Search Results

Search found 15059 results on 603 pages for 'associative array'.

Page 449/603 | < Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • what is for....in statement in javascript

    - by dramasea
    anyone can explain how to use for...in statement in javascript. I had read the w3school article but i think it is not so clear.Below is the code, please explain this: <html> <body> <script type="text/javascript"> var x; var mycars = new Array(); mycars[10] = "Saab"; mycars[20] = "Volvo"; mycars[30] = "BMW"; for (x in mycars) { document.write(mycars[x] + "<br />"); } </script> </body> </html>

    Read the article

  • Setting Mnemonics and Hot Keys for a JOptionPane Dialog

    - by Daniel Bingham
    Is it possible to assign hotkeys and mnemonics to the buttons in a JOptionPane Dialog? I'd like to be able, in a JOptionPane generated message dialog with the options Yes, No and Cancel, press Y to hit the Yes button, N to hit the No button and escape to activate the escape button. Similarly in a dialog with Okay and Cancel buttons I'd like to be able to activate them with enter and escape. I've attempted passing JButtons into the JOptionPane's button Object array with the Mnemonics set already. The mnemonics work and the buttons show up correctly in the dialogs, however, they do not act properly when they are activated. Most noticeably they do not dispose of the dialog. What is the correct way to add hotkeys and Mnemonics to a JOptionPane Dialog's buttons? As always, my apologies ahead of time if this is a duplicate - I searched both Google and Stackoverflow and found nothing.

    Read the article

  • Python: Traffic-Simulation (cars on a road)

    - by kame
    Hello! I want to create a traffic simulator like here: http://www.doobybrain.com/wp-content/uploads/2008/03/traffic-simulation.gif But I didn't thougt very deep about this. I would create the class car. Every car has his own color, position and so on. And I could create the road with an array. But how to tell the car where to go? Could I hear your ideas? EDIT: Is it forbidden to get new ideas from good programmers? Why do some people want to close this thread? Or were to ask such questions? I dont understand them. :(

    Read the article

  • problem in counting children category

    - by moustafa
    I have this table: fourn_category (id , sub) I am using this code to count: function CountSub($id){ $root = array($id); $query = mysql_query("SELECT id FROM fourn_category WHERE sub = '$id'"); while( $row = mysql_fetch_array( $query, MYSQL_ASSOC ) ){ array_push($root,$row['id']); CountSub($row['id']); } return implode(",",$root); } It returns the category id as 1,2,3,4,5 to using it to count the sub by IN() But the problem is that it counts this: category 1 category 2 category 3 category 4 category 5 Category 1 has 1 child not 4. Why? How can I get all children's trees?

    Read the article

  • Difference between two commands of fetching Shopping Cart Items in Magento

    - by Knowledge Craving
    In Magento, if you need to get / fetch the Shopping Cart's Item details, you can do it in any of the two possible ways, which will provide you with all the shopped Items in an array:- $cartItems1 = $cart->getQuote()->getAllItems(); $cartItems2 = $cart->getItems()->getData(); But before using any one of the above two methods, you need to initialize the shopping cart object as:- $cart = new Mage_Checkout_Model_Cart(); $cart->init(); Can anyone please describe in details as to what the two options provide & their differences between each other, along with their possible usage. In any more such option is available in Magento, can anyone please highlight it?

    Read the article

  • Suggestion to reverse string in c#

    - by HasanGursoy
    Is this the right method to reverse a string? I'm planning to use it to reverse a string like: Products » X1 » X3 to X3 « X1 « Products I want it to be a global function which can be used elsewhere. public static string ReverseString(string input, string separator, string outSeparator) { string result = String.Empty; string[] temp = Regex.Split(input, separator, RegexOptions.IgnoreCase); Array.Reverse(temp); for (int i = 0; i < temp.Length; i++) { result += temp[i] + " " + outSeparator + " "; } return result; }

    Read the article

  • Add UIView Above All Other Views, Including StatusBar

    - by Mike Stead
    I'm wanting to create a view (UIControl) which blocks all input and shows a UIActivityIndicatorView while authenticating a user. The UIActionSheet and UIAlertView both manage to add a black semi-transparent view over the top of all other views to block input and I'd like to do similar. I've tried adding my view to the top UIWindow in the [[UIApplication sharedApplication] windows] array, and while this does place it above the UIKeyboard if it's visible, it doesn't place it over the StatusBar (which makes sense). My next attempt was to extend UIAlertView, remove all of its subviews and set its layer.contents = nil, then add the ActivityIndicator as a subview. This works well, but I can't seem to kill the default bouncy transition of the UIAlertView when you call it to "show". Does anyone have any pointers towards the best way tackle this problem that gives me full control? Oh and I know blocking input is not great but I do ensure it's for a short period of time and it has the benefit of making it clear to the user that their action, which must complete for them to progress, is processing.

    Read the article

  • iPhone SDK Nested For Loop performance

    - by Skeep
    Hi All, I have a NSArray of string id and a NSDictionary of NSDictionary objects. I am currently looping through the string id array to match the id value in the NSDictionary. There are around 200 NSDictionary objects and only 5 or so string ID. My current code is such: for (NSString *Str in aArr) { for (NSDictionary *a in apArr) { if ([a objectForKey:@"id"] == Str) { NSLog(@"Found!"); } } } The performance of the above code is really slow and I was wondering if there is a better way to do this?

    Read the article

  • Regular expression for parsing CSV in PHP

    - by Discodancer
    I already managed to split the CSV file using this regex: "/,(?=(?:[^\"]\"[^\"]\")(?![^\"]\"))/" But I ended up with an array of strings that contain the opening and ending double quotes. Now I need a regex that would strip those strings of the delimiter double quotes. As far as I know the CSV format can encapsulate strings in double quotes, and all the double quotes that are already a part of the string are doubled. For example: My "other" cat becomes "My ""other"" cat" What I basically need is a regex that will replace all sequences of N doublequotes with a sequence of (N/2 - rounded down) double quotes. Or is there a better way ? Thanks in advance.

    Read the article

  • Regex gurus! here's a teaser: mixed thousands separators and csv's

    - by chichilatte
    I've got a string like... "labour 18909, liberals 12,365,conservatives 14,720" ...and i'd like a regex which can get rid of any thousands separators so i can pull out the numbers easily. Or even a regex which could give me a tidy array like: (labour => 18909, liberals => 12365, conservatives => 14720) Oh i wish i had the time to figure out regexes! Maybe i'll buy one as a toilet book, mmm.

    Read the article

  • [C++]Advantage of using a static member function instead of an equivalent non-static member function

    - by jonathanasdf
    I was wondering whether there's any advantages to using a static member function when there is a non-static equivalent. Will it result in faster execution (because of not having to care about all of the member variables), or maybe less use of memory (because of not being included in all instances)? Basically, the function I'm looking at is an utility function to rotate an integer array representing pixel colours an arbitrary number of degrees around an arbitrary centre point. It is placed in my abstract Bullet base class, since only the bullets will be using it and I didn't want the overhead of calling it in some utility class. It's a bit too long and used in every single derived bullet class, making it probably not a good idea to inline. How would you suggest I define this function? As a static member function of Bullet, of a non-static member function of Bullet, or maybe not as a member of Bullet but defined outside of the class in Bullet.h? What are the advantages and disadvantages of each?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Pear MDB2 class and raiserror exceptions in SQL Server

    - by drholzmichl
    Hi, in SQL Server it's possible to raise an error with raiserror(). I want to use a severity, which doesn't interrupt the connection. This error is raised in a stored procedure. In SQL Management Studio all is fine and I get my error code when executing this SP. But when trying to execute this SP via MDB2 in PHP5 this doesn't work. All I get is an empty array. MDB2 object is created via (including needed options): $db =& MDB2::connect($dsn); $db->setFetchMode(MDB2_FETCHMODE_ASSOC); $db->setOption('portability',MDB2_PORTABILITY_ALL ^ MDB2_PORTABILITY_EMPTY_TO_NULL); The following works (I get a PEAR error): $db->query("RAISERROR('test',11,0);"); But when calling a stored procedure which raises this error via $db->query("EXEC sp_raise_error"); there is not output. What's wrong?

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Regular Expression - capturing contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

  • Calling UITableViews delegate methods directly.

    - by RickiG
    Hi I was looking for a way to call the edit method directly. - (void)tableView:(UITableView *)theTableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath I have all my logic for animating manipulated cells, removing from my model array etc. in this method. It is getting called when a user swipes, adds or rearranges, but I would like to call it manually/directly as a background thread changes my model. I have constructed an NSIndexPath like so: NSIndexPath *path = [NSIndexPath indexPathForRow:i inSection:1]; I just can't figure out how to call something like: [self.tableview commitEditingStyle:UITableViewCellEditingStyleDelete forRowAtIndexPath:path]; Do I need to gain access to the methods of this plain style UITableView in another way? Thanks:)

    Read the article

  • JSON Search and remove in php?

    - by moogeek
    Hello! I have a session variable $_SESSION["animals"] containing a deep json object with values: $_SESSION["animals"]='{ "0":{"kind":"mammal","name":"Pussy the Cat","weight":"12kg","age":"5"}, "1":{"kind":"mammal","name":"Roxy the Dog","weight":"25kg","age":"8"}, "2":{"kind":"fish","name":"Piranha the Fish","weight":"1kg","age":"1"}, "3":{"kind":"bird","name":"Einstein the Parrot","weight":"0.5kg","age":"4"}, }'; For example, I want to find the line with "Piranha the Fish" and then remove it (and json_encode it again as it was). How to do this? I guess i need to search in json_decode($_SESSION["animals"],true) resulting array and find the parent key to remove but i'm stucked anyways.

    Read the article

  • How can I use a variable as a module name in Perl?

    - by mjn12
    I know it is possible to use a variable as a variable name for package variables in Perl. I would like to use the contents of a variable as a module name. For instance: package Foo; our @names =("blah1", "blah2"); 1; And in another file I want to be able be able to set the contents of a scalar to "foo" and then access the names array in Foo through that scalar. my $packageName = "Foo"; Essentially I want to do something along the lines of: @{$packageName}::names; #This obviously doesn't work. I know I can use my $names = eval '$'. $packageName . "::names" But only if Foo::names is a scalar. Is there another way to do this without the eval statement?

    Read the article

  • Codeigniter Form validation problem

    - by ben robinson
    Please please please can someone help me $this-load-library('form_validation'); $this-load-helper('cookie'); $data = array(); if($_POST) { // Set validation rules including additional validation for uniqueness $this-form_validation-set_rules('yourname', 'Your Name', 'trim|required'); $this-form_validation-set_rules('youremail', 'Your Email', 'trim|required|valid_email'); $this-form_validation-set_rules('friendname', 'Friends Name', 'trim|required'); $this-form_validation-set_rules('friendemail', 'Friends Email', 'trim|required|valid_email'); // Run the validation and take action if($this-form_validation-run()) { echo 'valid; } } else{ echo 'problem'; } Form validation is coming back with no errors can cany one see why?

    Read the article

  • Routing zend request through a default controller when controller not found.

    - by Brett Pontarelli
    Below is a function defined in my Bootstrap class. I must be missing something fundamental in the way Zend does routing and dispatching. What I am trying to accomplish is simple: For any request /foo/bar/* that is not dispatchable for any reason try /index/foo/bar/. The problem I'm having is when the FooController exists I get Action "foo" does not exist. Basically, the isDispatchable is always false. public function run() { $front = Zend_Controller_Front::getInstance(); $request = $front->getRequest(); $dispatcher = $front->getDispatcher(); //$controller = $dispatcher->getControllerClass($request); if (!$dispatcher->isDispatchable($request)) { $route = new Zend_Controller_Router_Route( ':action/*', array('controller' => 'index') ); $router = $front->getRouter(); $router->addRoute('FallBack', $route); } $front->dispatch(); }

    Read the article

  • TypeError: 'NoneType' object does not support item assignment

    - by R S John
    I am trying to do some mathematical calculation according to the values at particular index of a NumPy array with the following code X = np.arange(9).reshape(3,3) temp = X.copy().fill(5.446361E-01) ind = np.where(X < 4.0) temp[ind] = 0.5*X[ind]**2 - 1.0 ind = np.where(X >= 4.0 and X < 9.0) temp[ind] = (5.699327E-1*(X[ind]-1)**4)/(X[ind]**4) print temp But I am getting the following error Traceback (most recent call last): File "test.py", line 7, in <module> temp[ind] = 0.5*X[ind]**2 - 1.0 TypeError: 'NoneType' object does not support item assignment Would you please help me in solving this? Thanks

    Read the article

  • Dynamic programming: Find largest diamond (rhombus)

    - by Darksody
    I have a small program to do in Java. I have a 2D array filled with 0 and 1, and I must find the largest rhombus (as in square rotated by 90 degrees) and their numbers. Example: 0 1 0 0 0 1 1 0 1 1 1 0 1 0 1 1 1 1 0 1 1 1 1 1 0 0 1 1 1 1 1 1 1 1 1 1 Result: 1 1 1 1 1 1 1 1 1 1 1 1 1 The problem is similar to this SO question. If you have any idea, post it here.

    Read the article

  • Craft a JSONpath expression so that it retrieves only a specific value?

    - by Alex
    Hello, I have some JSON of which the following is a small sample: results": { "div": [ { "class": "sylEntry", "id": "sylOne", "div": [ { "class": "sT", "id": "sOT", "p": "Mon 11/17, Computer work time" }, { "class": "des", "id": "dOne", "p": "All classes Siebel 0218" } ] }, I would like to only retrieve the "p" content for the div element with class "sT". I would like to use a loop and doing something like this: var arrayOfResults = $.results..div.p does not work because I only want to retrieve the p value for the div element with class "sT". So how do I construct my JSONpath so that it will retrive the array of p elements that are contained within the divs class "sT". Thanks!!

    Read the article

  • iPhone: How to create dynamic image dragging ala iphone icon rearranging

    - by Jim Coffman
    On the iPhone, if you touch and hold your finger on an icon, it starts vibrating, then you can drag them around while the other icons move aside and rearrange dynamically. I'm trying to figure out how to do this inside an application with a grid of images or buttons. I don't need them to vibrate, but I do want the UI to allow the user to drag them with real-time dynamic reordering and then return the new position (ie, an int for accessing a mutable array). Any ideas how to do this? Any sample code out there? Thanks!

    Read the article

< Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >