Search Results

Search found 11527 results on 462 pages for 'ajax validator collout ex'.

Page 448/462 | < Previous Page | 444 445 446 447 448 449 450 451 452 453 454 455  | Next Page >

  • Howcome I cannot make my javascript 'executable' in an address bar

    - by imHavoc
    The second link does not work like the first one. How come? <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"> <html> <head> <title>Dynamic CSS Properties</title> <script language="JavaScript"> function change(){ //document.getElementById("box1").style.visibility = "visible"; var spanArray = document.getElementsByTagName('span'); var number_spans = spanArray.length ; for( var i = 0; i < number_spans ; i++ ){ var target = spanArray[ i ] ; // do something with target like set visibility target.style.visibility = "visible"; } } function change2(){ var spanArray=document.getElementsByTagName('span');var number_spans=spanArray.length;for(var i=0;i<number_spans;i++){var target=spanArray[i];target.style.visibility="visible";} } </script> </head> <body> <a href="javascript:change2();">Change</a> <br /> <a href="javascript:var spanArray=document.getElementsByTagName('span');va r number_spans=spanArray.length;for(var i=0;i<number_spans;i++){var target=spanArray[i];target.style.visibility='visible';}; ">Show Spans</a> <br /> <div style="position: relative; overflow: hidden;"><center> <br><br> <font size="5" color="blue"> 1. just press the <img src="http://up203.siz.co.il/up1/jw2k4az1imny.jpg"> button on the top to see the picture i promise you its so funny!!!!: <br><br><br> <span style="background: none repeat scroll 0% 0% white;"><span style="visibility: hidden;"> <a onmousedown="UntrustedLink.bootstrap($(this), &quot;77a0d&quot;, event)" rel="nofollow" target="_blank" onclick="(new Image()).src = '/ajax/ct.php?app_id=4949752878&amp;action_type=3&amp;post_form_id=3917211492ade40ee468fbe283b54b3b&amp;position=16&amp;' + Math.random();return true;" href="http://thebigbrotherisrael.blogspot.com/2010/04/all-family-guy-characters-in-real-life.html">Press here to see the picture!!!</a> </span><span style="visibility: visible;"></span></span></font></center></div> </body> </html>

    Read the article

  • Callback function in jquery doesn't seem to work......

    - by Pandiya Chendur
    I use the following jquery pagination plugin and i got the error a.parentNode is undefined when i executed it... <script type="text/javascript"> $(document).ready(function() { getRecordspage(1, 5); $(".pager").pagination(17, { callback: pagechange, current_page: '0', items_per_page: '5', num_display_entries : '5', next_text: 'Next', prev_text: 'Prev', num_edge_entries: '1' }); }); function pagechange() { $("#ResultsDiv").empty(); $("#ResultsDiv").css('display', 'none'); getRecordspage($(this).text(), 5); } function getRecordspage(curPage, pagSize) { $.ajax({ type: "POST", url: "Default.aspx/GetRecords", data: "{'currentPage':" + curPage + ",'pagesize':" + pagSize + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: function(jsonObj) { var strarr = jsonObj.d.split('##'); var jsob = jQuery.parseJSON(strarr[0]); var divs = ''; $.each(jsob.Table, function(i, employee) { divs += '<div class="resultsdiv"><br /><span class="resultName">' + employee.Emp_Name + '</span><span class="resultfields" style="padding-left:100px;">Category&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.Desig_Name + '</span><br /><br /><span id="SalaryBasis" class="resultfields">Salary Basis&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.SalaryBasis + '</span><span class="resultfields" style="padding-left:25px;">Salary&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.FixedSalary + '</span><span style="font-size:110%;font-weight:bolder;padding-left:25px;">Address&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.Address + '</span></div>'; }); $("#ResultsDiv").append(divs).show('slow'); $(".resultsdiv:even").addClass("resultseven"); $(".resultsdiv").hover(function() { $(this).addClass("resultshover"); }, function() { $(this).removeClass("resultshover"); }); } }); } </script> and in my page, <div id="ResultsDiv" style="display:none;"> </div> <div id="pager" class="pager"> </div> Any suggestion....

    Read the article

  • modify this code .. please help me?

    - by Sam
    i wana modify this code from static choices to dynamic this for 3 choices var PollhttpObject=null; function DoVote() {if(document.getElementById('PollRadio1').checke d)DoVote_Submit(1);else if(document.getElementById('PollRadio2').checked)DoVote_Submit(2);else if(document.getElementById('PollRadio3').checked)DoVote_Submit(3);else alert('?????: ?????? ?????? ??? ?????????? ??????? ?? ????? ??? ?? ???????');return false;} function DisbalePoll(TheCase) {document.getElementById('VoteBttn').onclick=function(){alert('!?????? ??? ?? ??????? ??????');} document.getElementById('PollRadio1').disabled='true';document.getElementById('PollRadio2').disabled='true';document.getElementById('PollRadio3').disabled='true';if(TheCase=='EXPIRED') {document.getElementById('VoteBttn').src='images/design/VoteBttn_OFF.jpg';document.getElementById('ResultBttn').src='images/design/ResultsBttn_OFF.jpg';document.getElementById('VoteBttn').onclick='';document.getElementById('ResultBttn').onclick='';document.getElementById('ResultBttn').style.cursor='';document.getElementById('VoteBttn').style.cursor='';}} function DoVote_Submit(VoteID) {if(VoteID!=0)DisbalePoll();try{PollhttpObject=getHTTPObject();if(PollhttpObject!=null) {PollhttpObject.onreadystatechange=PollOutput;PollhttpObject.open("GET","Ajax.aspx?ACTION=POLL&VOTEID="+ VoteID+"&RND="+ Math.floor(Math.random()*10001),true);PollhttpObject.send(null);}} catch(e){} return false;} function PollOutput(){if(PollhttpObject.readyState==4) {var SearchResult=PollhttpObject.responseText;document.getElementById('PollProgress').style.display='none';document.getElementById('PollFormDiv').style.display='block';if(SearchResult.length=2&&SearchResult.substr(0,2)=='OK') {var ReturnedValue=SearchResult.split("#");document.getElementById('PollBar1').style.width=0+'px';document.getElementById('PollBar2').style.width=0+'px';document.getElementById('PollBar3').style.width=0+'px';document.getElementById('PollRate1').innerHTML="0 (0%)";document.getElementById('PollRate2').innerHTML="0 (0%)";document.getElementById('PollRate3').innerHTML="0 (0%)";window.setTimeout('DrawPollBars(0, '+ ReturnedValue[1]+', 0, '+ ReturnedValue[2]+', 0, '+ ReturnedValue[3]+')',150);} else if(SearchResult.length=2&&SearchResult.substr(0,2)=='NO') {alert("?????: ??? ??? ???????? ?????");}} else {document.getElementById('PollProgress').style.display='block';document.getElementById('PollFormDiv').style.display='none';}} function DrawPollBars(Bar1Var,Bar1Width,Bar2Var,Bar2Width,Bar3Var,Bar3Width) {var TotalVotes=parseInt(Bar1Width)+parseInt(Bar2Width)+parseInt(Bar3Width);var IncVal=parseFloat(TotalVotes/10);var NewBar1Width=0;var NewBar2Width=0;var NewBar3Width=0;var Bar1NextVar;var Bar2NextVar;var Bar3NextVar;if(parseInt(parseInt(Bar1Var)*200/TotalVotes)0)NewBar1Width=parseInt(Bar1Var)*200/TotalVotes;else if(Bar1Var0)NewBar1Width=1;else NewBar1Width=0;if(parseInt(parseInt(Bar2Var)*200/TotalVotes)0)NewBar2Width=parseInt(Bar2Var)*200/TotalVotes;else if(Bar2Var0)NewBar2Width=1;else NewBar2Width=0;if(parseInt(parseInt(Bar3Var)*200/TotalVotes)0)NewBar3Width=parseInt(Bar3Var)*200/TotalVotes;else if(Bar3Var0)NewBar3Width=1;else NewBar3Width=0;document.getElementById('PollBar1').style.width=NewBar1Width+'px';document.getElementById('PollBar2').style.width=NewBar2Width+'px';document.getElementById('PollBar3').style.width=NewBar3Width+'px';document.getElementById('PollRate1').innerHTML=parseFloat(Bar1Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar1Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate2').innerHTML=parseFloat(Bar2Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar2Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate3').innerHTML=parseFloat(Bar3Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar3Var)/TotalVotes*100).toFixed(1)+"%)";if(Bar1Var!=Bar1Width||Bar2Var!=Bar2Width||Bar3Var!=Bar3Width) {if(parseFloat(Bar1Var)+IncVal<=parseInt(Bar1Width))Bar1NextVar=parseFloat(Bar1Var)+IncVal;else Bar1NextVar=Bar1Width;if(parseFloat(Bar2Var)+IncVal<=parseInt(Bar2Width))Bar2NextVar=parseFloat(Bar2Var)+IncVal;else Bar2NextVar=Bar2Width;if(parseFloat(Bar3Var)+IncVal<=parseInt(Bar3Width))Bar3NextVar=parseFloat(Bar3Var)+IncVal;else Bar3NextVar=Bar3Width;window.setTimeout('DrawPollBars('+ Bar1NextVar+', '+ Bar1Width+', '+ Bar2NextVar+', '+ Bar2Width+', '+ Bar3NextVar+', '+ Bar3Width+')',80); }}

