Search Results

Search found 19975 results on 799 pages for 'disk queue length'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 450/799 | < Previous Page | 446 447 448 449 450 451 452 453 454 455 456 457  | Next Page >

  • background music stops after 3/4 runs in iphone app

    - by amy
    I am playing sounds in loop in my app. So it should continue playing through out the app. but sometimes it stops after playing sound for 3/4 times.I don't understand whats happening. I am using audio-toolbox framework for playing sound. creating audio queue and then playing sounds in loop. I am also playing sound from ipod library using mediaplayer. Same thing happening with song from ipod. I have set [musicPlayer setRepeatMode: MPMusicRepeatModeOne]; but still it stops after 3/4 times.

    Read the article

  • How to research unmanaged memory leaks in .NET?

    - by Brandon
    I have a WCF service running over MSMQ. Memory gradually increases over time, indicating that there is some sort of memory leak. I ran the service locally and monitored some counters using PerfMon. Total CLR memory managed heap bytes remains relatively constant, while the process' private bytes increases over time. This leads me to believe that there is some sort of unmanaged memory leak. Assuming that unmanaged memory leak is the issue, how do I address the issue? Are there any tools I could use to give me hints as to what is causing the unmanaged memory leak? Also, all my service is doing is reading from the transactional queue and writing to a database, all as part of a DTC transaction (handled under the hood by requiring a transaction on the service contract). I am not doing anything explicitly with COM or DllImports. Thanks in advance!

    Read the article

  • Azure Service Bus Scalability

    - by phebbar
    I am trying to understand how can I make Azure Service Bus Topic to be scaleable to handle 10,000 requests/second from more than 50 different clients. I found this article at Microsoft - http://msdn.microsoft.com/en-us/library/windowsazure/hh528527.aspx. This provides lot of good input to scale azure service bus like creating multiple message factories, sending and receiving asynchronously, doing batch send/receive. But all these input are from the publisher and subscriber client perspective. What if the node running the Topic can not handle the huge number of transactions? How do I monitor that? How do I have the Topic running on multiple nodes? Any input on that would be helpful. Also wondering if any one has done any capacity testing with Topic/Queue and I am eager to see those results... Thanks, Prasanna

    Read the article

  • Ajax gets nothing back from the php.

    - by ShaMun
    Jquery i dont have alert and firefox i dont have anything in return. The code was working before, database query have successfull records also. What i am missing??? Jquery ajax. $.ajax({ type : "POST", url : "include/add_edit_del.php?model=teksten_display", data : "oper=search&ids=" + _id , dataType: "json", success : function(msg){ alert(msg); } }); PHP case 'teksten_display': $id = $_REQUEST['ids']; $res = $_dclass-_query_sql( "select a,b,id,wat,c,d from tb1 where id='" . $id . "'" ); $_rows = array(); while ( $rows = mysql_fetch_array ($res) ) { $_rows = $rows; } //header('Cache-Control: no-cache, must-revalidate'); //header('Expires: Mon, 26 Jul 1997 05:00:00 GMT'); header('Content-type: application/json'); echo utf8_encode( json_encode($_rows) ) ; //echo json_encode($_rows); //var_dump($_rows); //print_r ($res); break; Firefox response/request header Date Sat, 24 Apr 2010 22:34:55 GMT Server Apache/2.2.3 (CentOS) X-Powered-By PHP/5.1.6 Expires Thu, 19 Nov 1981 08:52:00 GMT Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma no-cache Content-Length 0 Connection close Content-Type application/json Host www.xxxx.be User-Agent Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.1.9) Gecko/20100330 Fedora/3.5.9-2.fc12 Firefox/3.5.9 Accept application/json, text/javascript, */* Accept-Language en-us,en;q=0.5 Accept-Encoding gzip,deflate Accept-Charset ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive 300 Connection keep-alive Content-Type application/x-www-form-urlencoded; charset=UTF-8 X-Requested-With XMLHttpRequest Referer http://www.xxxx.be/xxxxx Content-Length 17 Cookie csdb=2; codb=5; csdbb=1; codca=1.4; csdca=3; PHPSESSID=benunvkpecqh3pmd8oep5b55t7; CAKEPHP=3t7hrlc89emvg1hfsc45gs2bl2

    Read the article

  • SVN tags: How not to update/checkout them?

    - by Boldewyn
    In many projects, I check out the complete repository and have then the standard directory structure: project/ branches/ tags/ trunk/ If I do an svn up project, it's all fine with the branches and trunk folders, but, of course, the tags folder is updated, too, and filled with (mostly) lots of tagged versions that are of no value for my work and only occupy disk space. How can I except the tags folder from an svn update? Especially, how can I do this locally only, that is, without committing that back to the repository, as a solution with the svn:ignore keyword would do?

    Read the article

  • Need advice on cron job'ing a very large process

    - by Arms
    I have a PHP script that grabs data from an external service and saves data to my database. I need this script to run once every minute for every user in the system (of which I expect to be thousands). My question is, what's the most efficient way to run this per user, per minute? At first I thought I would have a function that grabs all the user Ids from my database, iterate over the ids and perform the task for each one, but I think that as the number of users grow, this will take longer, and no longer fall within 1 minute intervals. Perhaps I should queue the user Ids, and perform the task individually for each one? In which case, I'm actually unsure of how to proceed. Thanks in advance for any advice.

    Read the article

  • 1) PasswordResets emails user when requesting password reset

    - by Surge Pedroza
    I've been trying to add a password reset for users that forget their password. The users clicks on forgot password? on sign up page. Then the user types their email and clicks reset password, which creates a token and sends an email with a link to reset their password. For the most part, it was working well, and then it suddenly stopped working. When a user clicks password reset, it brings up the error message: Password cant be blank, password is too short(6 min) Ran into this error in video 275 How I Test. on 11:20 Failure/Error: click_button "Reset Password" ActiveRecord::RecordInvalid: Validation failed: Password can't be blank, Password is too short (minimum is 6 characters), Password confirmation can't be blank # ./app/models/user.rb:30:in send_password_reset' # ./app/controllers/password_resets_controller.rb:7:increate' # (eval):2:in click_button' # ./spec/requests/password_resets_spec.rb:9:inblock (2 levels) in ' Finished in 13.66 seconds 95 examples, 1 failure This is some of the code being used. user.rb # == Schema Information # # Table name: users # # id :integer not null, primary key # name :string(255) # email :string(255) # created_at :datetime not null # updated_at :datetime not null # class User < ActiveRecord::Base attr_accessible :name, :email, :password, :password_confirmation has_secure_password before_save { |user| user.email = email.downcase } before_save :create_remember_token validates :name, presence: true, length: { maximum: 50 } VALID_EMAIL_REGEX = /\A[\w+\-.]+@[a-z\d\-.]+\.[a-z]+\z/i validates :email, presence: true, format: { with: VALID_EMAIL_REGEX }, uniqueness: { case_sensitive: false } validates :password, presence: true, length: { minimum: 6 } validates :password_confirmation, presence: true def send_password_reset generate_token(:password_reset_token) self.password_reset_sent_at = Time.zone.now save! UserMailer.password_reset(self).deliver end def generate_token(column) begin self[column] = SecureRandom.urlsafe_base64 end while User.exists?(column => self[column]) end def self.search(search) if search find(:all, :conditions => ['name LIKE ?', "%#{search}%"]) else find(:all) end end private def create_remember_token self.remember_token = SecureRandom.urlsafe_base64 end end password_resets_controller.rb class PasswordResetsController < ApplicationController def new end def create user = User.find_by_email(params[:email]) user.send_password_reset redirect_to root_url, :notice => "Email sent with password reset instructions." end def edit @user = User.find_by_password_reset_token!(params[:id]) end end new.html.erb <h1>Reset Password</h1> <%= form_tag password_resets_path, :method => :post do %> <div class="field"> <%= label_tag :email %> <%= text_field_tag :email, params[:email] %> </div> <div class="actions"><%= submit_tag "Reset Password" %></div> <% end %>

    Read the article

  • Rails: How can I log all requests which take more than 4s to execute?

    - by Fedyashev Nikita
    I have a web app hosted in a cloud environment which can be expanded to multiple web-nodes to serve higher load. What I need to do is to catch this situation when we get more and more HTTP requests (assets are stored remotely). How can I do that? The problem I see from this point of view is that if we have more requests than mongrel cluster can handle then the queue will grow. And in our Rails app we can only count only after mongrel will receive the request from balancer.. Any recommendations?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • string and z-depth animation, as3

    - by VideoDnd
    How do I pass this string to my children? formatCount(fcount) is the value I'm trying to pass to children timer is the value the children are recieving now Timer that loops through an array of displayObjects var timer:Timer = new Timer(100); var count:int = 0; var fcount:int = 0; timer.addEventListener(TimerEvent.TIMER, countdown); function countdown(event:TimerEvent) { count++; fcount=int(count*count/1000); //myText.text = formatCount(fcount); //LOOPS THROUGH MY LIST ITEMS 'see array at bottom' var currentFrame:int = timer.currentCount % frames.length; for (var i:int = 0; i < frames.length; ++i) { frames[i].visible = (i == currentFrame); } } timer.start(); //SUBSTRING AND ZERO PLACEHOLDER function formatCount(i:int):String { var fraction:int = i % 100; var whole:int = i / 100; return ("0000000" + whole).substr(-7, 7) + "." + (fraction < 10 ? "0" + fraction : fraction); } //PASS MATH TO SPRITE HANDLER function spriteHandler(e:Event):void { numbers.setTime(formatCount(fcount)); } //LOST ARGUMENT==>GOES TO NUMBERSVIEW //var numbers:NumbersView; var numbers:*; //MY ARRAY 'list of numbers, one-to-zero' var frames:Array = [new Frame1(),new Frame2(),new Frame3(), new Frame4(),new Frame5(),new Frame6(),new Frame7(),new Frame8(),new Frame9(), new Frame0()]; for each (var frame:Sprite in frames) { addChild(frame); } Example of NumbersView 'increment and place display objects across the stage' function NumbersView() { _listItems = new Array(); previousNums = new Array(); var item:NumberImage; for (var i:Number = 0; i <= 9; i++) { item = new NumberImage(); addChild(item); item.x = i * item.width; _listItems.push(item); } }

    Read the article

  • What's the simplest way to extract the last section of an IP address?

    - by Jon Cage
    I have an IP address which I want to grab the last chunk of as an integer. So from "192.168.1.150" I'd get 150. This is the code I'd concocted (I'm using C++/CLI), but somehow it feels rather clunky: String^ ipString = "192.168.1.150"; int lastDot = ipString->LastIndexOf('.'); int lastSection = int::Parse(ipString->Substring(lastDot, ipString->Length-lastDot)); Is there a simpler way of doing this?

    Read the article

  • Deleting document attachments in CouchDb

    - by henrik_lundgren
    In CouchDb's documentation, the described method of deleting document attachments is to send a DELETE call to the attachment's url. However, I have noticed that if you edit the document and remove the attachment stub from the _attachment field, it will not be accessible anymore. If i remove foo.txt from the document below and save to CouchDb it will be gone the next time I access the document: { "_id":"attachment_doc", "_rev":1589456116, "_attachments": { "foo.txt": { "stub":true, "content_type":"text/plain", "length":29 } } } Is the attachment actually deleted on disk or is just the reference to it deleted?

    Read the article

  • Question about fwrite API

    - by michael
    Hi, In C++, there is a fwrite() which writes a buffer to a file on disk: http://www.cplusplus.com/reference/clibrary/cstdio/fwrite/ Can you please tell me if there is any buffer inside that fwrite implementation? i.e. if I call fwrite() multiple times (say 10 times), does it actually invoke file i/o 10 different times? Thank you.

    Read the article

  • JavaFx MediaPlayer via HTTPS

    - by LMA
    I'm trying to make applet-videoplayer, that takes video files from PHP script via https. If source of data is httpS ://domain.com/1.flv - it works httpS ://domain.com/view.php - it doesn't work HTTP ://domain.com/view.php - it works again. In php I make HTTP header, that contains Content-type: video/x-flv Last-Modified: Wed, 14 Apr 2010 14:04:34 GMT Accept-Ranges: bytes Content-Length: 24693477 What else should I add in header to make it work? If I use not mediaPlayer, but MediaBox from samples, it writes "Loading", and keeps "rolling" locading image

    Read the article

  • Understanding configuration for parallel calling in web app (IIS + MS SQL)

    - by mmcteam.com.ua
    We have an ASP.NET MVC application + IIS 7.5 + SQL Server 2008 R2. We have to load a lot of aggregate counters on the each page. We decided to use ajax and call with javascript for each counter or groups of counters and return them as JSON result. We solve the problem that user doesn't wait for page loading, page loads fast. User waits for counters loading while seeing other page content. But we thought that if we make calls from javascript - our queries will be make async, but we notice, that it is not. All our javascipt calls runs immediately, but action that they invoke are in queue. If we use Async Controller ability - all counters calculating simultaneously, but user has to wait for the longest counter calculating before page loads. The question: We want to understand what is happens if we use ajax and call two or more actions simultaneously. And how can we configuring this. (also in each action we make some queries to sql server)

    Read the article

  • BST Level Traversal

    - by Dalton Conley
    Ok, so I'm trying to do a level order traversal of a binary search tree and its not working. The code below makes sense to me, but that is probably because I've been looking at it forever and I've convinced myself that it should work. void BST<T>::levelByLevel(ostream &out) { Queue<BinNodePointer> q; BinNodePointer subtreeRoot; if(myRoot == NULL) return; q.enqueue(myRoot); while(!q.empty()) { subtreeRoot = q.front(); out << subtreeRoot->data << " "; q.dequeue(); if(subtreeRoot->left != NULL) q.enqueue(subtreeRoot->left); if(subtreeRoot->right != NULL) q.enqueue(subtreeRoot->right); } } Maybe you guys could point out what I'm doing wrong because, although I understand the concept of a binary search tree, I'm not 100% on all the ins and outs.

    Read the article

  • Xml with spaces as InnerText

    - by David Rutten
    I'm parsing Xml data which has entries like this: <item name="UserText" type_name="gh_string" type_code="10"> </item> I'm supposed to read the 6 spaces as a String, but both the InnerText and InnerXml values of the System.Xml.XmlNode are zero length Strings. Is there any way I can get at this whitespace data in existing files and what do I need to do in the future to prevent this sort of screw up?

    Read the article

  • Supporting twitter-like user page urls with apache/php?

    - by user246114
    Hi, I'm using php on apache with mysql. I want to let users enter a url into their browser to see a custom user page for themselves, just like twitter does. For example, they could enter urls like: www.mysite.com/johndoe www.mysite.com/janedoe and see that user's page. How could I do this with php and apache? I don't want to create a folder on disk for every user like above, I'd instead kind of like to catch the url and generate the page on the fly for them, Thanks

    Read the article

  • Cascading MVC controllers with CatchAll Routes

    - by Richard
    Hi, I have an MVC app which has its routes defined with the final route being a catch all route to a "PageController" for a database driven collection of pages. What I want to achieve is to be able to plugin to the app a second controller to the catch all route which the first controller passes on to if it does not find the url recieved in the database. Effectively I want to queue up controllers with catch all actions: public ActionResult PageCatchall(string url) { var page = repository.Get<Page>(string url); if (page != null) { // Handle the request return View(page) } // Otherwise pass to a new controller ???? } Anyone have any good ideas as to how to solve this? I have tried RedirectToAction but that requires that the next controller has a different route to the action. I have tried ActionInvoker but this failed to work the way I did it.

    Read the article

  • Weird constants

    - by Quassnoi
    I've seen these in real code: #define SCREEN_DIMENSIONS 2 #define THREE_THOUSAND_FIVE_HUNDRED_TWENTY_TWO 3522 What is the weirdest constant you've ever seen? P. S. And of course my favorite in JScript: bool b; switch (b.ToString().length) { case 4: // true ... break; case 5: // false ... break; )

    Read the article

  • Extract dates from filename(C#3.0)

    - by Newbie
    I have a situation where I need to extract dates from the file names whose general pattern is [filename_]YYYYMMDD[.fileExtension] e.g. "xxx_20100326.xls" or x2v_20100326.csv The below program does the work //Number of charecter in the substring is set to 8 //since the length of YYYYMMDD is 8 public static string ExtractDatesFromFileNames(string fileName) { return fileName.Substring(fileName.IndexOf("_") + 1, 8); } Is there any better option of achieving the same? I am basically looking for standard practice. I am using C#3.0 and dotnet framework 3.5 Thanks

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 446 447 448 449 450 451 452 453 454 455 456 457  | Next Page >