Search Results

Search found 12404 results on 497 pages for 'native types'.

Page 486/497 | < Previous Page | 482 483 484 485 486 487 488 489 490 491 492 493  | Next Page >

  • JMS MQ Connection closed in JSF 2 SessionBean

    - by veote
    I use Websphere Application Server 8 with MQ Series as Messaging Queue. When I open close the connection in sessionbean in a "postConstruct" method and I use it in another method then its closed. My Code is: import java.io.Serializable; import javax.annotation.PostConstruct; import javax.annotation.PreDestroy; import javax.annotation.Resource; import javax.faces.application.FacesMessage; import javax.faces.bean.ManagedBean; import javax.faces.bean.SessionScoped; import javax.faces.context.FacesContext; import javax.jms.JMSException; import javax.jms.Queue; import javax.jms.QueueConnection; import javax.jms.QueueConnectionFactory; import javax.jms.QueueSender; import javax.jms.QueueSession; import javax.jms.Session; import javax.jms.TextMessage; @ManagedBean @SessionScoped public class MQRequest implements Serializable { private static final long serialVersionUID = 1L; @Resource(name = "jms/wasmqtest/wasmqtest_QCF") private QueueConnectionFactory connectionFactory; @Resource(name = "jms/wasmqtest/Request_Q") private Queue requestQueue; private QueueConnection connection; private String text = ""; public void sendMessage() { System.out.println("Connection in sendMessage: \n" + connection); TextMessage msg; try { QueueSession queueSession = connection.createQueueSession(false, Session.AUTO_ACKNOWLEDGE); QueueSender sender = queueSession.createSender(requestQueue); msg = queueSession.createTextMessage(text); sender.send(msg); queueSession.close(); sender.close(); } catch (JMSException e) { // TODO Auto-generated catch block e.printStackTrace(); } text = ""; } @PostConstruct public void openConenction() { System.out.println("Open Connection"); try { connection = connectionFactory.createQueueConnection(); connection.start(); System.out.println("Connection in OpenConnectioN: \n" + connection); } catch (JMSException e) { e.printStackTrace(); } } @PreDestroy public void closeConnection() { try { System.out.println("Closing Connection"); connection.close(); } catch (JMSException e) { e.printStackTrace(); } } public void setText(String text) { this.text = text; } public String getText() { return text; } } In PostConstruct method the connection is initialized: [21.10.13 07:36:05:574 CEST] 00000025 SystemOut O Connection in OpenConnectioN: com.ibm.ejs.jms.JMSQueueConnectionHandle@36c9b1a managed connection = com.ibm.ejs.jms.JMSManagedQueueConnection@3657e8b physical connection = com.ibm.mq.jms.MQXAQueueConnection@36618b6 closed = false invalid = false restricted methods enabled = false open session handles = [] temporary queues = [] But in sendMessage() method it isnt and I get a ConnectionClosed Problem: [21.10.13 07:36:12:493 CEST] 00000025 SystemOut O Connection in sendMessage: com.ibm.ejs.jms.JMSQueueConnectionHandle@36c9b1a managed connection = null physical connection = null closed = true invalid = false restricted methods enabled = false open session handles = [] temporary queues = [] 21.10.13 07:36:12:461 CEST] 00000025 SystemErr R 15 [WebContainer : 3] INFO org.apache.bval.jsr303.ConfigurationImpl - ignoreXmlConfiguration == true [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R javax.jms.IllegalStateException: Connection closed [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at com.ibm.ejs.jms.JMSConnectionHandle.checkOpen(JMSConnectionHandle.java:821) [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at com.ibm.ejs.jms.JMSQueueConnectionHandle.createQueueSession(JMSQueueConnectionHandle.java:206) [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at de.volkswagen.wasmqtest.queue.MQRequest.sendMessage(MQRequest.java:51) [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:60) [21.10.13 07:36:12:601 CEST] 00000025 SystemErr R at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:37) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at java.lang.reflect.Method.invoke(Method.java:611) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at org.apache.el.parser.AstValue.invoke(AstValue.java:262) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:278) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at org.apache.myfaces.view.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:83) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component._MethodExpressionToMethodBinding.invoke(_MethodExpressionToMethodBinding.java:88) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at org.apache.myfaces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:100) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component.UICommand.broadcast(UICommand.java:120) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component.UIViewRoot._broadcastAll(UIViewRoot.java:973) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:275) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component.UIViewRoot._process(UIViewRoot.java:1285) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:711) [21.10.13 07:36:12:602 CEST] 00000025 SystemErr R at org.apache.myfaces.lifecycle.InvokeApplicationExecutor.execute(InvokeApplicationExecutor.java:34) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at org.apache.myfaces.lifecycle.LifecycleImpl.executePhase(LifecycleImpl.java:171) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at org.apache.myfaces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at javax.faces.webapp.FacesServlet.service(FacesServlet.java:189) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.servlet.ServletWrapper.service(ServletWrapper.java:1147) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.servlet.ServletWrapper.handleRequest(ServletWrapper.java:722) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.servlet.ServletWrapper.handleRequest(ServletWrapper.java:449) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.servlet.ServletWrapperImpl.handleRequest(ServletWrapperImpl.java:178) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.filter.WebAppFilterManager.invokeFilters(WebAppFilterManager.java:1020) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.webapp.WebApp.handleRequest(WebApp.java:3703) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.webapp.WebGroup.handleRequest(WebGroup.java:304) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.WebContainer.handleRequest(WebContainer.java:953) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.WSWebContainer.handleRequest(WSWebContainer.java:1655) [21.10.13 07:36:12:603 CEST] 00000025 SystemErr R at com.ibm.ws.webcontainer.channel.WCChannelLink.ready(WCChannelLink.java:195) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.ws.http.channel.inbound.impl.HttpInboundLink.handleDiscrimination(HttpInboundLink.java:452) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.ws.http.channel.inbound.impl.HttpInboundLink.handleNewRequest(HttpInboundLink.java:511) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.ws.http.channel.inbound.impl.HttpInboundLink.processRequest(HttpInboundLink.java:305) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.ws.http.channel.inbound.impl.HttpICLReadCallback.complete(HttpICLReadCallback.java:83) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.ws.tcp.channel.impl.AioReadCompletionListener.futureCompleted(AioReadCompletionListener.java:165) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.AbstractAsyncFuture.invokeCallback(AbstractAsyncFuture.java:217) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.AsyncChannelFuture.fireCompletionActions(AsyncChannelFuture.java:161) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.AsyncFuture.completed(AsyncFuture.java:138) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.ResultHandler.complete(ResultHandler.java:204) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.ResultHandler.runEventProcessingLoop(ResultHandler.java:775) [21.10.13 07:36:12:604 CEST] 00000025 SystemErr R at com.ibm.io.async.ResultHandler$2.run(ResultHandler.java:905) [21.10.13 07:36:12:605 CEST] 00000025 SystemErr R at com.ibm.ws.util.ThreadPool$Worker.run(ThreadPool.java:1650) Do you have an idea why the connection is closed?

