Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 465/1731 | < Previous Page | 461 462 463 464 465 466 467 468 469 470 471 472  | Next Page >

• Know any file compare utility for chunks of text?

  - by Belun

  Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

  Read the article

• How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

  - by Piotr Piaseczny

  Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

  Read the article

• iPhone Docked Playing Through PC, Buzzing.

  - by DrFloyd5

  Hi. I have an iPhone that I fit into an Apple dock. There is an audio cable from dock into the line in on my sound card. My headphones are plugged into the line out. I get this really quite buzz that is fairly constant, but changes as the iphone "does stuff". It's not so bad when the music is playing. But when it stops I get the buzz, so I can't really use my headphones as "noise cancellation." It doesn't help to change my volume sliders on the PC. Any ideas? Thanks in advance.

  Read the article

• How to failover to local account on a cisco switch/router if radius server fails?

  - by 3d1l

  I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

  Read the article

• Unable to delete files in Temporary Internet Files folder

  - by Johnny

  I'm on Win7. I have a large number of of large .bin files, totaling 183GB, in my Temporary Internet Files folder. They all seem to come from video sharing sites like youtube. The files are invisible in Explorer even after allowing viewing of hidden files. The only way I can see them is by issuing "dir /fs" on the command line. Now when I try to delete them from the command line nothing happens. Trying to delete the whole folder from Explorer results in access denied because another process is using a file in the folder (IE is not running while I'm doing this). Trying to clear the folder using IE is also unsuccessful. How do I delete these files? How did they end up being there without being deleted by IE?

  Read the article

• How to run nodejs on linux platform

  - by rotem

  How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

  Read the article

• How to start MSSQL Server with corrupt model db

  - by Jordan McGuigan

  After moving some databases around (restoring, deleting, etc) we experienced an issue creating new databases. Specifically, When trying to create a new database MSSQL Server it failed because the "The database 'model' is marked RESTORING and is in a state that does not allow recovery to be run". As some online solutions suggested, we tried to Start and Stop the MSSQL Service. Service would not restart because "Could not create tempdb. You may not have enough disk space available. Free additional disk space by deleting other files on the tempdb drive" (FYI: the drive has 100gb of free space). Tried restarting the machine the MSSQL Server is running on. When the server came back online, we received the same error. We have tried deleting tempdb.mdf and restoring the modeldb from the templates folder, but neither of these solved the issue. We are unable to connect to the database, even in single user mode. Many of the online solutions have us running SQL commands against the server, but we are unable to connect (even in single user mode) to the DB to run commands against the server. Specific error messages: Database 'model' cannot be opened. It is in the middle of a restore. (Microsoft SQL Server, Error: 927) The SQL Server (MSSQLSERVER) service is starting. The SQL Server (MSSQLSERVER) service could not be started. A service specific error occurred: 1814. We need the server up and running again ASAP.

  Read the article

• Map keys in Vim

  - by efficiencyIsBliss

  I want to map e to mean end of line. I tried the following mapping in my vimrc: map $ e $ is the default end of line command. However, this doesn't work. I'm wondering what the problem is. Also, I want to map Alt+right/left arrow to navigate words. So, for example, Alt+right arrow would take me to end of word. This command is currently mapped to e. Any tips on how I would go about doing this? Thanks!

  Read the article

• xm console command is not working in XEN

  - by stillStudent

  I have XEN 4.0.x.x rpm with CENT OS. I have set it up and have many VMs on it. But problem is when I execute 'xm console ' command from dom0, command just hangs dom0 and some 'y' comes up in next line but nothing really happens. Is it a bug in xen 4.0 and I need to upgrade it or I can tweak some configuration file in /etc/xen/ to make it work. I found following at some site but its not working: In order to be able to login to your domU from the console using: xm create {your hostname}.cfg -c (to the set root password for ssh, for instance, or to see more output than just kernel output when debugging) it may be necessary to add the following line to your /etc/xen/{your hostname}.cfg extra='xencons=tty' Is there any other way to solve it?

  Read the article

• PHP session files have permissions of 000 - They're unusable

  - by vanced

  I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

  Read the article

• How do I allow a (local) user to start/stop services with a scheduled task?

  - by Mulmoth

  Hi, on a Windows 2008 R2 server I have two small .cmd-scripts to start/stop a certain service. They look like this net start MyService and net stop MyService I want to execute these script via scheduled task, and I thought it would be best to create a local user for this job. The user is not member of the Administrators group. But the scripts fail with exit code 2. When I logon with this local user and try to execute these script in command line, I see a message like (maybe not exactly translated from german to english): Error code 5: Access denied It doesn't matter whether I start the command line as Administrator or not. How can this local user gain rights to do the job?

  Read the article

• Splitting an HTTP request into multiple byte-range requests

  - by redpola

  I have arrived at the unusual situation of having two completely independent Internet connections to my home. This has the advantage of redundancy etc but the drawback that both connections max out at about 6Mb/s. So one individual outbound http request is directed by my "intelligent gateway" (TP-LINK ER6120) out over one or the other connection for its lifetime. This works fine over complex web pages and utilises both external connects fine. However, single-http-request downloads are limited to the maximum rate of one of the two connections. So I'm thinking, surely I can setup some kind of proxy server to direct all my http requests to. For each incoming http request, the proxy server will issue multiple byte-range requests for the desired data and manage the reassembly and delivery of that data to the client's request. I can see this has some overhead, and also some edge cases where there will be blocking problems waiting for data. I also imagine webmasters of single-servers would rather I didn't hit them with 8 byte-range requests instead of one request. How can I achieve this http request deconstruct/reconstruction? Or am I just barking mad?

  Read the article

• Pressing 'Enter' doesn't really work in Firefox

  - by inkedmn

  When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

  Read the article

• What are the advantages of registered memory?

  - by odd parity

  I'm browsing for a few low-end servers for a startup and I'm a bit confused about the different memory types. The advantage of ECC is clear - single-bit error correction. When it comes to registered memory it seems more vague, especially in systems that support both registered and unbuffered memory. A Google search mostly finds copies of the Wikipedia article, which states that registered memory chips "...place less electrical load on the memory controller and allow single systems to remain stable with more memory modules than they would have otherwise". However I can't find any quantification of this. What I'm wondering about is: Is registered memory an improvement over unbuffered when it comes to soft error rate, or is it purely about the maximum number of modules supported? If yes, at what point (amount of modules or GB of memory) do these improvements start to become noticeable? For a specific example, the HP ProLiant DL 120 G6 server manual states that maximum supported memory configuration is 16 GB unbuffered (4x4GB) or 12 GB registered (6x2GB). In this case I'd rather have the extra 4GB of memory if the reliability difference is negligible.

  Read the article

• Is it possible to trace someone using Google during an online exam?

  - by George

  I happen to be a professor at a reputed college. I want to design an online exam for over 1000 students via around 50 computers right after the vacation ends. Now the problem is that I have heard that many students use Google on a different tab to find answers when no invigilator is around. I want to know if there is a way to backtrace it after the exams via some kind of history or any other possible way. In our university there is a standard system. I am not good with computers but I will try to explain. Each computer uses mozilla to connect to a server centrally located via an IP. The students open it and enter a unique ID and password to start the exams. Many questions are jumbled and different groups of students give exam in a different time slot. Is there any way to trace it since I want to set an example for students so they won't cheat and give exams in an honest way. Additional details: Since the number of computers are less than the number of students, more than 10 students are going to use a single computer on a single day over a period of 10 hours. After this, if I check the history (and let's say someone even forgot to delete the history and I see it), will I able to figure out who among the 10 has done it? Moreover, is it even practical and feasible?

  Read the article

• Automating the installation using SSH

  - by RAY

  I am running a bash script from a remote host to run a binary file which installs 64 bit JDK 6 update 29 on multiple VMs across the Environment. It is installing the file but, at the last line i have to hit a enter to complete the installation. I want to fully automate the script where i do not have to hit the enter at the last line. This is what i am using ssh ${V_TIERS}@${V_TIERS} 'cd JDK; sh jdk-6u29-solaris-sparcv9.sh' It updates as desired, but during install i have to hit enter to continue and complete the installation. Can anybody please help to fully automate the update process.

  Read the article

• How to reformat reStructuredText?

  - by wal-o-mat

  I'm writing reST in vim, which handles line breaks for me (after 80 chars). However, since I frequently go back and edit the text before, lines get ugly again. For example, in tables, it's sometimes annoying to re-format a complete table just because you need a line break in some place. So I wish I had a program that reads my ugly-but-correct reStructuredText and outputs it nicely formatted and wrapped. I found that pandoc in.rst -w rst mostly works, but it has some drawbacks. For example :author: John Doe becomes author John Doe and title formatting is changed as well. Sadly, there seems to be no rst2rst or something similar. Does anyone have some advice?

  Read the article

• PHPMyAdmin running very slow over internet but fine locally

  - by columbo

  I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

  Read the article

• how do I view what version of samba i am running for my domain controler?

  - by Crash893

  Is there a command line way to see what version of Samba I am running?

  Read the article

• Underlying Concept Behind Keyboard Mappings

  - by ajay

  I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

  Read the article

• Wildcard subdomain setup ... want to change host IP throws off client A records... what to do...

  - by Joe

  Here is the current set up (in a nutshell). The site is set up with a wildcard subdomain, so *.website.com is accessible. Clients can then domain map their own domains with an A record to the server IP address and it will translate the to appropriate *.website.com with re directions and env variables in htaccess. Everything is working perfect... but now comes the problem. The site has grown larger than a single DQC Xeon server can handle at peak times. Looking at cloud options seems tempting, but clients are pointing their domains to a single IP address with the A record (our server). Now, this was probably bad planing from the start, but the question is, if this was to be done today, how would we set it up so that clients use a CNAME perhaps to point their domains to our server rather than an A record. And, if that is not possible for the root domain, how can we then use multiple IP addresses on our side to translate the incoming http request? Complex enough? Hope I've explained it well!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• What else can I do to secure my Linux server?

  - by eric01

  I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

  Read the article

• Exchange 2003 inbound routing issue

  - by user565712

  Just recently we started experiencing inbound routing issues. Email adddressed to [email protected] is intermittantly translated to [email protected]. This is happening for several users and, as stated, is intermittant. I don't know where to start looking for the solution. Is this an Exchange issue? A DNS issue? We have a single Exchange server inside our network with an FQDN of server.domain.local with a single SMTP Virtual Server. The Advanced properties of the Delivery tab of the Virt Server has an empty Masquerade Domain textbox and the value for the FDQN text-box is set to the domain itself, domain.com. The DNS record for domain.com is a CNAME entry referencing www.domain.com. Is this somehow related to the problem? I checked the headers of the inbound messages that generated NDRs as a result of being sent to [email protected] and nowhere in the header is www.domain.com mentioned. To make my life even more difficult, we use Postini as a third-party SPAM filtering service. Our MX records point to the Postini servers and Postini delivers the messages to our server. Perhaps it is Postini that is mucking things up? sigh I'm having trouble with this one and the intermittent aspect is making it that much more difficult for me. Any ideas?

  Read the article

• Disabled annotation tools in Skim

  - by Kit

  Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

  Read the article

< Previous Page | 461 462 463 464 465 466 467 468 469 470 471 472  | Next Page >