Search Results

Search found 34094 results on 1364 pages for 'open authentication'.

Page 475/1364 | < Previous Page | 471 472 473 474 475 476 477 478 479 480 481 482  | Next Page >

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • subversion problem on mac os x

    - by Mohsin Jimmy
    This exists in my httpd.conf file: <Location /svn> DAV svn SVNParentPath /Users/iirp/Sites/svn Allow from all #AuthType Basic #AuthName "Subversion repository" #AuthUserFile /Users/iirp/Sites/svn-auth-file #Require valid-user </Location> This is working file When I change this to: <Location /svn> DAV svn SVNParentPath /Users/iirp/Sites/svn #Allow from all AuthType Basic AuthName "Subversion repository" AuthUserFile /Users/iirp/Sites/svn-auth-file Require valid-user </Location> and when I access my repository through URL, it gives me the authentication screen but after that screen my svn repository is not showing up correctly. to see message that it gives to me is: Internal Server Error The server encountered an internal error or misconfiguration and was unable to complete your request. Please contact the server administrator, [email protected] and inform them of the time the error occurred, and anything you might have done that may have caused the error. More information about this error may be available in the server error log.

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • PostgreSQL under Mac OSX Lion. Wrong userpass?

    - by Matt
    I'm completely helpless, maybe you guys can help me out. I installed PostgreSQL under my new MacOSX Lion. When I try to connect to my localhost with pgAdminIII.app it says: Error connecting to the database: FATAL password authentication failed for user postgres I just have no idea what to do? Non of my passwords work. Neither my adminpass nor "postgres" nor anyhting else. I tried to install it again via the console where I found this helpful link: http://www.peerassembly.com/2011/08/...resql-on-lion/ However the problem is, that when I try to run createuser -a -d _postgres the same password problem appears again. I just can't seem to find a solution to this. Always wrong password. Btw. I have a new User called "PostgreSQL" on my machine after I installed postgres. Any ideas? I'm so stuck and I really need to make this work.

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • IIS cannot access itself

    - by dave
    We are on a corporate network that uses ISA and I am having issues trying to not have requests go through ISA. I have IIS7 on my local Windows 7 machine that has websites and a service layer. The websites access the service layer using a xxxx.servicelayer.local address that is set up in my HOSTS file to point to 127.0.0.1. I have Windows Firewall client which I have disabled. I have tried both adding this address into IE so that it does not go through ISA and also disabled this section altogether. When the website (which is actually IIS making the request to itself) tries to access the service layer I receive an ISA error that proxy authentication has failed. Considering that everything I can see to configure is set to not go through the proxy, ISA, I cannot see how this is actually going through the proxy and giving this error. Is there something within Windows 7 that forces the proxy setting, some sort of caching or similar?

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • RODC password replication and A/D sites and subnets

    - by Gregory Thomson
    I work at a school district with about 30 school sites. Windows 2008 A/D setup - all central at the district office. In A/D, all is under one site, and no subnets defined. One A/D forest and only one domain under that. We're now looking to start putting RODCs at the schools to put the authentication and DNS out there closer to them. I haven't worked with A/D sites and subnets, and only a little with RODC password replication. But just got an invite to a meeting to talk about this tomorrow... If we start breaking down the A/D pieces into sites/subnets, can we also use that as a way to help apply an RODC password replication policy in a way that matches so that only each school sites' users passwords are replicated/cached on their RODC?

    Read the article

  • AirPlay over unicast DNS-SD. Anyone got it working?

    - by Moduspwnens
    We set up AirPrint using unicast DNS-SD on our campus about a year ago and it turned out to be a big success, so we're looking at trying to get AirPlay working so our faculty and students can wirelessly show content on our classroom projectors. There are still a couple of other things preventing an ideal implementation (username and password authentication, for starters), but I've been trying to set up a working demo nonetheless. Getting AirPrint working was basically just a matter of advertising the same records over a DNS-SD domain instead of the multicast (.local) one, but doing the same thing for AirPlay doesn't seem to cut it. The devices don't recognize the DNS-SD AirPlay servers as available. I've uploaded a screenshot of my DNS-SD configuration with the original (from AirServer, which works normally for multicast) here. I realize this is still a fairly new feature and documentation is lacking, but has anyone been able to get AirPlay working via DNS-SD? If it simply only works over multicast, I can accept that, but its potential is so appealing for us that I thought it'd be worth asking if anyone else has figured it out.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Migrating LDAP user and password to SAMBA4 AD

    - by Rudy Dajoh
    As title suggests. We are migrating from OpenLDAP as user authentication to Samba 4 AD Domain. But I can't find any information on how to transfer passwords and users to Samba 4 AD. How to migrate all LDAP user base at ou=People,dc=company,dc=com to samba 4 AD domain? I don't need to assistance transferring everything, I only need to transfer user accounts. I've finished migrating them all but user/passwords. Can it be done? If so, how?

    Read the article

  • Creating and writing file from a FileOutputStream in Java

    - by Althane
    Okay, so I'm working on a project where I use a Java program to initiate a socket connection between two classes (a FileSender and FileReceiver). My basic idea was that the FileSender would look like this: try { writer = new DataOutputStream(connect.getOutputStream()); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } //While we have bytes to send while(filein.available() >0){ //We write them out to our buffer writer.write(filein.read(outBuffer)); writer.flush(); } //Then close our filein filein.close(); //And then our socket; connect.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); The constructor contains code that checks to see if the file exists, and that the socket is connected, and so on. Inside my FileReader is this though: input = recvSocket.accept(); BufferedReader br = new BufferedReader(new InputStreamReader(input.getInputStream())); FileOutputStream fOut= new FileOutputStream(filename); String line = br.readLine(); while(line != null){ fOut.write(line.getBytes()); fOut.flush(); line = br.readLine(); } System.out.println("Before RECV close statements"); fOut.close(); input.close(); recvSocket.close(); System.out.println("After RECV clsoe statements"); All inside a try-catch block. So, what I'm trying to do is have the FileSender reading in the file, converting to bytes, sending and flushing it out. FileReceiver, then reads in the bytes, writes to the fileOut, flushes, and continues waiting for more. I make sure to close all the things that I open, so... here comes the weird part. When I try and open the created text file in Eclipse, it tells me "An SWT error has occured ... recommended to exit the workbench... see .log for more details.". Another window pops up saying "Unhandled event loop exception, (no more handles)". However, if I try to open the sent text file in notepad2, I get ThisIsASentTextfile Which is good (well, minus the fact that there should be line breaks, but I'm working on that...). Does anyone know why this is happening? And while we're checking, how to add the line breaks? (And is this a particularly bad way to transfer files over java without getting some other libraries?)

    Read the article

  • Configuring Redhat / CentOS 5 SSH to authenticate to IPA server with public keys

    - by Kyle Flavin
    I'm trying to configure some Red Hat/CentOS servers to use an ipa-server on CentOS 6 for SSH authentication with public keys. I'm storing the public keys on the IPA server, which works great on Centos6 using "AuthorizedKeysCommand /usr/bin/sss_ssh_authorizedkeys" in /etc/ssh/sshd_config. However, on RH 5.10, neither the "AuthorizedKeysCommand" directive or the "/usr/bin/sss_ssh_authorizedkeys" command exist to pull the public key from the directory. Is there a different way to make this work? Googling this mostly returns instructions for setting it up on 6.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • disable RADIUS for Cisco 2500 wireless controller

    - by Tim Vaughan
    I have a Cisco 2500 wireless controller and four lightweight access points. I want to use the controller to manage a wireless network secured by WPA only, without using RADIUS or anything else. We'll handle the authentication using a captive portal behind the access points. However, it seems like the controller's default security policy requires a RADIUS server and I can't find out how to switch the policy off. The documentation assumes I'm in an environment which needs heavy-duty security and the use case is actually a small charity/business with much less stringent security requirements. How do I disable the complicated security policy and instead run a simple one that just uses WPA?

    Read the article

  • Security Audit Failures in Event Viewer Windows Server 2008R2

    - by Jacob
    When I am looking at the security tab of my event viewer on a Windows Server 2008 R2, I am showing a ton of Audit Failures with Event ID 4776. The computer attempted to validate the credentials for an account. Authentication Package: MICROSOFT_AUTHENTICATION_PACKAGE_V1_0 Logon Account: randy Source Workstation: HPDB1 Error Code: 0xc0000064 I verified the account "randy" exist in my Active Directory. From my understanding, there has not been any recent password changes. Is there any way to get detailed information on this error? I am wondering what program is requesting this information. Also, is there any way to clear this error up? I was thinking about resetting the password and changing it back to the original.

    Read the article

  • Solaris 10 opencsw git package issue with bitbucket git hosting

    - by zephyrus00jp
    Has anyone tried using `git' from opencsw package in order to work with bitbucket source hosting service (under solaris10)? I tried to use git as the bitbucket documentation explains, and - under Debian GNU/Linux, it worked flawlessly as described, but - under Solaris 10, I got Authentication Failed message. I even tried to run truss to see anything is suspicious but could not find any smoking gun under solaris why it failed. ldd git-binary didnd't show anything suspicious either (except for the libcrypt library which could be a suspicious to think about export restrictions. Have they shipped incompatible version? BUT since the password is typed into https: connection, I suspect it is only a matter of web-level cryptography and should be universal these days.) I am now tempted to compile git suite under solaris 10, but I did find people who seem to be using git with bitbucket under solaris 10 and am wondering what could be wrong.

    Read the article

  • Backup Exec backup-to-disk folder creation - Access denied

    - by ewwhite
    I'm having a difficult time creating a backup-to-disk folder in Symantec Backup Exec 12.5 and Backup Exec 2010. The backend storage is a Nexenta/ZFS-based NAS filer sharing the volume via CIFS. I've also seen the issue on other *nix-based NAS devices. I've attempted mapping the drive, providing the full paths to the folder, etc. I can browse to the share just fine from within Windows, but Backup Exec fails to create the B2D folder with different variants of a Unable to create new backup folder. Access denied error. I've attempted creating service accounts in Backup Exec to handle the authentication, but nothing seems to work. What's the key to making this work?

    Read the article

  • Accessing Windows 7 Printer from Ubuntu Linux via LPR/LPD or Samba

    - by nitbuntu
    Hi, I'm having difficulty printing from my Linux (Ubuntu 10.04) based PC to a printer connected to a Windows 7 machine. I was trying to connect using Samba (version 3.5.6) but this always brings up an authentication screen which never accepts any password I use. So I read somewhere that an alternative is to access the Windows printer via LPR/LPD. I added an LPR/LPD printer in Windows 7, but even within Windows 7, I am not able to print as the print que monitor shows as 'printer busy'. The printer in question is an Epson Stylus DX7400 and works fine when using the standard USB ports....but doesn't when I use with the LPR/LPD ports. I even opened up the TCP/IP port 515 in my McAfee firewall without any success. Any help with this would be highly appreciated. Additionally, does anyone have any idea how I can get Samba working for me?

    Read the article

  • How to authenticate users in nested groups in Apache LDAP?

    - by mark
    I've working LDAP authentication with the following setup AuthName "whatever" AuthType Basic AuthBasicProvider ldap AuthLDAPUrl "ldap://server/OU=SBSUsers,OU=Users,OU=MyBusiness,DC=company,DC=local?sAMAccountName?sub?(objectClass=*)" Require ldap-group CN=MySpecificGroup,OU=Security Groups,OU=MyBusiness,DC=company,DC=local This works, however I've to put all users I want to authenticate into MySpecificGroup. But on LDAP server I've configured that MySpecificGroup also contains the group MyOtherGroup with another list of users. But those users in MyOtherGroup are not authenticated, I've to manually add them all to MySpecificGroup and basically can't use the nested grouping. I'm using Windows SBS 2003. Is there a way to configure Apache LDAP to do this? Or is there a problem with possible infinite recursion and thus not allowed?

    Read the article

< Previous Page | 471 472 473 474 475 476 477 478 479 480 481 482  | Next Page >