    Read the article

  • Adding a mini admin to a webpage.

    - by DADU
    Hello Picture this: you are creating a little module that people can incorporate into their website easily, for example, a little contact form. It would consist of a PHP file that outputs some HTML, a Javascript file (ajax etc.), a CSS file and a CSS skin. Now the person who doesn't know much about coding wants to integrate it on a webpage (website/index.php). We could do this with three rules of code: <link rel="stylesheet" href="module/css/module.css" /> <script src="module/js/module.js"></script> <?php require_once 'module/module.php'; ?> There's no doubt this part is questionable, right? Now when we want to add an admin for this little module, there are two options: Accessing the admin via an extra URL like website/module/admin.php and after authentication, displaying a page where the person can do all the settings. The person then goes back to index.php to see the results. Enabling the admin via an extra URL like website/module/admin.php and after authentication, redirecting back to index.php. The person can now edit the module directly (HTML5 contenteditable) and see changes live, on the webpage where everybody else will see it when the person saves the changes. Option 2 has a couple of advantages: The person doesn't have to toggle between admin and index.php. The person can see directly how it's looking at the webpage it's integrated in. The person probably feels like the module is more part of the webpage/website. Of course option 2 has some disadvantages too: Not everything works well editing it inline. The person would need to have an HTML5 compliant browser. Probably some more I can't think of right now. Now I have a few concerns that's I can't seem to see a clear answer to. How would we let the person integrate the admin on their webpage? The admin files only need to be included in index.php if the person has choosen to edit the module via the url (website/module/admin.php). But how can we do this if we have a admin.css file that belongs in the head section, an admin.php file that goes into the body, and another admin.js file that's included at the end of the body? How would we know the file that admin.php needs to redirect back to, after authentication? index.php could be any webpage with any name. Any real life website/web apps examples using this principle are welcome too. If there's something unclear, I am glad to add additional info.

    Read the article

  • Loop append div and repeat

    - by Diego Vieira
    I have this code <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> But i want generate dynamically, how i do that? Ex.: i have 4 rounds, this would be the generated code <div class="round-4-top"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> <div class="round-4-bottom"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> I try using TagBuilder in MVC C# but I can not do. What should happen is, if you are 3 rounds, adding he should go inside each div is like the example above. Any idea how can I develop it?

    Read the article

  • Writing to a comet stream using tomcat 6.0

    - by user301247
    Hey I'm new to java servlets and I am trying to write one that uses comet so that I can create a long polling Ajax request. I can successfully start the stream and perform operations but I can't write anything out. Here is my code: public class CometTestServlet extends HttpServlet implements CometProcessor { /** * */ private static final long serialVersionUID = 1070949541963627977L; private MessageSender messageSender = null; protected ArrayList<HttpServletResponse> connections = new ArrayList<HttpServletResponse>(); public void event(CometEvent cometEvent) throws IOException, ServletException { HttpServletRequest request = cometEvent.getHttpServletRequest(); HttpServletResponse response = cometEvent.getHttpServletResponse(); //final PrintWriter out = response.getWriter(); if (cometEvent.getEventType() == CometEvent.EventType.BEGIN) { PrintWriter writer = response.getWriter(); writer.println("<!doctype html public \"-//w3c//dtd html 4.0 transitional//en\">"); writer.println("<head><title>JSP Chat</title></head><body bgcolor=\"#FFFFFF\">"); writer.println("</body></html>"); writer.flush(); cometEvent.setTimeout(10 * 1000); //cometEvent.close(); } else if (cometEvent.getEventType() == CometEvent.EventType.ERROR) { log("Error for session: " + request.getSession(true).getId()); synchronized(connections) { connections.remove(response); } cometEvent.close(); } else if (cometEvent.getEventType() == CometEvent.EventType.END) { log("End for session: " + request.getSession(true).getId()); synchronized(connections) { connections.remove(response); } PrintWriter writer = response.getWriter(); writer.println("</body></html>"); cometEvent.close(); } else if (cometEvent.getEventType() == CometEvent.EventType.READ) { //handleReadEvent(cometEvent); InputStream is = request.getInputStream(); byte[] buf = new byte[512]; do { int n = is.read(buf); //can throw an IOException if (n > 0) { log("Read " + n + " bytes: " + new String(buf, 0, n) + " for session: " + request.getSession(true).getId()); } else if (n < 0) { //error(cometEvent, request, response); return; } } while (is.available() > 0); } } Any help would be appreciated.

    Read the article

  • Autocomplete server-side implementation

    - by toluju
    What is a fast and efficient way to implement the server-side component for an autocomplete feature in an html input box? I am writing a service to autocomplete user queries in our web interface's main search box, and the completions are displayed in an ajax-powered dropdown. The data we are running queries against is simply a large table of concepts our system knows about, which matches roughly with the set of wikipedia page titles. For this service obviously speed is of utmost importance, as responsiveness of the web page is important to the user experience. The current implementation simply loads all concepts into memory in a sorted set, and performs a simple log(n) lookup on a user keystroke. The tailset is then used to provide additional matches beyond the closest match. The problem with this solution is that it does not scale. It currently is running up against the VM heap space limit (I've set -Xmx2g, which is about the most we can push on our 32 bit machines), and this prevents us from expanding our concept table or adding more functionality. Switching to 64-bit VMs on machines with more memory isn't an immediate option. I've been hesitant to start working on a disk-based solution as I am concerned that disk seek time will kill performance. Are there possible solutions that will let me scale better, either entirely in memory or with some fast disk-backed implementations? Edits: @Gandalf: For our use case it is important the the autocompletion is comprehensive and isn't just extra help for the user. As for what we are completing, it is a list of concept-type pairs. For example, possible entries are [("Microsoft", "Software Company"), ("Jeff Atwood", "Programmer"), ("StackOverflow.com", "Website")]. We are using Lucene for the full search once a user selects an item from the autocomplete list, but I am not yet sure Lucene would work well for the autocomplete itself. @Glen: No databases are being used here. When I'm talking about a table I just mean the structured representation of my data. @Jason Day: My original implementation to this problem was to use a Trie, but the memory bloat with that was actually worse than the sorted set due to needing a large number of object references. I'll read on the ternary search trees to see if it could be of use.

    Read the article

  • No unique bean of type [javax.persistence.EntityManagerFactory] is defined: expected single bean but found 0

    - by user659580
    Can someone tell me what's wrong with my config? I'm overly frustrated and I've been loosing my hair on this. Any pointer will be welcome. Thanks Persistence.xml <?xml version="1.0" encoding="UTF-8"?> <persistence version="2.0" xmlns="http://java.sun.com/xml/ns/persistence" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/persistence http://java.sun.com/xml/ns/persistence/persistence_2_0.xsd"> <persistence-unit name="myPersistenceUnit" transaction-type="JTA"> <provider>org.eclipse.persistence.jpa.PersistenceProvider</provider> <jta-data-source>jdbc/oracle</jta-data-source> <class>com.myproject.domain.UserAccount</class> <properties> <property name="eclipselink.logging.level" value="FINE"/> <property name="eclipselink.jdbc.batch-writing" value="JDBC" /> <property name="eclipselink.target-database" value="Oracle10g"/> <property name="eclipselink.cache.type.default" value="NONE"/> <!--Integrate EclipseLink with JTA in Glassfish--> <property name="eclipselink.target-server" value="SunAS9"/> <property name="eclipselink.cache.size.default" value="0"/> <property name="eclipselink.cache.shared.default" value="false"/> </properties> </persistence-unit> </persistence> Web.xml <?xml version="1.0" encoding="UTF-8"?> <web-app xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:web="http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" id="WebApp_ID" version="3.0"> <display-name>MyProject</display-name> <persistence-unit-ref> <persistence-unit-ref-name>persistence/myPersistenceUnit</persistence-unit-ref-name> <persistence-unit-name>myPersistenceUnit</persistence-unit-name> </persistence-unit-ref> <servlet> <servlet-name>mvc-dispatcher</servlet-name> <servlet-class>org.springframework.web.servlet.DispatcherServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>mvc-dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> <context-param> <param-name>contextConfigLocation</param-name> <param-value>/WEB-INF/mvc-dispatcher-servlet.xml</param-value> </context-param> <context-param> <param-name>contextConfigLocation</param-name> <param-value>classpath:applicationContext.xml</param-value> </context-param> <listener> <listener-class>org.springframework.web.context.ContextLoaderListener</listener-class> </listener> </web-app> applicationContext.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:aop="http://www.springframework.org/schema/aop" xmlns:tx="http://www.springframework.org/schema/tx" xmlns:context="http://www.springframework.org/schema/context" xmlns:mvc="http://www.springframework.org/schema/mvc" xmlns:jee="http://www.springframework.org/schema/jee" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd http://www.springframework.org/schema/aop http://www.springframework.org/schema/aop/spring-aop.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd http://www.springframework.org/schema/jee http://www.springframework.org/schema/jee/spring-jee.xsd" default-autowire="byName"> <tx:annotation-driven/> <tx:jta-transaction-manager/> <jee:jndi-lookup id="entityManagerFactory" jndi-name="persistence/myPersistenceUnit"/> <bean class="org.springframework.beans.factory.annotation.RequiredAnnotationBeanPostProcessor"/> <bean class="org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor"/> <!-- enables interpretation of the @PersistenceUnit/@PersistenceContext annotations providing convenient access to EntityManagerFactory/EntityManager --> <bean class="org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor"/> </beans> mvc-dispatcher-servlet.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:context="http://www.springframework.org/schema/context" xmlns:mvc="http://www.springframework.org/schema/mvc" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx.xsd"> <!-- DispatcherServlet Context: defines this servlet's request-processing infrastructure --> <tx:annotation-driven /> <tx:jta-transaction-manager /> <context:component-scan base-package="com.myProject" /> <context:annotation-config /> <!-- Enables the Spring MVC @Controller programming model --> <mvc:annotation-driven /> <mvc:default-servlet-handler /> <bean class="org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping" /> <bean class="org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter" /> <!-- Location Tiles config --> <bean id="tilesConfigurer" class="org.springframework.web.servlet.view.tiles2.TilesConfigurer"> <property name="definitions"> <list> <value>/WEB-INF/tiles-defs.xml</value> </list> </property> </bean> <!-- Resolves views selected for rendering by Tiles --> <bean id="tilesViewResolver" class="org.springframework.web.servlet.view.UrlBasedViewResolver" p:viewClass="org.springframework.web.servlet.view.tiles2.TilesView" /> <!-- Resolves views selected for rendering by @Controllers to .jsp resources in the /WEB-INF/views directory --> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix"> <value>/WEB-INF/pages/</value> </property> <property name="suffix"> <value>.jsp</value> </property> </bean> <bean id="messageSource" class="org.springframework.context.support.ReloadableResourceBundleMessageSource"> <property name="basename" value="/WEB-INF/messages" /> <property name="cacheSeconds" value="0"/> </bean> <bean id="validator" class="org.springframework.validation.beanvalidation.LocalValidatorFactoryBean" /> </beans> UserAccountDAO.java @Repository public class UserAccountDAO implements IUserAccountDAO { private EntityManager entityManager; @PersistenceContext public void setEntityManager(EntityManager entityManager) { this.entityManager = entityManager; } @Override @Transactional(readOnly = true, propagation = Propagation.REQUIRED) public UserAccount checkLogin(String userName, String pwd) { //* Find the user in the DB Query queryUserAccount = entityManager.createQuery("select u from UserAccount u where (u.username = :userName) and (u.password = :pwd)"); ....... } } loginController.java @Controller @SessionAttributes({"userAccount"}) public class LoginLogOutController { private static final Logger logger = LoggerFactory.getLogger(UserAccount.class); @Resource private UserAccountDAO userDAO; @RequestMapping(value="/loginForm.htm", method = RequestMethod.GET) public String showloginForm(Map model) { logger.debug("Get login form"); UserAccount userAccount = new UserAccount(); model.put("userAccount", userAccount); return "loginform"; } ... Error Stack INFO: 13:52:21,657 ERROR ContextLoader:220 - Context initialization failed org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'loginController': Injection of resource dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userAccountDAO': Injection of persistence dependencies failed; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No unique bean of type [javax.persistence.EntityManagerFactory] is defined: expected single bean but found 0 at org.springframework.context.annotation.CommonAnnotationBeanPostProcessor.postProcessPropertyValues(CommonAnnotationBeanPostProcessor.java:300) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1074) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:276) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:197) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:47) at org.apache.catalina.core.StandardContext.contextListenerStart(StandardContext.java:4664) at com.sun.enterprise.web.WebModule.contextListenerStart(WebModule.java:535) at org.apache.catalina.core.StandardContext.start(StandardContext.java:5266) at com.sun.enterprise.web.WebModule.start(WebModule.java:499) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:928) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:912) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:694) at com.sun.enterprise.web.WebContainer.loadWebModule(WebContainer.java:1947) at com.sun.enterprise.web.WebContainer.loadWebModule(WebContainer.java:1619) at com.sun.enterprise.web.WebApplication.start(WebApplication.java:90) at org.glassfish.internal.data.EngineRef.start(EngineRef.java:126) at org.glassfish.internal.data.ModuleInfo.start(ModuleInfo.java:241) at org.glassfish.internal.data.ApplicationInfo.start(ApplicationInfo.java:236) at com.sun.enterprise.v3.server.ApplicationLifecycle.deploy(ApplicationLifecycle.java:339) at com.sun.enterprise.v3.server.ApplicationLifecycle.deploy(ApplicationLifecycle.java:183) at org.glassfish.deployment.admin.DeployCommand.execute(DeployCommand.java:272) at com.sun.enterprise.v3.admin.CommandRunnerImpl$1.execute(CommandRunnerImpl.java:305) at com.sun.enterprise.v3.admin.CommandRunnerImpl.doCommand(CommandRunnerImpl.java:320) at com.sun.enterprise.v3.admin.CommandRunnerImpl.doCommand(CommandRunnerImpl.java:1176) at com.sun.enterprise.v3.admin.CommandRunnerImpl.access$900(CommandRunnerImpl.java:83) at com.sun.enterprise.v3.admin.CommandRunnerImpl$ExecutionContext.execute(CommandRunnerImpl.java:1235) at com.sun.enterprise.v3.admin.CommandRunnerImpl$ExecutionContext.execute(CommandRunnerImpl.java:1224) at com.sun.enterprise.v3.admin.AdminAdapter.doCommand(AdminAdapter.java:365) at com.sun.enterprise.v3.admin.AdminAdapter.service(AdminAdapter.java:204) at com.sun.grizzly.tcp.http11.GrizzlyAdapter.service(GrizzlyAdapter.java:166) at com.sun.enterprise.v3.server.HK2Dispatcher.dispath(HK2Dispatcher.java:100) at com.sun.enterprise.v3.services.impl.ContainerMapper.service(ContainerMapper.java:245) at com.sun.grizzly.http.ProcessorTask.invokeAdapter(ProcessorTask.java:791) at com.sun.grizzly.http.ProcessorTask.doProcess(ProcessorTask.java:693) at com.sun.grizzly.http.ProcessorTask.process(ProcessorTask.java:954) at com.sun.grizzly.http.DefaultProtocolFilter.execute(DefaultProtocolFilter.java:170) at com.sun.grizzly.DefaultProtocolChain.executeProtocolFilter(DefaultProtocolChain.java:135) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:102) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:88) at com.sun.grizzly.http.HttpProtocolChain.execute(HttpProtocolChain.java:76) at com.sun.grizzly.ProtocolChainContextTask.doCall(ProtocolChainContextTask.java:53) at com.sun.grizzly.SelectionKeyContextTask.call(SelectionKeyContextTask.java:57) at com.sun.grizzly.ContextTask.run(ContextTask.java:69) at com.sun.grizzly.util.AbstractThreadPool$Worker.doWork(AbstractThreadPool.java:330) at com.sun.grizzly.util.AbstractThreadPool$Worker.run(AbstractThreadPool.java:309) at java.lang.Thread.run(Thread.java:732)

    Read the article

  • jquery refresh php loop?

    - by Elliott
    Hi, I have a page in which users can make "posts" its similar to facebook, I am trying to figure out how I can get it to run the php loop say every 10mins, in order for the person to see new posts. Everytime a post is made it is added into the db and then the page is refreshed, I want to do it more "facebook like". Using jquery slide down etc. Below is what I have up2 now. function postdata() { $.ajax({ type: "POST", dataType: "text", url: "makepost.php", data: "post_text=" + $("#post_text").val(), cache: false, success: function(reply_text) { if (reply_text.indexOf("Successful") >= 0) { alert("Post Made"); window.location = "index.php" } else { alert(reply_text); } } }); } </script> <div id="content"> <?php if (loggedin()) { $ID = getID(); $query = "SELECT * FROM `posts`"; $result=mysql_query($query); $count=mysql_num_rows($result); $users = "SELECT `userID` FROM `users`"; $resultID=mysql_query($users); while ($row = mysql_fetch_array($result)) { echo '<div class="posts">'; echo $row['2']."<br /><br />"; echo '<div class="posts_bottom">'; echo '<p class="name">'; echo showuser($row['1'])."</p>"; echo '<p class="rate">'; echo '<input type="submit" value="+1"/></p>'; echo '<p class="points">'; echo showpoints($row['1'])."</p>"; echo "</div>"; echo '</div>'; } echo '<div id="makepost"> <br /><textarea rows="3" cols="25" id="post_text" ></textarea><br /> <input type="submit" id="post_bttn" value="Post" onclick="postdata(); return false;"> </div>'; As they are put into a new div everytime I don't know what to refresh? Such as if it was one div I could jus refresh that, but these are being created and I don't know how many would need to be loaded. Any adivce? Thanks alot :D

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • jQuery bind efficiency

    - by chelfers
    I'm having issue with load speed using multiple jQuery binds on a couple thousands elements and inputs, is there a more efficient way of doing this? The site has the ability to switch between product lists via ajax calls, the page cannot refresh. Some lists have 10 items, some 100, some over 2000. The issue of speed arises when I start flipping between the lists; each time the 2000+ item list is loaded the system drags for about 10 seconds. Before I rebuild the list I am setting the target element's html to '', and unbinding the two bindings below. I'm sure it has something to do with all the parent, next, and child calls I am doing in the callbacks. Any help is much appreciated. loop 2500 times <ul> <li><input type="text" class="product-code" /></li> <li>PROD-CODE</li> ... <li>PRICE</li> </ul> end loop $('li.product-code').bind( 'click', function(event){ selector = '#p-'+ $(this).prev('li').children('input').attr('lm'); $(selector).val( ( $(selector).val() == '' ? 1 : ( parseFloat( $(selector).val() ) + 1 ) ) ); Remote.Cart.lastProduct = selector; Remote.Cart.Products.Push( Remote.Cart.customerKey, { code : $(this).prev('li').children('input').attr('code'), title : $(this).next('li').html(), quantity : $('#p-'+ $(this).prev('li').children('input').attr('lm') ).val(), price : $(this).prev('li').children('input').attr('price'), weight : $(this).prev('li').children('input').attr('weight'), taxable : $(this).prev('li').children('input').attr('taxable'), productId : $(this).prev('li').children('input').attr('productId'), links : $(this).prev('li').children('input').attr('productLinks') }, '#p-'+ $(this).prev('li').children('input').attr('lm'), false, ( parseFloat($(selector).val()) - 1 ) ); return false; }); $('input.product-qty').bind( 'keyup', function(){ Remote.Cart.lastProduct = '#p-'+ $(this).attr('lm'); Remote.Cart.Products.Push( Remote.Cart.customerKey, { code : $(this).attr('code') , title : $(this).parent().next('li').next('li').html(), quantity : $(this).val(), price : $(this).attr('price'), weight : $(this).attr('weight'), taxable : $(this).attr('taxable'), productId : $(this).attr('productId'), links : $(this).attr('productLinks') }, '#p-'+ $(this).attr('lm'), false, previousValue ); });

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • Programming a callback function within a jQuery plugin

    - by ILMV
    I'm writing a jQuery plug-in so I can reuse this code in many places as it is a very well used piece of code, the code itself adds a new line to a table which has been cloned from a hidden row, it continues to perform a load of manipulations on the new row. I'm currently referencing it like this: $(".abc .grid").grid(); But I want to include a callback so each area the plug-in is called from can do something a bit more unique when the row has been added. I've used the jQuery AJAX plug-in before, so have used the success callback function, but cannot understand how the code works in the background. Here's what I want to achieve: $(".abc .grid").grid({ row_added: function() { // do something a bit more specific here } }); Here's my plug-in code (function($){ $.fn.extend({ //pass the options variable to the function grid: function() { return this.each(function() { grid_table=$(this).find('.grid-table > tbody'); grid_hidden_row=$(this).find('.grid-hidden-row'); //console.debug(grid_hidden_row); $(this).find('.grid-add-row').click(function(event) { /* * clone row takes a hidden dummy row, clones it and appends a unique row * identifier to the id. Clone maintains our jQuery binds */ // get the last id last_row=$(grid_table).find('tr:last').attr('id'); if(last_row===undefined) { new_row=1; } else { new_row=parseInt(last_row.replace('row',''),10)+1; } // append element to target, changes it's id and shows it $(grid_table).append($(grid_hidden_row).clone(true).attr('id','row'+new_row).removeClass('grid-hidden-row').show()); // append unique row identifier on id and name attribute of seledct, input and a $('#row'+new_row).find('select, input, a').each(function(id) { $(this).appendAttr('id','_row'+new_row); $(this).replaceAttr('name','_REPLACE_',new_row); }); // disable all the readonly_if_lines options if this is the first row if(new_row==1) { $('.readonly_if_lines :not(:selected)').attr('disabled','disabled'); } }); $(this).find('.grid-remove-row').click(function(event) { /* * Remove row does what it says on the tin, as well as a few other house * keeping bits and pieces */ // remove the parent tr $(this).parents('tr').remove(); // recalculate the order value5 //calcTotal('.net_value ','#gridform','#gridform_total'); // if we've removed the last row remove readonly locks row_count=grid_table.find('tr').size(); console.info(row_count); if(row_count===0) { $('.readonly_if_lines :disabled').removeAttr('disabled'); } }); }); } }); })(jQuery); I've done the usually searching on elgooG... but I seem to be getting a lot of noise with little result, any help would be greatly appreciated. Thanks!

    Read the article

  • problem in saving drag&drop object in database

    - by Mac Taylor
    hey guys i made a script inspired by wordpress widgets'page to drag&drop blocks of my sites but problem is in saving the position after droping this is jquery code , i used to do the above target : <script type="text/javascript" >$(function(){ $('.widget') .each(function(){ $(this).hover(function(){ $(this).find('h4').addClass('collapse'); }, function(){ $(this).find('h4').removeClass('collapse'); }) .find('h4').hover(function(){ $(this).find('.in-widget-title').css('visibility', 'visible'); }, function(){ $(this).find('.in-widget-title').css('visibility', 'hidden'); }) .click(function(){ $(this).siblings('.widget-inside').toggle(); //Save state on change of collapse state of panel updateWidgetData(); }) .end() .find('.in-widget-title').css('visibility', 'hidden'); }); $('.column').sortable({ connectWith: '.column', handle: 'h4', cursor: 'move', placeholder: 'placeholder', forcePlaceholderSize: true, opacity: 0.4, start: function(event, ui){ //Firefox, Safari/Chrome fire click event after drag is complete, fix for that if($.browser.mozilla || $.browser.safari) $(ui.item).find('.widget-inside').toggle(); }, stop: function(event, ui){ ui.item.css({'top':'0','left':'0'}); //Opera fix if(!$.browser.mozilla && !$.browser.safari) updateWidgetData(); } }) .disableSelection(); }); function updateWidgetData(){ var items=[]; $('.column').each(function(){ var columnId=$(this).attr('id'); $('.widget', this).each(function(i){ var collapsed=0; if($(this).find('.widget-inside').css('display')=="none") collapsed=1; //Create Item object for current panel var item={ id: $(this).attr('id'), collapsed: collapsed, order : i, column: columnId }; //Push item object into items array items.push(item); }); }); //Assign items array to sortorder JSON variable var sortorder={ items: items }; //Pass sortorder variable to server using ajax to save state $.post('updatePanels.php', 'data='+$.toJSON(sortorder), function(response){ if(response=="success") $("#console").html('<div class="success">Saved</div>').hide().fadeIn(1000); setTimeout(function(){ $('#console').fadeOut(1000); }, 2000); }); } </script> and a simple php file but problem is its not sending data to target php file is there anything wrong with my code ?

    Read the article

  • jQuery Table - Reference User Input Row Names and Values

    - by Vic
    I have several tables which are generated by another application, which I have no control over. I am totally new to jQuery and ajax, and have only a limited knowledge of jsp. Two sample rows are: <table class="sicknessForm"> <tr id="row_0" class="datarow"> <td id="col_2"><input name="row_0-col_2" class="tabcell" value="Injuries"></td> <td id="col_4"><input name="row_0-col_4" class="tabcell" value="01"></td> <td id="col_5"><input name="row_0-col_5" class="tabcell" value="2"></td> <td id="col_6"><input name="row_0-col_6" class="tabcell" value="5"></td> </tr> <tr id="row_1" class="datarow"> <td id="col_2"><input name="row_1-col_2" class="tabcell" value="Absences"></td> <td id="col_4"><input name="row_1-col_4" class="tabcell" value="100"></td> <td id="col_5"><input name="row_1-col_5" class="tabcell" value="102"></td> <td id="col_6"><input name="row_1-col_6" class="tabcell" value="105"></td> </tr> </table> There are more rows and columns in the actual tables. What I need to do is to pass the ordered row information to the database, e.g.: Injuries, 1, 2, 5 .... Absences 100, 102, 105... I can retrieve the values for each input using: $('#SicknessForm .userInput').each(function() { alert($(this).val()); }); 1) How can I loop through each row, get the value from the first column (Injuries) and place the data into an array to send to the server? 2) How do I reference the first row of each column to disable user input on it? $(:HowDoIReferenceThis).attr('disabled', ''); 3) I need to validate that each cell is numeric, other than the first column. Any pointers on this (otherwise I can check it in my servlet), especially on how to loop through all valid input cells (everything except 'Injuries','Abences', ... cells). Many Thanks! Vic

    Read the article

  • is there any way we can disable on mouse over event on certain columns of an data grid

    - by prince23
    hi, here wat i am trying to do is that on mouse over of first column i need to hit mouse MouseEnter event and show the pop up which i have kept there rest all other column i dnt need to to show the pop up so i am having this fuction there MouseLeave="Row_MouseLeave" <sdk:DataGrid MinHeight="100" x:Name="dgCounty" AutoGenerateColumns="False" VerticalAlignment="Top" Grid.Row="1" IsReadOnly="True" Margin="5,5,5,0" RowDetailsVisibilityChanged="dgCounty_RowDetailsVisibilityChanged" SelectionMode="Extended" RowDetailsVisibilityMode="VisibleWhenSelected" MouseEnter="dgCounty_MouseEnter" MouseLeave="dgCounty_MouseLeave" SelectionChanged="dgCounty_SelectionChanged" LoadingRow="dgCounty_LoadingRow1" UnloadingRow="dgCounty_UnloadingRow"> <sdk:DataGrid.Columns> <sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Button x:Name="myButton" Width="24" Height="24" Click="Details_Click"> <Image x:Name="img" Source="Images/detail.JPG" Stretch="None"/> </Button> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="ID"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <sdk:Label Content="{Binding EmployeeID}" /> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Name"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <sdk:Label Content="{Binding EmployeeFName}" MouseLeave="Row_MouseLeave" /> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="MailID"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <sdk:Label Content="{Binding EmployeeMailID}" MouseLeave="Row_MouseLeave" /> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> </sdk:DataGrid.Columns> </sdk:DataGrid> in code behind void Row_MouseLeave(object sender, MouseEventArgs e) { Show.Visibility = Visibility.Collapsed; PoPGrid.Visibility = Visibility.Collapsed; } void Row_MouseEnter(object sender, MouseEventArgs e) { } the pop up her is like the ajax modal pop up wat we do in asp.net i am able to show data in pop up now the main issue is i need to show pop up only on the 2 column. rest all other column i need to hide the pop up when i move mouse over on that column. i am trying this concept it is not working is there any way i can achive it as i said only need to show pop up on mouse over of the 2 column thanks in advance prince

    Read the article

  • Jquery $.post and PHP - Prevent the ability to use script outside of main website.

    - by Tim
    I have a PHP script setup using Jquery $.post which would return a response or do an action within the targeted .php file within $.post. Eg. My page has a form where you type in your Name. Once you hit the submit form button, $.post is called and sends the entered Name field value into "mywebsite.xyz/folder/ajaxscript.php" If a user was to visit "mywebsite.xyz/folder/ajaxscript.php" directly and somehow POST the data to the script, the script would return a response / do an action, based on the submitted POST data. The problem is, I don't want others to be able to periodically "call" an action or request a response from my website without using the website directly. Theoretically, right now you could determine what Name values my website allows without even visiting it, or you could call an action without going through the website, by simply visiting "mywebsite.xyz/folder/ajaxscript.php" So, what measures can I take to prevent this from happening? So far my idea is to ensure that it is a $_POST and not a $_GET - so they cannot manually enter it into the browser, but they could still post data to the script... Another measure is to apply a session key that expires, and is only valid for X amount of visits until they revisit the website. ~ Or, just have a daily "code" that changes and they'd need to grab this code from the website each day to keep their direct access to the script working (eg. I pass the daily "code" into each post request. I then check that code matches in the ajax php script.) However, even with these meaures, they will STILL have access to the scripts so long as they know how to POST the data, and also get the new code each day. Also, having a daily code requirement will cause issues when visiting the site at midnight (12:00am) as the code will change and the script will break for someone who is on the website trying to call the script, with the invalid code being passed still. I have attempted using .htaccess however using: order allow,deny deny from all Prevents legitimate access, and I'd have to add an exception so the website's IP is allowed to access it.. which is a hassle to update I think. Although, if it's the only legitimate solution I guess I'll have to. If I need to be more clear please let me know.

    Read the article

  • ASP.NET MVC CRUD PartialView Popup Issue

    - by Smiley Face
    I am creating an MVC website which makes use of Partial Views on Popups to handle all my CRUD transactions. Please note that my application can already handle these CRUD operations perfectly (LINQ-To-Entity). However, I have a problem with my popup forms. Below is the code from my _Add.cshtml: @model MyStore.Models.MyModels.ProductsModel @{ Layout = null; } @using (Ajax.BeginForm("_Add", "Products", new AjaxOptions { InsertionMode = InsertionMode.Replace, HttpMethod = "POST", OnSuccess = "addSuccess" }, new { @id = "addForm" })) { @Html.ValidationSummary(true) <div id="add-message" class="error invisible"></div> <fieldset> <legend>Products</legend> @Html.HiddenFor(m => Model.ProductCode) <div class="editor-label"> @Html.LabelFor(model => model.ProductName) </div> <div class="editor-field"> @Html.EditorFor(model => model.ProductName) @Html.ValidationMessageFor(model => model.ProductName) </div> <div class="editor-label"> @Html.LabelFor(model => model.Price) </div> <div class="editor-field"> @Html.TextBoxFor(model => model.Price) @Html.ValidationMessageFor(model => model.Price) </div> </fieldset> } Below is the code from my Controller: [HttpGet] public ActionResult _Add(string productCode) { ProductsModel model = newProductsModel(); model.ProductCode = ProductCode ; return PartialView(model); } [HttpPost] public JsonResult _Add(ProductsModel model) { if (ModelState.IsValid) { ProductsManager prod = new ProductsManager(); Products pa = new Products(); pa.ProductCode = model.ProductCode; pa.ProductName = model.ProductName; pa.Price = model.Price; prod.AddProduct(pa); return Json(HelperClass.SuccessResponse(pa), JsonRequestBehavior.AllowGet); } else { return Json(HelperClass.ErrorResponse("Please review your form"), JsonRequestBehavior.DenyGet); } } Please note that the _Add.cshtml is a partial view which is being rendered through a Popup.js which I found on the internet. It is rendered through this code: @Html.ActionLink("[Add Product]", "_Add", new { ProductCode = @ViewData["ProductCode"] }, new { @class = "editLink" }) This works okay. I mean it adds product to my database. But my problem is upon clicking the Proceed button, I get this pop-up download dialog from the page: Can somebody please help me with this? I have a hunch it's because of the HttpMethod i'm using (POST, PUT, GET, DELETE) but i'm not really sure which one is right to use or if it really is the problem in the first place. Any help would be greatly appreciated! PS. Sorry for the long post.

    Read the article

  • Return only the new database items since last check in Rails

    - by Smith
    I'm fairly new to Ruby, and currently trying to implement an AJAX style commenting system. When the user views a topic, all the current comments on that topic will be displayed. The user can post a comment on the page of a topic and it should automatically display without having to refresh the page, along with any new comments that have been posted since the last comment currently displayed to the user. The comments should also automatically refresh at a specified frequency. I currently have the following code: views/idea/view.html.erb <%= periodically_call_remote(:update => "div_chat", :frequency => 1, :position => "top", :url => {:controller => "comment", :action => :test_view, :idea_id => @idea.id } ) %> <div id="div_chat"> </div> views/comment/test_view.html.erb <% @comments.each do |c| %><div id="comment"> <%= c.comment %> </div> <% end %> controllers/comment_controller.rb class CommentController < ApplicationController before_filter :start_defs def add_comment @comment = Comment.new params[:comment] if @comment.save flash[:notice] = "Successfully commented." else flash[:notice] = "UnSuccessfully commented." end end def test_render @comments = Comment.find_all_by_idea_id(params[:idea_id], :order => "created_at DESC", :conditions => ["created_at > ?", @latest_time] ) @latest = Comment.find(:first, :order => "created_at DESC") @latest_time = @latest.created_at end def start_defs @latest = Comment.find(:first, :order => "created_at ASC") @latest_time = @latest.created_at end end The problem is that every time periodically_call_remote makes a call, it returns the entire list of comments for that topic. From what I can tell, the @latest_time gets constantly reset to the earliest created_at, rather than staying updated to the latest created_at after the comments have been retrieved. I'm also not sure how I should directly refresh the comments when a comment is posted. Is it possible to force a call to periodically_call_remote on a successful save?

    Read the article

  • How to loop a json array and update links

    - by azz0r
    Hello, On page load, I do one call to get the current status of all the favourite links (display the right message aka: click to subscribe, click to unsubscribe. So far I have the following code: $(InitFavorite); function InitFavorite(){ var jList = $(".favourite_link"); var ids_to_check = {};//new Array(); $.each(jList, function () { var id = this.id; var object = id.split("_"); if (!ids_to_check[object[1]]) { ids_to_check[object[1]] = []; } ids_to_check[object[1]].push(object[0]); }); //console.log(ids_to_check); $.ajax({ type: 'POST', url: '/user/subscription/favourite-listing', data: ids_to_check, dataType: 'json', beforeSend: function(x) { if(x && x.overrideMimeType) { x.overrideMimeType("application/j-son;charset=UTF-8"); } }, error: function() { alert(1); }, success: function(returned_values) { $.each(returned_values, function() { console.log($(this)); }) } }); } My returned data is: {"env":"development","loggedIn":true,"translate":{},"aaron":"{\"Playlist\":{\"10\":\"Stop Recieving Updates For This Playlist\"},\"Clip\":{\"26\":\"Recieve Updates For This Clip\",\"27\":\"Recieve Updates For This Clip\",\"28\":\"Recieve Updates For This Clip\",\"29\":\"Stop Recieving Updates For This Clip\",\"30\":\"Recieve Updates For This Clip\"}}"} I would like it to loop through the data and for example update the class <a href="/user/subscription/toggle/id/26/object/Clip" class="favourite_link" id="26_Clip"> <img src="/design/images/icon/subscribe.png"> Add Clip To Favourites</a> However eaching through returned_values equals this in firebug: ["{", """, "P", "l", "a", "y", "l", "i", "s", "t", """, ":", "{", """, "1", "0", """, ":", """, "S", "t", "o", "p", " ", "R", "e", "c", "i", "e", "v", "i", "n", "g", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "P", "l", "a", "y", "l", "i", "s", "t", """, "}", ",", """, "C", "l", "i", "p", """, ":", "{", """, "2", "6", """, ":", """, "R", "e", "c", "i", "e", "v", "e", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "C", "l", "i", "p", """, ",", """, "2", "7", """, ":", """, "R", "e", "c", "i", "e", "v", "e", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "C", "l", "i", "p", """, ",", """, "2", "8", """, ":", """, "R", "e", "c", "i", "e", "v", "e", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "C", "l", "i", "p", """, ",", """, "2", "9", """, ":", """, "S", "t", "o", "p", " ", "R", "e", "c", "i", "e", "v", "i", "n", "g", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "C", "l", "i", "p", """, ",", """, "3", "0", """, ":", """, "R", "e", "c", "i", "e", "v", "e", " ", "U", "p", "d", "a", "t", "e", "s", " ", "F", "o", "r", " ", "T", "h", "i", "s", " ", "C", "l", "i", "p", """, "}", "}"] How would I successfully loop that json array? Many thanks

    Read the article

  • please help me to find out where i am doing mistake in this code? i wnat retieve the value that i am

    - by user309381
    function reload(form) { var val = $('seltab').getValue(); new Ajax.Request('Website.php?cat=' +escape(val), { method:'get', onSuccess: function(transport){ var response = transport.responseText ; $("MyDivDB").innerHTML = transport.responseText ; alert("Success! \n\n" + response); }, onFailure: function(){ alert('Something went wrong...') } }); } </script> </head> title author pages $con = mysql_connect($dbhostname,$dbuserid,$dbpassword); if(!$con) { die ("connection failed".mysql_error()); } $db = mysql_select_db($dbname,$con); if(!$db) { die("Database is not selected".mysql_error()); } $query ="SELECT * FROM books NATURAL JOIN authors" ; $result = mysql_query($query); if(!$query) { die("Database is not query".mysql_error()); } while($row = mysql_fetch_array($result,MYSQL_ASSOC)) { $title = $row["title"]; $author = $row["author"]; $page = $row["pages"]; echo "<tr>"; echo "<td>$title</td>"; echo "<td>$author</td>"; echo "<td>$page</td>"; echo "</tr>"; } print "</table>"; echo "<select id = seltab onchange = 'reload(this.form)'>"; $querysel = "SELECT title_id,author FROM authors NATURAL JOIN books"; $result1 = mysql_query($querysel) ; while($rowID = mysql_fetch_assoc($result1)) { $TitleID = $rowID['title_id']; $author = $rowID['author']; print "<option value = $author>$author\n"; print "</option>"; } print "</select>"; ? Wbsite.php

    Read the article

  • Why does my entire page reload in Chrome and Firefox when using asynchronous UpdatePanel postbacks?

    - by Alex
    Being a bit perplexed about this issue by now, I hope some of you gurus can shed some light on my problem... I've developed a AJAX-enhanced website, which has been running fine in IE, Chrome and Firefox for a year or so. I use a Timer-control to check for incoming messages every 30 seconds, and this updates an UpdatePanel showing potential new messages. Now several one of my Firefox users complain about the page refreshing every 30 seconds! I my self cannot reproduce this behaviour, but given the "30 seconds"-description, I cursed my Timer-solution as the culprit. But now, I'm experiencing this error myself, not in Firefox though, but in Google Chrome! (And only on one of my two computers!) Every 30 seconds the page reloads! But I found that it's not only related to the Timer, because all other asynchronous postbacks to the server within UpdatePanels reloads the entire page as well. This error has never been experienced in Internet Explorer (to my knowledge). As I said, this it not only related to the Timer postback, but if it's of interest to anybody the code is like this: <asp:Timer runat="server" ID="MailCheckTimer" Interval="30000" OnTick="MailChecker_Tick"></asp:Timer> <asp:UpdatePanel runat="server" ID="MailCheckerUpdatePanel" UpdateMode="Conditional"> <ContentTemplate> <div class="newmail_box" runat="server" id="newmail_box"> <!-- Content stripped for this example --> </div> </ContentTemplate> <Triggers> <asp:AsyncPostBackTrigger ControlID="MailCheckTimer" /> </Triggers> </asp:UpdatePanel> In other places of the website I call the client side __doPostBack function directly from JavaScript in relation to an UpdatePanel. Normal behaviour for this call is to updated the referenced UpdatePanel with some content, but now in Chrome this refreshes the entire page! (but again not consistently, and never in IE) Even the most fundamental UpdatePanel operations like refreshing the content after a button (inside the panel) is clicked, forces the page to reload completely: <asp:Button ID="btnSearch" runat="server" Text="Search" OnClick="btnSearch_Click"></asp:Button> And just to torment me further, I only experience this on my public website, and not in my local development environment, making it a tedious affair for me to find the actual cause! :( Any ideas on why this happens? Why so inconsistently? Has it to do with my UpdatePanel-design? Or does some security setting in Firefox/Chrome that prevent some asynchronous UpdatePanel callbacks? Any help or idea is highly appreciated!

    Read the article

  • jQuery: form input values turns up undefined

    - by Seerumi
    Having problem with this bit of code qith jQuery. it should pick the values from current form and then submit them, but when I try to get them with jQuery they always turn up undefined. I know the SQL results are fine since they show correctly in HTML table, so it must be my inferior javascript skills. New with jQuery and I'm at loss :( PHP/HTML: echo "<table>\n" while ($row = odbc_fetch_array($query)) { echo "<form class='catForm'>\n"; echo "<input type=hidden class='catID' name='catID' value='".$row['running_id']."'/>\n"; echo "<tr>\n"; echo "<td>".$row['running_id']."</td>\n"; echo "<td>".$row['site_id']."</td>\n"; echo "<td>".$row['main_category']."</td>\n"; echo "<td>".$row['map_name']."</td>\n"; echo "<td><input type=textfield class='bCatID' value='".$row['mapping_id']."' size=6/></td>\n"; echo "<td><input type=submit class='saveCat' value='Save'/></td>\n"; echo "<td><input type=submit class='killCat' value='Delete' /></td>\n"; echo "</tr>\n"; echo "</form>\n"; } echo "</table>"; jQuery: $(".catForm").submit(function () { var id = $(this).find('.catID').val(); var bCatID = $(this).find('.bCatID').val(); var dataString = 'id='+id+'&bCatID='+bCatID; $.ajax({ type: "POST", url: 'adminUI/bin/updateSCategories.php', dataType : 'json', data: dataString, success: function(data) { if (data.error == true) $('.failure').html("Error, save failed.").show().fadeOut(2000); if (data.error == false) $('.success').html("Saved succesfully").show().fadeOut(2000); }, error: function(XMLHttpRequest, textStatus, errorThrown) { $('.failure').html("Error, save failed.").show().fadeOut(2000); } }); return false; }); RESULT: id: undefined bCatID: undefined

    Read the article

  • How to retrieve parent container ID after sorting using Jquery sortable??

    - by user187580
    Hello I have following markup and javascript to sort some items. Items can be sorted within a block or across other blocks. It works but I have a problem in retrieving correct block ID after an item is moved from one block to another. For example, if I move item 1 within "Block 1", I get "I am in Block= block_1" but if I move Item 1 to Block 2 I still get I am in Block 1. But I want to make the block 2 as its parent container. I need to retrieve this id so that I can do some ajax and update the db accordingly. Can you please help me correct this?? <div id="blocks_sortable"> <div id="block_1"> <h2>Block 1</h2> <div class="items_sortable connectedSortable"> <div id="item_1"> <span>Item 1</span></div> <div id="item_2"> <span>Item 2</span></div> <div id="item_3"> <span>Item 3</span></div> </div> </div> <div id="block_2"> <h2>Block 2</h2> <div class="items_sortable connectedSortable"> <div id="item_4"> <span>Item 4</span></div> <div id="item_5"> <span>Item 5</span></div> <div id="item_6"> <span>Item 6</span></div> </div> </div> </div> <script> $("#blocks_sortable").sortable({ }); $(".items_sortable").sortable({ connectWith: '.connectedSortable' , forcePlaceholderSize: true , stop : function(event, ui){ alert("I am in block = "+$(this).parent().attr("id")); } }).disableSelection(); </script> Thank you.

    Read the article

  • ajaxSubmit options success & error functions aren't fired

    - by Thommy Tomka
    jQuery 1.7.2 jQuery Validate 1.1.0 jQuery Form 3.18 Wordpress 3.4.2 I am trying to code a contact/ mail form in above environment/ with above jQuery libs. Now I am having a problem with the jQuery Form JS: I have taken the original code from the developers page for ajaxSubmit and only altered the target option to an ID which exists in my HTML source and replaced $ with jQuery in function showRequest. The problem is, that the function namend after success: does not fire. I tried the same with error: and again nothing fired. Only complete: did and the function I placed there alerted the responseText from the receiving script. Does anyone has an idea whats going wrong? Thanks in advance! Thomas jQuery(document).ready(function() { var options = { target: '#mail-status', // target element(s) to be updated with server response beforeSubmit: showRequest, // pre-submit callback success: showResponse, // post-submit callback // other available options: //url: url // override for form's 'action' attribute //type: type // 'get' or 'post', override for form's 'method' attribute //dataType: null // 'xml', 'script', or 'json' (expected server response type) //clearForm: true // clear all form fields after successful submit //resetForm: true // reset the form after successful submit // $.ajax options can be used here too, for example: //timeout: 3000 }; jQuery("#mailform").validate( { submitHandler: function(form) { jQuery(form).ajaxSubmit(options); }, errorPlacement: function(error, element) { }, rules: { author: { minlength: 2, required: true }, email: { required: true, email: true }, comment: { minlength: 2, required: true } }, highlight: function(element) { jQuery(element).addClass("e"); jQuery(element.form).find("label[for=" + element.id + "]").addClass("e"); }, unhighlight: function(element) { jQuery(element).removeClass("e"); jQuery(element.form).find("label[for=" + element.id + "]").removeClass("e"); } }); }); // pre-submit callback function showRequest(formData, jqForm, options) { // formData is an array; here we use $.param to convert it to a string to display it // but the form plugin does this for you automatically when it submits the data var queryString = jQuery.param(formData); // jqForm is a jQuery object encapsulating the form element. To access the // DOM element for the form do this: // var formElement = jqForm[0]; alert('About to submit: \n\n' + queryString); // here we could return false to prevent the form from being submitted; // returning anything other than false will allow the form submit to continue return true; } // post-submit callback function showResponse(responseText, statusText, xhr, $form) { // for normal html responses, the first argument to the success callback // is the XMLHttpRequest object's responseText property // if the ajaxSubmit method was passed an Options Object with the dataType // property set to 'xml' then the first argument to the success callback // is the XMLHttpRequest object's responseXML property // if the ajaxSubmit method was passed an Options Object with the dataType // property set to 'json' then the first argument to the success callback // is the json data object returned by the server alert('status: ' + statusText + '\n\nresponseText: \n' + responseText + '\n\nThe output div should have already been updated with the responseText.'); }

    Read the article

< Previous Page | 444 445 446 447 448 449 450 451 452 453 454 455  | Next Page >