Search Results

Search found 36132 results on 1446 pages for 'line height'.

Page 469/1446 | < Previous Page | 465 466 467 468 469 470 471 472 473 474 475 476  | Next Page >

• How to reformat reStructuredText?

  - by wal-o-mat

  I'm writing reST in vim, which handles line breaks for me (after 80 chars). However, since I frequently go back and edit the text before, lines get ugly again. For example, in tables, it's sometimes annoying to re-format a complete table just because you need a line break in some place. So I wish I had a program that reads my ugly-but-correct reStructuredText and outputs it nicely formatted and wrapped. I found that pandoc in.rst -w rst mostly works, but it has some drawbacks. For example :author: John Doe becomes author John Doe and title formatting is changed as well. Sadly, there seems to be no rst2rst or something similar. Does anyone have some advice?

  Read the article

• Automating the installation using SSH

  - by RAY

  I am running a bash script from a remote host to run a binary file which installs 64 bit JDK 6 update 29 on multiple VMs across the Environment. It is installing the file but, at the last line i have to hit a enter to complete the installation. I want to fully automate the script where i do not have to hit the enter at the last line. This is what i am using ssh ${V_TIERS}@${V_TIERS} 'cd JDK; sh jdk-6u29-solaris-sparcv9.sh' It updates as desired, but during install i have to hit enter to continue and complete the installation. Can anybody please help to fully automate the update process.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• PHPMyAdmin running very slow over internet but fine locally

  - by columbo

  I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

  Read the article

• Underlying Concept Behind Keyboard Mappings

  - by ajay

  I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

  Read the article

• What else can I do to secure my Linux server?

  - by eric01

  I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

  Read the article

• How to stretch the image from one screen to two screens

  - by wxiiir

  I want to be able to stretch the image from one monitor to a second monitor even if i have to use some software to do it. For example i want the top half of the image that is now shown on my first monitor to occupy the whole second monitor and i want the bottom half to occupy the whole first monitor, or the other way around i don't really care as long as it works. I would be cool to know how to do the same stuff but to the left half and right half. I know that image pixels would have twice the lenght or height this way but i don't really care about it as long as it works so basically i want the stuff to show on both monitors but with the same pixels as before. I have a hd4870 and windows7 and hd4000 family doesnt support having two monitors behaving like a large one, only hd5000 upwards, this would solve my problems without any of the drawbacks but it just can't be done (or maybe it can via software but i'm just too tired of searching). A solution to make almost any graphic card have two monitors behaving like a large one is matrox dualhead2go but that's just as expensive as a good hd5000 card so it's not worth it. thanks in advance EDIT I guess that nobody so far was able to fully comprehend my problem that was very explicitly written but i will elaborate some more. My hd4870 can have 2 monitors working with it but some stuff like games won't run on both monitors, which sucks. There are some ways to circumvent this problem and two of them are perfect or almost perfect but expensive and the third would be a software solution that would make it possible. The first one is to have and hd5000 family video card which will work just fine with both monitors. The second is to have a matrox dualhead2go that will make my hd4870 detect my two monitors as a large monitor. The third is to have a software that makes my two displays be detected as a large display and then captures the output of the video card, splits the images and renders them as 2d images to both monitors OR a simpler one but that would make outputted pixels double the width or height would be to capture the output of the graphics card to one screen, split it in two and enlarge it to fit both monitors and then output it to the monitors. p.s. By capturing the output of the video card i mean just make the video card process the stuff in a certain way. Making the video card detect two monitors as a large one via software may be a bit impossible or impracticable but stretching the output as a 2d image from one to both monitors for some coders should be a walk in the park so it would be likely that such program would exist or that some widespread softwares for dual monitor would have such function in them.

  Read the article

• Application for Auto-Scaling backgrounds in Windows XP

  - by jweede

  One thing that's always annoyed me about windows XP is how there's no "scale" option for the desktop background. It either has to be stretched or centered. It's a pretty simple algorithm to scale the image so that one of the dimensions (usually height) fits on the screen. Does anyone know of a good program that does this, or is there a way to enable it?

  Read the article

• Disabled annotation tools in Skim

  - by Kit

  Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

  Read the article

• PHP session files have permissions of 000 - They're ununsable

  - by vanced

  I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

  Read the article

• Printing data in Excel ver 14.0 in a maxed cell

  - by Zppy

  I have set the cell to the maximum size (column width of 255 and row height of 409.5). In order to view all of the data in the cell, I have to use up/down arrows. I don't need to necessarily view all of the data in the cell at one time, however I do need it to print, and it's only printing what's viewable (not what you can scroll through).....any suggestions on how to get the entire cell to print? Thanks!

  Read the article

• Custom prompt doesn't work on Mac Terminal

  - by mareks

  I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

  Read the article

• Images as links bad for SEO?

  - by Karl

  I am just about finished with my website and my as I was reading over Google's SEO information, they mentioned images as links without text is bad. What if it is simply a link to enlarge the picture? such as the following: <a href="images/image1.jpg"><img src="images/image1.jpg" height="200" width="100"></a> Any help on this would be great! Thanks, -K

  Read the article

• How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

  - by ysim

  I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

  Read the article

• What's the advantage of using a bash script for cron jobs?

  - by AlxVallejo

  From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

  Read the article

• Transfer disk image to larger/smaller disk

  - by forthrin

  I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

  Read the article

• How to convert MS word 2007 file into JPG file?

  - by metal gear solid

  How to convert MS word 2007 file into JPG file? I need portable off-line tool/method for Windows XP.

  Read the article

• How to read iptables -L output?

  - by skrebbel

  I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

  Read the article

• Why does Notepad "randomly" make pasted text a smaller font size?

  - by Coldblackice

  Sometimes when I copy and paste text into Notepad, it will paste the text in the default Notepad font and size, however, the latter half of the pasted line will be multiple font sizes smaller. I'm stumped as to why this is happening. I wondered if it was perhaps some type of hidden formatting that was being copied into Notepad, but I believe that Notepad strips the formatting. I've subsequently taken the same text and tried copy and pasting it into URL bars and CMD prompts to strip any potential formatting (even though it was plaintext copied from web), and then re-pasted into Notepad, but it still leaves this phenomenon. Additionally, when resizing the Notepad window, it will change what portion of the line is default sized and downsized, as seen in the screenshot posted below. The three windows are actually the same Notepad window, each with a different resizing and the resulting text resizing.

  Read the article

• How to install php cli with pnctl alongside Zend Server

  - by fazy

  I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

  Read the article

• How to Transpose in Excel a column with more than 50,000 rows?

  - by ezlee69

  I am trying to Transpose all of column "B", but want to skip a line then grab the next 4 and paste them in the same column. How can I make this loop all of column "B" skipping every 5th line and change the range to the next open cell or "Range" automatically without manually typing each one individually? Range("B12:B16").Select Selection.Copy Sheets("Sheet2").Select Range("A2").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B18:B22").Select Selection.Copy Sheets("Sheet2").Select Range("A3").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B24:B28").Select Selection.Copy Sheets("Sheet2").Select Range("A4").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True

  Read the article

• Mass modify all php files on my server

  - by anslume

  I would like to delete a php code on all my php files on my debian server. indeed I would like to get rid of a line: eval(base64_decode("DQplcnJvcl9yZXBvcnR")); It's present in many of my phpfiles. That's why I would like to find a script which is going to look it up in all my php files and replace itwith nothing? Do you have any idea how i could do that ? I know how to do it on windows with some software (notepad++ is very useful) but no idea how can I do that in a command line through ssh Thanks for your answer, Ans

  Read the article

• Copying List of Files Through Powershell

  - by Driftpeasant

  So I'm trying to copy 44k files from one server to another. My Powershell script is: Import-CSV f:\script\Listoffiles.csv | foreach $line {Move-item $_.Source $_.Destination} With the Format for the CSV: Source, Destination E:\folder1\folder2\file with space.txt, \\1.2.3.4\folder1\folder2\file with space.txt I keep getting: A positional parameter cannot be found that accepts argument '\\1.2.3.4\folder1\folder2\file'. At line:1 char:10 + move-item <<<< E:\folder1\folder2\file with space.txt \\1.2.3.4\folder1\folder2\file with space.txt + CategoryInfo : InvalidArgument: (:) [Move-Item], ParameterBindingException + FullyQualifiedErrorId : PositionalParameterNotFound,Microsoft.PowerShell.Commands.MoveItemCommand So I've tried putting "s around both paths, and also 's, and I still get either Move-Item: Could not find a part of the path errors. Can anyone help me?

  Read the article

• Help with user login on Centos 5.6

  - by Owen

  I added a user for the sole purpose of using SU for root. I did not allow the creation of a home directory when creating the user. So now when I login as this user I get the following: Could not chdir to home directory /home/MYUSERNAME: No such file or directory Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Is this an error, and if so how do I fix it so it is not looking to "resolve" the homedir?

  Read the article

• Setting a mapped drive in Virtual hosts causes apache to not start

  - by darksoulsong

  I´m trying to set a virtual host on my windows 7 machine. The folder I want to point to is located on a centOS machine and the folder path is Z:\Websites\Online\MyClient\Site. But something strange happens when I set the document root like this: DocumentRoot "Z:\Websites\Online\MyClient\Site" Apache do not restarts after that. When I take a look at the log, there is an error pointing to that line, where I added the path to the folder: Syntax error on line 48 of C:/Program Files/Zend/Apache2/conf/extra/httpd-vhosts.conf: DocumentRoot must be a directory. There must be a way to make it work like this, by setting an Apache Installation on a machine and pointing it to a folder located on another computer, right? My hosts file is set like this: 172.17.10.1\Data\Websites\Online\MyClient\Site MyClient.local ANY HELP would be VERY appreciated.

  Read the article

< Previous Page | 465 466 467 468 469 470 471 472 473 474 475 476  | Next Page >