Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 465/1731 | < Previous Page | 461 462 463 464 465 466 467 468 469 470 471 472  | Next Page >

  • Tool to launch a script driven by modem activity

    - by Will M
    Can anyone suggest a software tool (preferably under Windows XP or later) that would launch an application or script in response to a phone call being received on a landline phone line connected to a data modem on the same PC? or, better, in response to a sequence of touch-tones being played over such a phone line. This would allow, for example, using the telephone to manipulate firewall settings so as to create another layer of security in connection with remote internet access to that computer. I seem to recall seeing tools to do this sort of thing in the days before broadband internet access, when there was more attention to various tips and tricks for the dial-up modem, but a few attempts at Google hasn't turned anything up.

    Read the article

  • Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

    - by casualuser
    I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

    Read the article

  • What else can I do to secure my Linux server?

    - by eric01
    I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

    Read the article

  • How to run nodejs on linux platform

    - by rotem
    How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

    Read the article

  • Is drupal going to improve these small features ?

    - by Patrick
    Is drupal going to improve the following features ? 1) multi-line description for CCK fields such as images (at the moment I can only write in a line but a text-area would be better 2) thumbnails upload for CCK Video fields (so I can upload a thumbnails for each video if I cannot install ffmpeg on the server) 3) merge CCK Images and Videos in a single group. So my customer can order them in the same list by dragging and dropping them, and in my front-end I have them ordered in the same list. This would be very useful for me. Do you know if I can get some of theme with some modules maybe ? thanks

    Read the article

  • Enabling openssl With PHP/nginx

    - by reefine
    I'm getting the following error when trying to connect to SMTP + SSL through PHP using nginx + PHP 5, Could not connect to smtp host 'ssl://smtp.gmail.com' (5) (Unable to find the socket transport "ssl" - did you forget to enable it when you configured PHP?) In phpinfo I see: OpenSSL support disabled (install ext/openssl) This leads me to believe I've installed OpenSSL incorrectly. I've read a bunch of places where I should uncomment the following line: extension = php_openssl.dll This line does not exist so I added it to the end of my php.ini to no avail. The php_openssl.dll file does not exist anywhere on my server.

    Read the article

  • PHP session files have permissions of 000 - They're unusable

    - by vanced
    I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

    Read the article

  • What are the typical methods used to scale up/out email storage servers?

    - by nareshov
    Hi, What I've tried: I have two email storage architectures. Old and new. Old: courier-imapds on several (18+) 1TB-storage servers. If one of them show signs of running out of disk space, we migrate a few email accounts to another server. the servers don't have replicas. no backups either. New: dovecot2 on a single huge server with 16TB (SATA) storage and a few SSDs we store fresh mails on the SSDs and run a doveadm purge to move mails older than a day to the SATA disks there is an identical server which has a max-15min-old rsync backup from the primary server higher-ups/management wanted to pack in as much storage as possible per server in order to minimise the cost of SSDs per server the rsync'ing is done because GlusterFS wasn't replicating well under that high small/random-IO. scaling out was expected to be done with provisioning another pair of such huge servers on facing disk-crunch issues like in the old architecture, manual moving of email accounts would be done. Concerns/doubts: I'm not convinced with the synchronously-replicated filesystem idea works well for heavy random/small-IO. GlusterFS isn't working for us yet, I'm not sure if there's another filesystem out there for this use case. The idea was to keep identical pairs and use DNS round-robin for email delivery and IMAP/POP3 access. And if one the servers went down for whatever reasons (planned/unplanned), we'd move the IP to the other server in the pair. In filesystems like Lustre, I get the advantage of a single namespace whereby I do not have to worry about manually migrating accounts around and updating MAILHOME paths and other metadata/data. Questions: What are the typical methods used to scale up/out with the traditional software (courier-imapd / dovecot)? Do traditional software that store on a locally mounted filesystem pose a roadblock to scale out with minimal "problems"? Does one have to re-write (parts of) these to work with an object-storage of some sort - such as OpenStack object storage?

    Read the article

  • Underlying Concept Behind Keyboard Mappings

    - by ajay
    I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

    Read the article

  • Disabled annotation tools in Skim

    - by Kit
    Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

    Read the article

  • Proccess of carrying out a BER Test

    - by data
    I am subscribed to an ISP supplying a 3meg ADSL line. Lately (for the last 4 weeks) speeds have dropped from the usual average downstream speed of ~250kbps to just 0.14Mbps (according to speedtest.net) and employees are complaining about lack of access to the server. I have been calling customer support and logging calls for the last 3 weeks, but they have been unable to determine the source of the problem other carrying out a few bitstream tests and checking the DHCP renewal times. I am going to call back and suggest carrying out a BER test. What type of equipment is needed to carry out this test? I have access to a wide range of Cisco networking equipment. Other: We dont need a leased line as there are less than ten employees.

    Read the article

  • Server 2008 SP1 VSS Writers Not Responding

    - by Jason
    I've got a Windows Server 08 box on SP1 that is having some problems. We've experienced backup problems and I've traced it down to VSS Writers not responding. From the command line, if I type vssadmin list providers, I get Provider name: 'Microsoft Software Shadow Copy provider 1.0' Provider type: System Provider Id: {b5946137-7b9f-4925-af80-51abd60b20d5} Version: 1.0.0.7 If I type vssadmin list writers, I get this vssadmin 1.1 - Volume Shadow Copy Service administrative command-line tool (C) Copyright 2001-2005 Microsoft Corp. Waiting for responses. These may be delayed if a shadow copy is being prepared. I could wait this out for hours and it won't move. I looked up how Server 2008 handles VSS writers, and you can't reregister them like you could in Server 2003 http://social.technet.microsoft.com/Forums/en/windowsserver2008r2general/thread/062cc52c-899b-45f3-8d0c-798b92363f41 Does anyone know how to fix something like this or where to turn next?

    Read the article

  • How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

    - by Piotr Piaseczny
    Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

    Read the article

  • Know any file compare utility for chunks of text?

    - by Belun
    Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

    Read the article

  • How to read iptables -L output?

    - by skrebbel
    I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

    Read the article

  • Pressing 'Enter' doesn't really work in Firefox

    - by inkedmn
    When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

    Read the article

  • How to route outbound traffic to specific domain "XYZ.org" via a specific NIC or public/static IP?

    - by user139943
    Within the next week or so, I'll be setting up an AT&T U-verse modem with 5 usable static public IP addresses. I plan to register a domain name to 1 of the 5 static IPs (remaining 4 unregistered), and run a website from a single server setup in my home LAN. I'll skip the long winded reason why, but I need to somehow route outbound traffic (originating from my server) destined for one public domain (i.e. http://www.sample.org) through one of the UNREGISTERED static IP addresses ONLY. Basically, I want this public domain to see connections coming from an IP address and not my domain name. If it makes it easier, this can apply to all outbound traffic from my server as long as it doesn't impact users browsing my website! Inbound connections should go through the domain name / registered public IP. Can I accomplish this with my single server with one or multiple NICs? Do I need multiple servers and set one up as a proxy? Please help as my background is in software and not networking, and I don't think I can accomplish this at a software level (e.g. Java). Thanks.

    Read the article

  • How to failover to local account on a cisco switch/router if radius server fails?

    - by 3d1l
    I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

    Read the article

  • PHPMyAdmin running very slow over internet but fine locally

    - by columbo
    I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

    Read the article

  • Wildcard subdomain setup ... want to change host IP throws off client A records... what to do...

    - by Joe
    Here is the current set up (in a nutshell). The site is set up with a wildcard subdomain, so *.website.com is accessible. Clients can then domain map their own domains with an A record to the server IP address and it will translate the to appropriate *.website.com with re directions and env variables in htaccess. Everything is working perfect... but now comes the problem. The site has grown larger than a single DQC Xeon server can handle at peak times. Looking at cloud options seems tempting, but clients are pointing their domains to a single IP address with the A record (our server). Now, this was probably bad planing from the start, but the question is, if this was to be done today, how would we set it up so that clients use a CNAME perhaps to point their domains to our server rather than an A record. And, if that is not possible for the root domain, how can we then use multiple IP addresses on our side to translate the incoming http request? Complex enough? Hope I've explained it well!

    Read the article

  • How can I inject clips [ads] in a playlist every x minutes (even if previous clip is not over)

    - by azera
    Sorry for the title, I find it quite hard to describe what I want to do in a single sentence We have a few TV here linked to our computer, which we use to display clips about what we do in our sport center, what you should do to stay in good form ect ... It's running non stop, actually though vlc + playlist. Those main clips are 1-2 hours long and we have about 20 of them looping randomly all day. We would like to inject ads for some of our sponsiored products every now and then during the playlist, like say one ad every 15 minute. Does any one know how we can do that, while keeping the main clip random order ? I thought about encoding the whole thing as a single movie with ads inserted, but then it's not random. So we can put the ads in the playlist itself right ? Except clips are several hours long and we want that more often than that. Cutting the main clips in several pieces seems to work but that kind of sucks as new clips are made every month. If any one has an idea, thanks a lot

    Read the article

  • How do I allow a (local) user to start/stop services with a scheduled task?

    - by Mulmoth
    Hi, on a Windows 2008 R2 server I have two small .cmd-scripts to start/stop a certain service. They look like this net start MyService and net stop MyService I want to execute these script via scheduled task, and I thought it would be best to create a local user for this job. The user is not member of the Administrators group. But the scripts fail with exit code 2. When I logon with this local user and try to execute these script in command line, I see a message like (maybe not exactly translated from german to english): Error code 5: Access denied It doesn't matter whether I start the command line as Administrator or not. How can this local user gain rights to do the job?

    Read the article

  • Google Apps routing to different servers, depending on domain

    - by Philip
    We are investigating Google Apps for Education for our group of schools. Currently, each school uses their own Exchange (2003) server. Each school has its own domain which I have added to Google Apps as additional domains. I would like to start transitioning certain staff and some new pupils over to Google Apps to start testing. In this interim phase, I need mail to be routed through Google Apps and then, if no appropriate mail box is found, route on to the individual schools depending on the recipient. I do know that it is possible to route mail that does not have an appropriate Google Apps mail account to a single server - under "Settings / E-mail Settings / General Settings / Routing / E-mail routing". This works well for a single organisation where all the extra mail is destined for one place. I do know that it is possible to set up Routes, under "Settings / E-mail Settings / Hosts" and then use rules, found under "Settigns / E-mail Settings / General Settings / Routing / Receiving Routing". I can then filter based on e-mail domain and forward on to the necessary server. My problem with this, as I understand it, is that it ignores the users that have Google Apps accounts set up and sends all mail to the Exchange server. Are there any solutions for this predicament? Many thanks!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Custom prompt doesn't work on Mac Terminal

    - by mareks
    I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

    Read the article

< Previous Page | 461 462 463 464 465 466 467 468 469 470 471 472  | Next Page >