.getChildren().size()); t.commit(); sess.flush(); sess.clear(); sess.close(); } In the logging I can see that the first time 2 queries are executed getting the parent and getting the children. Furthermore the logging shows that the child entities as well as the collection are stored in the 2nd level cache. However when reading the collection a query is executed to fetch the children on second and third attempt.

    Read the article

< Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >