Search Results

Search found 44742 results on 1790 pages for 'after create'.

Page 453/1790 | < Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >

  • TFS and team project portal question

    - by DotnetDude
    The team explorer for my project looks like this: mytfsserver\mycollection -- Project 1 solution -- Project 2 solution -- Project 3 solution When I right click on one of the solutions and do a "Show Project Portal", I see the following hierarchy: mycollection - WSS site Project 1 site with dashboard (appears to be a MOSS site) Project 2 site with dashboard (appears to be a MOSS site) Project 3 site with dashboard (appears to be a MOSS site) Are the dashboard sites MOSS sites? If I want to create a wiki, do I have to create a subsite with the wiki template under each of the Project sites? Can someone point me to a document/video that talks about the sites that area created by TFS by default?

    Read the article

  • How to run Jquery constructor from own function?

    - by Invidian
    I need to create a function which will returning jQuery.Color object and i have no idea how to do it. Here is code example function newcolor () { var obj = new $.Color( 'rgb(0,0,0)' ); return obj;} var foo = newcolor(); foo.red(); Edit: My full code: function my (element,a,b,c){ //class my this.target = $(elem); this.new_color = function (a,b,c) { return new $.Color( 'rgb('+a+','+b+','+c+')'); } this.base_color = new_color (a,b,c); this.colorize = function () ( this.target.css({ background-color: new_color }); } var div = new My($('foo'),0,0,0); div.new_color(255,255,255); div.colorize(); My goal is to create class which can hold jquery element and operate on it. Now I'm stuck on returning $.Color().

    Read the article

  • How to subString a block of user generated HTML while preserving formatting?

    - by Chad
    I'd like to create the typical preview paragraph with a [read more] link. Problem is, the content that I'd like to SubString() contains text and html, written by a user with a WYSIWYG editor. Of course, I check to make sure the string is not null or empty, then SubString() it, problem is that I could end up breaking the html tags, throwing off the rendering of the entire site. The WYSIWYG editor doesn't seem to create perfectly formatted HTML, and many times seems to use <br /> tags instead of <p></p>, etc... basically, I can't rely on well-formed tags, etc. My workaround was to just strip out all HTML and substring the leftover text. This works, but loses any of the formatting that was in the HTML. What's the best method of SubString()'ing a block of non-well-formed HTML while maintaining HTML that won't break the rendering of the site?

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Problem with SQL syntax (probably simple)

    - by Bryan Folds
    I'm doing some custom database work for a module for Drupal and I get the following SQL error when trying to create my table: user warning: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'DEFAULT NULL, rooms INT DEFAULT NULL, adults INT DEFAULT NULL, children' at line 14 query: CREATE TABLE dr_enquiry ( eId INT unsigned NOT NULL auto_increment, eKey VARCHAR(16) NOT NULL, dateSent INT NOT NULL DEFAULT 0, status VARCHAR(30) NOT NULL DEFAULT 'Unanswered', custName VARCHAR(50) NOT NULL, custEmail VARCHAR(200) NOT NULL, custPhone VARCHAR(25) NOT NULL, custCountry VARCHAR(40) NOT NULL, custIP VARCHAR(11) DEFAULT NULL, offerName VARCHAR(100) NOT NULL, offerURL VARCHAR(200) NOT NULL, arrival DATETIME DEFAULT NULL, departure DEFAULT NULL, rooms INT DEFAULT NULL, adults INT DEFAULT NULL, children INT DEFAULT NULL, childAges VARCHAR(32) DEFAULT NULL, toddlers INT DEFAULT NULL, toddlerAges VARCHAR(32) DEFAULT NULL, catering VARCHAR(255) DEFAULT NULL, comments VARCHAR(255) DEFAULT NULL, agent VARCHAR(100) DEFAULT NULL, voucher VARCHAR(100) DEFAULT NULL, PRIMARY KEY (eId) ) /*!40100 DEFAULT CHARACTER SET UTF8 */ in /home/travelco/public_html/includes/database.inc on line 550.

    Read the article

  • Maintaining both free and pro versions of an application

    - by Immortal
    I want to create a PRO version of my application for Android and was wondering how to structure my repository. For know I have a trunk and feature branches. I'd like to put a pro version in another branch but maybe there is a better way? For example, maybe I should create two branches - one for free version, the other for pro? Pro version will have additional features and will be ads-free, so eg. I don't want to include AdMob libraries in the pro version. Do you have any experience or suggestions as to what would be the best way to structure the repository in this case?

    Read the article

  • SelectList in Asp-mvc and data from the database

    - by George
    Hello guys. I'm having some troubles with SelectList in ASP.MVC. Here is the issue: I have a Create View and begind a ViewModel model. The page load just fine (GET verb). But when posting, something happens, and my model is considered invalid, and it cannot insert. Here's what i've tried so far. public class DefinitionFormViewModel { private Repository<Category> categoryRepository = new Repository<Category>(); public Definition ViewDefinition { get; private set; } public SelectList Categories { get; private set; } public DefinitionFormViewModel(Definition def) { ViewDefinition = def; // here i wanted to place it directly, like shown in NerdDinner Tutorial // new SelectList(categoryRepository.All(),ViewDefinition.Category); Categories = new SelectList(categoryRepository.All(), "CategoryId", "CategoryName", ViewDefinition.CategoryId); } } // pageview which inherits DefinitionFormViewModel <div class=editor-field"> <%= Html.DropDownList("Category",Model.Categories) %> <%= Html.ValidationMessageFor(model => Model.ViewDefinition.Category) %> </div> // controller methods [Authorize] public ActionResult Create() { Definition definition = new Definition(); return View(new DefinitionFormViewModel(definition)); } [AcceptVerbs(HttpVerbs.Post), Authorize] public ActionResult Create(int id,Definition definition) { Term term = termRepository.SingleOrDefault(t => t.TermId == id); if (term == null) { return View("NotFound", new NotFoundModel("Termo não encontrado", "Termo não encontrado", "Nos desculpe, mas não conseguimos encontrar o termo solicitado.", "Indíce de Termos", "Index", "Term")); } else { if (ModelState.IsValid) { try { definition.TermId = term.TermId; definition.ResponsibleUser = User.Identity.Name; UpdateModel(definition); term.Definitions.Add(definition); termRepository.SaveAll(); return RedirectToAction("Details", "Term", new { id = term.TermId }); } catch (System.Data.SqlClient.SqlException sqlEx) { ModelState.AddModelError("DatabaseError", "Houve um erro na inserção desta nova definição"); } catch { foreach (RuleViolation rv in definition.GetRuleViolations()) { ModelState.AddModelError(rv.PropertyName, rv.ErrorMessage); } } } } return View(new DefinitionFormViewModel(definition)); } I'm sorry about the long post, but I cant figure this out. I got no graphic errors or exceptions. My execution terminates in if (ModelState.IsValid). Thanks for your time George

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Stored Procedure with ALTER TABLE

    - by psayre23
    I have a need to sync auto_increment fields between two tables in different databases on the same MySQL server. The hope was to create a stored procedure where the permissions of the admin would let the web user run ALTER TABLE [db1].[table] AUTO_INCREMENT = [num]; without giving it permissions (That just smells of SQL injection). My problem is I'm receiving errors when creating the store procedure. Is this something that is not allowed by MySQL? DROP PROCEDURE IF EXISTS sync_auto_increment; CREATE PROCEDURE set_auto_increment (tableName VARCHAR(64), inc INT) BEGIN ALTER TABLE tableName AUTO_INCREMENT = inc; END;

    Read the article

  • handling Concurrency in SQL SERVER 2005

    - by sameer
    Hi, I have one question for you, if you can answer and refer resource it will be great help. I have a scenario where i need to create a appointment slot and a serial no for each slot memberwise. ex: Member Id |App Slot # 1|1 1|2 2|1 2|2 1|3 what im doing is take the Max slot number,increamenting it and insert it memberwise. but the problem is concurrent user can create a slot when i take the max slot after that if any other user insert the slot the value that im working with is no more valid, how to over come this problem Thanks & Regards, Sameer

    Read the article

  • Passing single attributes to associated factories

    - by lambdabutz
    I'm looking for a way to pass fields into the factories of associated models without having to explicitly call the factory itself. For example, lets say I have some factories like so: Factory.define :person do |person| person.name "Default Bob" person.sex "M" person.house {|p| p.association(:house)} end Factory.define :house do |house| house.color "Red" house.has_ac true house.suburb {|h| h.association(:suburb)} end Factory.define :suburb do |suburb| suburb.name "Little boxes" end This is fine and all, but if I want to use factories to create someone in a specific house in a specific suburb I have do this: sub = Factory(:suburb, :name => "Blue town") house = Factory(:house, :color => "Blue", :suburb => sub) person = Factory(:person, :name => "Bill", :house => house) While this isn't bad in this small case, my actual models sometimes have 7 or 8 associations, and when I want to create an object whose associations I only care about a single attribute, the code for this starts to get really heavy. Is there somewhat I can pass attributes to nested Factories without having to recall the Factory itself?

    Read the article

  • When should I use static methods in a class and what are the benefits?

    - by NAVEED
    I have concept of static variables but what are the benefits of static methods in a class. I have worked on some projects but I did not make a method static. Whenever I need to call a method of a class, I create an object of that class and call the desired method. Static variable in a method holds it's value even when method is executed but accessible only in its containing method but what is the best definition of static method? Is calling the static method without creating object of that class is the only benefit of static method? What is the accessible range for static method? What is the syntax to create and calling static method in php? Thanks

    Read the article

  • A code using SharePoint classes doesn't run on systems not having SharePoint installed

    - by Manish
    I have a window application which uses SP classes to create a site. I works fine on a system having Windows Server 2003 R2 with sharepoint installed. But it doesn't work on a system having XP installed and SharePoint not installed. The fact is that both of these systems are on a intranet. So I assumed that the NON-SP system would be able to run the code and create a site on the system having SP installed if all the required parameters (like serverLocation, domain, username, password) are provided. I did copied the DLLs to these NON-SP system and referenced them to build the project: Microsoft.SharePoint.dll microsoft.sharepoint.portal.dll Microsoft.SharePoint.Publishing.dll But this too didn't worked. What am I missing? Is my assumption wrong?

    Read the article

  • Positioning elements outside an Activity on Android

    - by Aleksander Kmetec
    Is there a way to absolutely position an UI element on Android so that it is located outside an Activity? For example: can you create a fullscreen ImageView simply by moving/resizing an ImageView inside an existing regular Activity instead of creating a new fullscreen activity? EDIT: Re-reading my question I see I wasn't very clear about what I'm trying to accomplish. I'd like to temporarily extend an element to cover the notification bar at the top of the screen. I need to create a semitranslucent fullscreen overlay but since translucent activities cannot cover the notification bar I'm trying to find out if it's possible for an element to break out of activity's bounds and resize itself to fill the whole screen, top to bottom.

    Read the article

  • How to name an event handler of a private variable in Vb.Net following FxCop rules and Vb.Net standa

    - by SoMoS
    Hello, On one side, in Vb.Net when you add an event handler to an object the created method is named: <NameOfTheObject>_<NameOfTheMethod>. As I like to have consistent syntax I always follow this rule when creating event handlers by hand. On the other side when I create private variables I prefix them with m_ as this is a common thing used by the community, in C# people use to put _ at the beginning of a variable but this is no CLS compliant. At the end, when I create event handlers for events raised by private variables I end with Subs like m_myVariable_MyEvent. Code Analysis (Fx Cop) is complainig about this way of naming because the method does not start with uppercase and because the _, so the question is: What naming standards do you follow when creating event handlers by hand that follow the Fxcop rules if any? Thanks in advance.

    Read the article

  • Creating my own bundle in xCode, for iPhone application

    - by sagar
    Hello everyone! I am having some difficulty creating a bundle for my application, and placing files in the bundle. For example, FaceBook has developed a bundle for iPhone applications using their framework. In the same way, I also want to create a bundle which can be reused for many applications. My questions are: what steps should I follow to create a bundle for any kind of application? what should be taken care while creating a bundle? Thanks in advance for sharing your knowledge.

    Read the article

  • EF4: ObjectContext inconsistent when inserting into a view with triggers

    - by user613567
    I get an Invalid Operation Exception when inserting records in a View that uses “Instead of” triggers in SQL Server with ADO.NET Entity Framework 4. The error message says: {"The changes to the database were committed successfully, but an error occurred while updating the object context. The ObjectContext might be in an inconsistent state. Inner exception message: The key-value pairs that define an EntityKey cannot be null or empty. Parameter name: record"} @ at System.Data.Objects.ObjectContext.SaveChanges(SaveOptions options) at System.Data.Objects.ObjectContext.SaveChanges() In this simplified example I created two tables, Contacts and Employers, and one view Contacts_x_Employers which allows me to insert or retrieve rows into/from these two tables at once. The Tables only have a Name and an ID attributes and the view is based on a join of both: CREATE VIEW [dbo].[Contacts_x_Employers] AS SELECT dbo.Contacts.ContactName, dbo.Employers.EmployerName FROM dbo.Contacts INNER JOIN dbo.Employers ON dbo.Contacts.EmployerID = dbo.Employers.EmployerID And has this trigger: Create TRIGGER C_x_E_Inserts ON Contacts_x_Employers INSTEAD of INSERT AS BEGIN SET NOCOUNT ON; insert into Employers (EmployerName) select i.EmployerName from inserted i where not i.EmployerName in (select EmployerName from Employers) insert into Contacts (ContactName, EmployerID) select i.ContactName, e.EmployerID from inserted i inner join employers e on i.EmployerName = e.EmployerName; END GO The .NET Code follows: using (var Context = new TriggersTestEntities()) { Contacts_x_Employers CE1 = new Contacts_x_Employers(); CE1.ContactName = "J"; CE1.EmployerName = "T"; Contacts_x_Employers CE2 = new Contacts_x_Employers(); CE1.ContactName = "W"; CE1.EmployerName = "C"; Context.Contacts_x_Employers.AddObject(CE1); Context.Contacts_x_Employers.AddObject(CE2); Context.SaveChanges(); //? line with error } SSDL and CSDL (the view nodes): <EntityType Name="Contacts_x_Employers"> <Key> <PropertyRef Name="ContactName" /> <PropertyRef Name="EmployerName" /> </Key> <Property Name="ContactName" Type="varchar" Nullable="false" MaxLength="50" /> <Property Name="EmployerName" Type="varchar" Nullable="false" MaxLength="50" /> </EntityType> <EntityType Name="Contacts_x_Employers"> <Key> <PropertyRef Name="ContactName" /> <PropertyRef Name="EmployerName" /> </Key> <Property Name="ContactName" Type="String" Nullable="false" MaxLength="50" Unicode="false" FixedLength="false" /> <Property Name="EmployerName" Type="String" Nullable="false" MaxLength="50" Unicode="false" FixedLength="false" /> </EntityType> The Visual Studio solution and the SQL Scripts to re-create the whole application can be found in the TestViewTrggers.zip at ftp://JulioSantos.com/files/TriggerBug/. I appreciate any assistance that can be provided. I already spent days working on this problem.

    Read the article

  • mysql GROUP_CONCAT

    - by user301766
    I want to list all users with their corropsonding user class. Here are simplified versions of my tables CREATE TABLE users ( user_id INT NOT NULL AUTO_INCREMENT, user_class VARCHAR(100), PRIMARY KEY (user_id) ); INSERT INTO users VALUES (1, '1'), (2, '2'), (3, '1,2'); CREATE TABLE classes ( class_id INT NOT NULL AUTO_INCREMENT, class_name VARCHAR(100), PRIMARY KEY (class_id) ); INSERT INTO classes VALUES (1, 'Class 1'), (2, 'Class 2'); And this is the query statement I am trying to use but is only returning the first matching user class and not a concatenated list as hoped. SELECT user_id, GROUP_CONCAT(DISTINCT class_name SEPARATOR ",") AS class_name FROM users, classes WHERE user_class IN (class_id) GROUP BY user_id; Actual Output +---------+------------+ | user_id | class_name | +---------+------------+ | 1 | Class 1 | | 2 | Class 2 | | 3 | Class 1 | +---------+------------+ Wanted Output +---------+---------------------+ | user_id | class_name | +---------+---------------------+ | 1 | Class 1 | | 2 | Class 2 | | 3 | Class 1, Class 2 | +---------+---------------------+ Thanks in advance

    Read the article

  • Css3 Transition on background transparent not working in Chrome 5

    - by Ricardo Koch
    I`m trying to create an animation using CSS3 transition. The animation is a gradient background that should change his color (rgba). I used the webkit tag for the gradient and it`s working in Chrome 5.0.375.55. Looking into w3c site I see that "background-image - only gradients" is supported for the transition. (http://www.w3.org/TR/css3-transitions/) But I can only animate the background-color property with this version of chrome. With gradient the transition does not work. Does anyone managed to create an animation with background gradients?

    Read the article

  • unable to install anything on ubuntu 9.10 with aptitude

    - by Srisa
    Hello, Earlier i could install software by using the 'sudo aptitude install ' command. Today when i tried to install rkhunter i am getting errors. It is not just rkhunter, i am not able to install anything. Here is the text output: user@server:~$ sudo aptitude install rkhunter ................ ................ 20% [3 rkhunter 947/271kB 0%] Get:4 http://archive.ubuntu.com karmic/universe unhide 20080519-4 [832kB] 40% [4 unhide 2955/832kB 0%] 100% [Working] Fetched 1394kB in 1s (825kB/s) Preconfiguring packages ... Selecting previously deselected package lsof. (Reading database ... ................ (Reading database ... 95% (Reading database ... 100% (Reading database ... 20076 files and directories currently installed.) Unpacking lsof (from .../lsof_4.81.dfsg.1-1_amd64.deb) ... dpkg: error processing /var/cache/apt/archives/lsof_4.81.dfsg.1-1_amd64.deb (--unpack): unable to create `/usr/bin/lsof.dpkg-new' (while processing `./usr/bin/lsof'): Permission denied dpkg-deb: subprocess paste killed by signal (Broken pipe) Selecting previously deselected package libmd5-perl. Unpacking libmd5-perl (from .../libmd5-perl_2.03-1_all.deb) ... Selecting previously deselected package rkhunter. Unpacking rkhunter (from .../rkhunter_1.3.4-5_all.deb) ... dpkg: error processing /var/cache/apt/archives/rkhunter_1.3.4-5_all.deb (--unpack): unable to create `/usr/bin/rkhunter.dpkg-new' (while processing `./usr/bin/rkhunter'): Permission denied dpkg-deb: subprocess paste killed by signal (Broken pipe) Selecting previously deselected package unhide. Unpacking unhide (from .../unhide_20080519-4_amd64.deb) ... dpkg: error processing /var/cache/apt/archives/unhide_20080519-4_amd64.deb (--unpack): unable to create `/usr/sbin/unhide-posix.dpkg-new' (while processing `./usr/sbin/unhide-posix'): Permission denied dpkg-deb: subprocess paste killed by signal (Broken pipe) Processing triggers for man-db ... Errors were encountered while processing: /var/cache/apt/archives/lsof_4.81.dfsg.1-1_amd64.deb /var/cache/apt/archives/rkhunter_1.3.4-5_all.deb /var/cache/apt/archives/unhide_20080519-4_amd64.deb E: Sub-process /usr/bin/dpkg returned an error code (1) A package failed to install. Trying to recover: Setting up libmd5-perl (2.03-1) ... Building dependency tree... 0% Building dependency tree... 50% Building dependency tree... 50% Building dependency tree Reading state information... 0% ........... .................... I have removed some lines to reduce the text. All the error messages are in here though. My experience with linux is limited and i am not sure what the problem is or how it is to be resolved. Thanks.

    Read the article

  • Structure accessible by attribute name or index options

    - by Bruno DeGoia
    I am very new to Python, and trying to figure out how to create an object that has values that are accessible either by attribute name, or by index. For example, the way os.stat() returns a stat_result or pwd.getpwnam() returns a struct_passwd. In trying to figure it out, I've only come across C implementations of the above types. Nothing specifically in Python. What is the Python native way to create this kind of object? I apologize if this has been widely covered already. In searching for an answer, I must be missing some fundamental concept that is excluding me from finding an answer.

    Read the article

< Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >