Search Results

Search found 17715 results on 709 pages for 'regular language'.

Page 443/709 | < Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >

• Access denied when using RunWithElevatedPrivileges?

  - by James123

  I want regular user can access the "User Information List" in Mysite root site. I am using "RunWithElevatedPrivileges" method. Still throwing access denied error. per example my root site collection for mysite is "http://network.test.com". the user want assess userinformation list this site collection. How can he access that? SPSecurity.RunWithElevatedPrivileges(delegate { using (SPSite site = new SPSite(SPContext.Current.Web.Site.ID)) { ServerContext sc = ServerContext.Current; UserProfileManager upm = new UserProfileManager(sc); UserProfile up = null; //get current user's profile (visitor) if (upm.UserExists(SPContext.Current.Web.CurrentUser.LoginName)) { up =upm.GetUserProfile(SPContext.Current.Web.CurrentUser.LoginName); SPWeb web = SPContext.Current.Web; SPList userInformationList = web.Lists["User Information List"];

  Read the article

• Efficient data structure design

  - by Sway

  Hi there, I need to match a series of user inputed words against a large dictionary of words (to ensure the entered value exists). So if the user entered: "orange" it should match an entry "orange' in the dictionary. Now the catch is that the user can also enter a wildcard or series of wildcard characters like say "or__ge" which would also match "orange" The key requirements are: * this should be as fast as possible. * use the smallest amount of memory to achieve it. If the size of the word list was small I could use a string containing all the words and use regular expressions. however given that the word list could contain potentially hundreds of thousands of enteries I'm assuming this wouldn't work. So is some sort of 'tree' be the way to go for this...? Any thoughts or suggestions on this would be totally appreciated! Thanks in advance, Matt

  Read the article

• Typed Arrays in Gecko 2: Float32Array concatenation and expansion.

  - by janesconference

  Hi all, I'm a bit confused with Javascript Typed Arrays. What I have several *Float32Array*s, that have no concat method. I'd like to concatenate them all inside another Float32Array, but: as I said before, there is no concatenation method if I try to write past the array length, the array is not expanded (aka this won't work - please note that event.frameBuffer and buffer are both Float32Array and that I don't know what the final length of my buffer will be): var length_now = buffer.length; for (var i = 0; i < event.frameBuffer.length; i += 1) { buffer [length_now + i] = event.frameBuffer[i]; } The only solution I found is to copy the Float32Array in a regular array, that's definitely not what I want. How would you do, stackoverflowers?

  Read the article

• Using Regex groups in bash

  - by AlexeyMK

  Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

  Read the article

• How to extract URL parameters from a URL with Ruby or Rails?

  - by Flackou

  Hi, I have some URLs, like http://www.example.com/something?param1=value1&param2=value2&param3=value3, and I would like to extract the parameters from these URLs and get them in a Hash. Obviously, I could use regular expressions, but I was just wondering if there was easier ways to do that with Ruby or Rails. I haven't found anything in the Ruby Module 'URI' but perhaps I missed something. In fact, I need a method that would do that : extract_parameters_from_url("http://www.example.com/something?param1=value1&param2=value2&param3=value3") => {:param1 => 'value1', :param2 => 'value2', :param3 => 'value3'} Would you have some advices? Thanks in advance. Julien

  Read the article

• a question on webpage data scraping using Java

  - by Gemma

  Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

  Read the article

• Merging MySQL row entries into a single row

  - by Derrick

  I've got two tables, one for listings and another representing a list of tags for the listings table. In the listings table the tag ids are stored in a field called tags as 1-2-3-. This has worked out very well for me (regular expressions and joins to separate and display the data), but I now need to pull the titles of those tags into a single row. See below. listings table id tags 1 1-2-3- 2 4-5-6- tags table id title 1 pig 2 dog 3 cat 4 mouse 5 elephant 6 duck And what I need to produce out of the listings table is: id tags 2 mouse, elephant, duck

  Read the article

• Testing file existence using NSURL

  - by Peter Hosey

  Snow Leopard introduced many new methods to use NSURL objects to refer to files, not pathnames or Core Services' FSRefs. However, there's one task I can't find a URL-based method for: Testing whether a file exists. I'm looking for a URL-based version of -[NSFileManager fileExistsAtPath:]. Like that method, it should return YES if the URL describes anything, whether it's a regular file, a directory, or anything else. I could attempt to look up various resource values, but none of them are explicitly guaranteed to not exist if the file doesn't, and some of them (e.g., NSURLEffectiveIconKey) could be costly if it does. I could just use NSFileManager's fileExistsAtPath:, but if there's a more modern method, I'd prefer to use that. Is there a simple method or function in Cocoa, CF, or Core Services that's guaranteed/documented to tell me whether a given file (or file-reference) URL refers to a file-system object that exists?

  Read the article

• Which testing method to go with? [Rails]

  - by yuval

  I am starting a new project for a client today. I have done some rails projects before but never bothered writing tests for them. I'd like to change that starting with this new project. I am aware there are several testing tools, but am a bit confused as to which I should be using. I heard of RSpec, Mocha, Webrat, and Cucamber. Please keep in mind I never really wrote any regular tests, so my knowledge of testing in general is quite limited. How would you suggest I get started? Thanks!

  Read the article

• What is the best possible technology for pulling huge data from 4 remote servers

  - by Habib Ullah Bahar

  Hello, For one of our project, we need to pull huge real time stock data from 4 remote servers across two countries. The trivial process here, check the sources for a regular interval and save the update to database. But as these are real time stock data of more than 1000 companies, I have to pull every second, which isn't good in case of memory, bandwidth I think. Please give me suggestion on which technology/platform [We are flexible here. PHP, Python, Java, PERL - anyone of them will be OK for us] we should choose, it can be achieved easily and with better performance.

  Read the article

• Javascript substrings multiline replace by RegExp

  - by Radek Šimko

  Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

  Read the article

• Obtaining references to function objects on the execution stack from the frame object?

  - by Marcin

  Given the output of inspect.stack(), is it possible to get the function objects from anywhere from the stack frame and call these? If so, how? (I already know how to get the names of the functions.) Here is what I'm getting at: Let's say I'm a function and I'm trying to determine if my caller is a generator or a regular function? I need to call inspect.isgeneratorfunction() on the function object. And how do you figure out who called you? inspect.stack(), right? So if I can somehow put those together, I'll have the answer to my question. Perhaps there is an easier way to do this?

  Read the article

• JTable custom cell renderer to create row header

  - by hhj

  Can somebody please explain how I would create row headers? I already have the data and header texts set in the JTable: all I want to know is how I can use a cell renderer to take that first column (i.e. the row header column) and make it look like the column headers (i.e. the first row). Right now its background is white, so it looks like regular data. I want it to appear gray (or non-opaque I guess??). Oh and it should also not be selectable. Thanks.

  Read the article

• ASP.NET MVC controllers with identical names

  - by Anton Gogolev

  Hi! Here's what I'm trying to do. I have an ASP.NET MVC web application, where I'd like to have a separate "admin" area (accessible via http://example.com/admin) and a regular area, available for all users. In both these parts of the site I have a /blogs section, but when accessing http://example.com/admin/blogs I want to be presented with admin interface for blogs, whereas usual http://example.com/blogs should just list all blogs. And the problem itself is: how do I get ASP.NET MVC to instantiate appropriate controllers, provided that there are two BlogsControllers: one in Site.Admin namespace, and the other is in Site.Sitefront namespace? Granted, I could rename admin controller to BlogsAdminController, but I'd like to keep the names as they already are.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Positioning elements outside an Activity on Android

  - by Aleksander Kmetec

  Is there a way to absolutely position an UI element on Android so that it is located outside an Activity? For example: can you create a fullscreen ImageView simply by moving/resizing an ImageView inside an existing regular Activity instead of creating a new fullscreen activity? EDIT: Re-reading my question I see I wasn't very clear about what I'm trying to accomplish. I'd like to temporarily extend an element to cover the notification bar at the top of the screen. I need to create a semitranslucent fullscreen overlay but since translucent activities cannot cover the notification bar I'm trying to find out if it's possible for an element to break out of activity's bounds and resize itself to fill the whole screen, top to bottom.

  Read the article

• Redirect www.example.com/apple to food.example.com/fruits/apple

  - by Senthil

  I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

  Read the article

• Does DataType DataAnnotation Check the Expression?

  - by Jason

  I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

  Read the article

• How can I remove sensitive data from the debug_backtrace function?

  - by RenderIn

  I am using print_r(debug_backtrace(), true) to retrieve a string representation of the debug backtrace. This works fine, as print_r handles recursion. When I tried to recursively iterate through the debug_backtrace() return array before turning it into a string it ran into recursion and never ended. Is there some simple way I can remove certain sensitive key/value pairs from the backtrace array? Perhaps some way to turn the array to a string using print_r, then back to an array with the recursive locations changed to the string RECURSION, which I could the iterate through. I don't want to execute regular expressions on the string representation if possible.

  Read the article

• How to use a different assembly name for different configurations?

  - by Mark Ingram

  In Visual Studio 2008 (and others) when creating a .NET or silverlight application if you look at your project properties, it seems like you can only have one assembly name - across all configurations. I would like to compile my application as: MyAppDebug - in debug mode and just MyApp - in release mode Does anyone know if this is possible? Edit: It seems some people are questioning the reasoning behind the question, so I'll explain a little further: I'm working on a Silverlight application which gets automatically uploaded to our test site when I to a "build solution". The trouble is, the test team are now testing the online version, whilst I work on a new one. So, I want to have a url like .\MyApp.html for the regular version that the QA team will test and then .\MyApp.html?version=debug for the current version that I'm working on.

  Read the article

• What is a Web Framework ? How does it compare with LAMP

  - by Nishant

  I started web development in LAMP/WAMP and it was logical to me . There is a Web Server program called Apache which does the networking part of setting up a service on port 80 ( common port ) . If the request is regular HTML it uses the HTTP headers to transport files .And if the request for the file is a PHP one , it has a mod_php with which Apache invokes the PHP interpreter to process the file and it gives back HTML which is again transferred as usual HTML . Now the question is what is a Web Framework ? I came across Python based website creation and there is Flask . What is a flask , how does it compare with LAMP . Further are DJango / Ruby on Rails different from flask ? Can someone answer me and also give some good places to read on these .Thanks for your answers in advance . Further is things like LAMP slower than the common FRAMEWORKS because they claimn easy deplyment fo web apps .

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• Using C# and gppg, how would I construct an abstract syntax tree?

  - by Rupert

  Is there a way to do this almost out-of-the-box? I could go and write a big method that would use the collected tokens to figure out which leaves should be put in which branches and in the end populate a TreeNode object, but since gppg already handled everything by using supplied regular expressions, I was wondering if there's an easier way? Even if not, any pointers as to how best to approach the problem of creating an AST would be appreciated. Apologies if I said anything silly, I'm only just beginning to play the compiler game. :)

  Read the article

• Android: Deciding between SurfaceView and OpenGL (GLSurfaceView)

  - by Rich

  Is there a way to decide up front based on the expected complexity of a game/app in the planning phase whether to use regular Canvas drawing in a SurfaceView or to go with OpenGL? I've been playing around with a Canvas and only need 2D movement, and on a fairly new phone I'm getting pretty decent performance with a bunch of primitive objects and a few bitmaps running around the screen on a solid background. Is it fair to say that if I'm going to be drawing background images and increasing the number of objects being moved and drawn on top of them that I should go straight to OpenGL?

  Read the article

• Capturing the contents of <select>

  - by joey mueller

  I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

  Read the article

< Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >