Search Results

Search found 18803 results on 753 pages for 'link'.

Page 470/753 | < Previous Page | 466 467 468 469 470 471 472 473 474 475 476 477  | Next Page >

  • OpenGL : sluggish performance in extracting texture from GPU

    - by Cyan
    I'm currently working on an algorithm which creates a texture within a render buffer. The operations are pretty complex, but for the GPU this is a simple task, done very quickly. The problem is that, after creating the texture, i would like to save it. This requires to extract it from GPU memory. For this operation, i'm using glGetTexImage(). It works, but the performance is sluggish. No, i mean even slower than that. For example, an 8MB texture (uncompressed) requires 3 seconds (yes, seconds) to be extracted. That's mind puzzling. I'm almost wondering if my graphic card is connected by a serial link... Well, anyway, i've looked around, and found some people complaining about the same, but no working solution so far. The most promising advise was to "extract data in the native format of the GPU". Which i've tried and tried, but failed so far. Edit : by moving the call to glGetTexImage() in a different place, the speed has been a bit improved for the most dramatic samples : looking again at the 8MB texture, it knows requires 500ms, instead of 3sec. It's better, but still much too slow. Smaller texture sizes were not affected by the change (typical timing remained into the 60-80ms range). Using glFinish() didn't help either. Note that, if i call glFinish() (without glGetTexImage), i'm getting a fixed 16ms result, whatever the texture size or complexity. It really looks like the timing for a frame at 60fps. The timing is measured for the full rendering + saving sequence. The call to glGetTexImage() alone does not really matter. That being said, it is this call which changes the performance. And yes, of course, as stated at the beginning, the texture is "created into the GPU", hence the need to save it.

    Read the article

  • Windows 8 Program Sharing?

    - by Martin W. Seitz
    How do I, as the administrator, share the Skype program with a user on the same PC? I tried to download Skype to the user from the windows store that said it was blocked and I must contact the administrator. The Skype icon appears on the user desktop but with an X in the corner with no way to allow it to work as the administrator. In the administrator desktop the Skype icon appears without the x and it does work. I have tried to research this issue and so far all I have been able to find and do is the enable $admin share at this link http://www.intelliadmin.com/index.php/2012/10/windows-8-enable-the-admin-share/ Now that I have done this how do I use it to share the Skype program? Thanks in advance. Marty Seitz

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • How to make the internal subwoofer work on an Asus G73JW?

    - by CodyLoco
    I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

    Read the article

  • When creating a GUI wizard, should all pages/tabs be of the same size? [closed]

    - by Job
    I understand that some libraries would force me to, but my question is general. If I have a set of buttons at the bottom: Back, Next, Cancel?, (other?), then should their location ever change? If the answer is no, then what do I do about pages with little content? Do I stretch things? Place them in the lone upper left corner? According to Steve Krug, it does not make sense to add anything to GUI that does not need to be there. I understand that there are different approaches to wizards - some have tabs, others do not. Some tabs are lined horizontally at the top; others - vertically on the left. Some do not show pages/tabs, and are simply sequences of dialogs. This is probably a must when the wizard is "non-linear", e.g. some earlier choices can result in branching. Either way the problem is the same - sacrifice on the consistency of the "big picture" (outline of the page/tab + location of buttons), or the consistency of details (some tabs might be somewhat packed; others having very little content). A third choice, I suppose is putting extra effort in the content in order to make sure that organizing the content such that it is more or less evenly distributed from page to page. However, this can be difficult to do (say, when the very first tab contains only a choice of three things, and then branches off from there; there are probably other examples), and hard to maintain this balance if any of the content changes later. Can you recommend a good approach? A link to a relevant good blog post or a chapter of a book is also welcome. Let me know if you have questions.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

    - by cdowen
    I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

    Read the article

  • QNAP TS-419p as a VPN Gateway?

    - by heisenberg
    Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

    Read the article

  • Why are my Google searches redirected?

    - by Please Help
    This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

    Read the article

  • no driver found error showing while installing windows 7

    - by Shyam s
    I accidentally deleted all my windows 7 drive partitions while installing Ubuntu in my laptop.On booting into ubuntu it is showing 450gb NTFs file partition.30 GB drive linux file system partition. so when i was reinstalling my Os with windows 7.i am not able to view my drives.it is showing drivers not found.I have searched the google followed the steps mentioned in this link. http://social.technet.microsoft.com/Forums/en/w7itproinstall/thread/d460efd3-eac4-4ef8-b95f-b8208b24f44f my laptop is i3 machine and i changed sata to ACHI.still it is showing same error. How can reinstall windows 7. thanks in advance.

    Read the article

  • Firefox 11 Bookmarks Toolbar too Tall

    - by tba
    After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

    Read the article

  • Set Up Remote Desktop at Home

    - by Rev
    I'm sure this has been asked before, but I'm unable to find a clear set of instructions. I'm currently using LogMeIn Hamachi to enable Windows 8's Remote Desktop feature on my home computer (running Win8 Pro x64). Unfortunatley, I can't use this method to access my home computer from my Surface Tablet, as I can't install in the Hamachi client. So how can I set up Remote Desktop without using LogMeIn Hamachi? A link to a noob-friendly tutorial would be greatly appreciated. I haven't been able to find anything that I understand (and I am pretty technical, router stuff just stumps me for some reason). EDIT: And I don't want to use a third party service like TeamViewer, in my experience those tools are laggy and quite horrible. The Remote Desktop feature has been excellent.

    Read the article

  • Why doesn't wireless work on Wubi 12.04 with a Broadcom BCM4312 card?

    - by Kristin
    I have recently set up ubuntu 12.04 on my laptop using the Wubi installer. I am having a very difficult time setting up a wireless internet connection. I am currently set up with an ethernet connection which I have used to download all new updates and to activate the Broadcom STA wireless driver. I have tried several things in the terminal based on other people's posts: ~$ rfkill list 0: brcmwl-0: Wireless LAN Soft blocked: no Hard blocked: yes ~$ rfkill unblock all It doesn't change anything. I also tried rebooting and connecting to the internet on my Windows Vista OS, and it worked, so I know that the connection should not be hard blocked. I have also tried installing b43 firmware (lp/phy version) that is supposed to work with my chip (BCM4312). It seems to have no effect. Then I tried: ~$ iwconfig lo no wireless extensions. eth1 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. This is my first time trying to work with ubuntu, so I would appreciate any help. Thanks. Also sorry this is poorly formatted. I'm having troubles with that too.

    Read the article

  • Software for Company internal Website [closed]

    - by LordT
    hope this is the right stackexchange site to ask this: We've a group of webpages/services at work (SE Startup), ranging from SVN, trac, continous integration to link collections to a DMS. Nearly everything has an RSS Feed to get the info I need, with the exception of SVN. I'm looking for some kind of software that can integrate these well on a kind of start-page. The most recent changes, upcoming events etc should be clearly visible, as well as an option to search (the search will be provided from a different tool). A news area should be included as well. Currently, I'm pondering doing this with either wordpress or TWiki, although wordpress seems to be the simpler solution in terms of getting something good looking quickly. Authentication should be handled by HTTP-Basic Auth, which we already have in place and working well. I normally would consider Sharepoint a viable option for this, but we're exclusively mac and linux, I won't put up a windows server just for this.

    Read the article

  • Update 3 for "NetBeans Platform for Beginners"

    - by Geertjan
    The latest monthly update of NetBeans Platform for Beginners was released during the last few days. Without any question at all, this book is awesome. I love how it is a 'living book' and that on a monthly basis new updates are made available. In this particular update, as before, reader comments and questions have led to changes and enhancements in the book. In addition, there's now a tighter integration between the long list of samples on GitHub and the book, since wherever a sample relates to a text in the book, the book has a handy icon, so that you know when to hop over to GitHub to get a related sample. Do you have comments or questions about the book? That's what the feedback link is for: https://leanpub.com/nbp4beginners/feedback And there's also a free sample, just in case you'd like to get a feel for the book prior to buying it: http://samples.leanpub.com/nbp4beginners-sample.pdf If you're from a company where you're all sharing a single copy of the book, it would be great if you'd go back and support this great project (and hopefully encourage future books being written) by buying additional copies, ideally one for each developer. Let's show the authors that writing books on the NetBeans Platform is a really profitable thing to do (and I'm hoping they'll write one on Maven and the NetBeans Platform, as well)!

    Read the article

  • What is the world wide web? [closed]

    - by think123
    I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

    Read the article

  • My Router is fast when i reset it but slows down seconds later

    - by hglocke
    I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

    Read the article

  • Excel Single column into rows, VBA script insight

    - by Sanityvoid
    Okay, so much similiar to the below link but mine is a bit different. Paginate Rows into Columns in Excel I have a lot of data in column A, I want to take every 14 to 15 rows and make them a new row with multiple columns. I'm trying to get it into a format where SQL can intake the data. I figured the best way was to get them into rows then make a CSV with the data. So it would like like below: (wow, the format totally didn't stick when posting) column A column B C D etc 1 1 2 3 x 2 16 17 a b 3 x y z 15 16 17 a b c I can clarify if needed, but I'm stumped on how to get the data out of the single column with so many rows in the column. Thanks for the help!!!

    Read the article

  • Garage Sale Code &ndash; Everything must go!

    - by mbcrump
    Garage Sale Code     The term “Garage Sale Code” came from a post by Scott Hanselman. He defines Garage Sale Code as: Complete – It’s a whole library or application. Concise – It does one discrete thing. Clear – It’ll work when you get it. Cheap – It’s free or < 25 cents. (Quite Possibly) Crap – As with a Garage Sale, you’ll never know until you get it home if it’s useless. With the code I’ve posted here, you’ll get all 5 of those things (with an emphasis on crap). All of the projects listed below are available on CodePlex with full source code and executables (for those that just want to run it).  I plan on keeping this page updated when I complete projects that benefit the community.  You can always find this page again by swinging by http://garagesale.michaelcrump.net or you can keep on driving and find another sale. Name Description Language/Technology Used WPF Alphabet WPF Alphabet is a application that I created to help my child learn the alphabet. It displays each letter and pronounces it using speech synthesis. It was developed using WPF and c# in about 3 hours (so its kinda rough). C#, WPF Windows 7 Playlist Generator This program allows you to quickly create wvx video playlist for Windows Media Center. This functionality is not included in WMC and is useful if you want to play video files back to back without selecting the next file. It is also useful to queue up video files to keep children occupied! C#, WinForms Windows 7 Automatic Playlist Creator This application is designed to create W7MC playlist automatically whenever you want. You can select if you want the playlist sorted Alphabetical, by Creation Date or Random. C#, WinForms, Console Generator Twitter Message for Live Writer This is a plug-in for Windows Live Writer that generates a twitter message with your blog post name and a TinyUrl link to the blog post. It will do all of this automatically after you publish your post. C#, LiveWriter API

    Read the article

  • Protecting a webpage with an authentication form

    - by Luke
    I have created an employee webpage with a lot of company info, links, etc., but I want to protect the page because it contains some confidential company information. I am running IIS7.5 on Windows Server 2008 R2, and I already have the site setup as a normal, non-protected site. I want all active directory users to have access to the site. This is not an intranet site, it is exposed to the internet. I tried setting it up using Windows Authentication, but I had problems with multiple login prompts, etc. I just want a simple form for users to enter their credentials and have access to the site, and I need it to query the AD for login. I've searched the web for a guide on this, but I can't seem to find one that fits my situation. This is not a Web App. It is just a simple html site. Does anyone have any suggestions or a link to a guide on this? Thanks so much! -LB

    Read the article

  • Chrome tabs showing wrong page

    - by Jeff
    I have a problem with Google Chrome where occasionally when switching to a newly created tab (usually one made from opening a link into a new tab), the wrong page shows. The correct page is functional, links and other functions are present, but I cannot see them because Chrome seems to be reading the page I want but showing another. Sometimes it is identical to the tab I just left, sometimes it shows the content of a previously closed tab. The problem sorts out when I switch to another tab and back, and then the correct page shows. This happens fairly often and is rather annoying. Some of my friends have also experienced this, and have stopped using Chrome because of it. If anybody else has seen this problem and happens to know a fix, I'd really appreciate it.

    Read the article

  • Enabling Office SharePoint Server Publishing Infrastructure Breaks Navigation

    - by swagers
    I'm migrating from WSS 3.0 to MOSS 2007, below are the steps I took to migrate. Backed up the content database of our WSS 3.0 site. Restored the database on our MOSS 2007 database server Create a new Web Application on our MOSS 2007 server and pointed the database to the newly restored database. Everything works correctly on the new server. I enabled Office SharePoint Server Publishing Infrastructure and navigations stops working correctly. Where it use to say Home it now says /. When I clicked on a link to any sub sites the top navigations reduces down to one button that says Error. Also any sub site navigation on the side bar reads Error. When I disable Office SharePoint Server Publishing Infrastructure everything goes back to the way it was.

    Read the article

  • News Applications internal working [on hold]

    - by Vijay
    How does news applications work other than RSS Feed based applications? I know some of them take the RSS content from the source site.But sometimes I see, those applications show - Title Description Date Image video etc. Even though when I see the original site's rss, image, video is not there in rss. So how does one get that to show in there applications? Some applications even shows feeds from magazine sites, newspaper sites. How do these applications work? I am creating an application which will link to different news sites feeds categorized (like top news, technology, games, articles etc.) On the front page it will show the website names, then on selection of any news site it will get the feed from that website and show it to user. So I would like to know All the fetching of data from should be done on user selection or data should be prefetched? Detailed information I want to fetch from the original like provided in the rss data. How should I go about it?

    Read the article

  • 1 ASPX Page, Multiple Master Pages

    - by csmith18119
    So recently I had an ASPX page that could be visited by two different user types.  User type A would use Master Page 1 and user type B would use Master Page 2.  So I put together a proof of concept to see if it was possible to change the MasterPage in code.  I found a great article on the Microsoft ASP.net website. Specifying the Master Page Programmatically (C#) by Scott Mitchell So I created a MasterPage call Alternate.Master to act as a generic place holder.  I also created a Master1.Master and a Master2.Master.  The ASPX page, Default.aspx will use this MasterPage.  It will also use the Page_PreInit event to programmatically set the MasterPage.  1: protected void Page_PreInit(object sender, EventArgs e) { 2: var useMasterPage = Request.QueryString["use"]; 3: if (useMasterPage == "1") 4: MasterPageFile = "~/Master1.Master"; 5: else if (useMasterPage == "2") 6: MasterPageFile = "~/Master2.Master"; 7: }   In my Default.aspx page I have the following links in the markup: 1: <p> 2: <asp:HyperLink runat="server" ID="cmdMaster1" NavigateUrl="~/Default.aspx?use=1" Text="Use Master Page 1" /> 3: </p> 4: <p> 5: <asp:HyperLink runat="server" ID="cmdMaster2" NavigateUrl="~/Default.aspx?use=2" Text="Use Master Page 2" /> 6: </p> So the basic idea is when a user clicks the HyperLink to use Master Page 1, the default.aspx.cs code behind will set the property MasterPageFile to use Master1.Master.  The same goes with the link to use Master Page 2.  It worked like a charm!  To see the actual code, feel free to download a copy here: Project Name: Skyhook.MultipleMasterPagesWeb http://skyhookprojectviewer.codeplex.com

    Read the article

  • What is your approach to draw a representation of your network ?

    - by Kartoch
    Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

    Read the article

< Previous Page | 466 467 468 469 470 471 472 473 474 475 476 477  | Next Page >