    Read the article

  • C question: Padding bits in unsigned integers and bitwise operations (C89)

    - by Anonymous Question Guy
    I have a lot of code that performs bitwise operations on unsigned integers. I wrote my code with the assumption that those operations were on integers of fixed width without any padding bits. For example an array of 32 bit unsigned integers of which all 32 bits available for each integer. I'm looking to make my code more portable and I'm focused on making sure I'm C89 compliant (in this case). One of the issues that I've come across is possible padded integers. Take this extreme example, taken from the GMP manual: However on Cray vector systems it may be noted that short and int are always stored in 8 bytes (and with sizeof indicating that) but use only 32 or 46 bits. The nails feature can account for this, by passing for instance 8*sizeof(int)-INT_BIT. I've also read about this type of padding in other places. I actually read of a post on SO last night (forgive me, I don't have the link and I'm going to cite something similar from memory) where if you have, say, a double with 60 usable bits the other 4 could be used for padding and those padding bits could serve some internal purpose so they cannot be modified. So let's say for example my code is compiled on a platform where an unsigned int type is sized at 4 bytes, each byte being 8 bits, however the most significant 2 bits are padding bits. Would UINT_MAX in that case be 0x3FFFFFFF (1073741823) ? #include <stdio.h> #include <stdlib.h> /* padding bits represented by underscores */ int main( int argc, char **argv ) { unsigned int a = 0x2AAAAAAA; /* __101010101010101010101010101010 */ unsigned int b = 0x15555555; /* __010101010101010101010101010101 */ unsigned int c = a ^ b; /* ?? __111111111111111111111111111111 */ unsigned int d = c << 5; /* ?? __111111111111111111111111100000 */ unsigned int e = d >> 5; /* ?? __000001111111111111111111111111 */ printf( "a: %X\nb: %X\nc: %X\nd: %X\ne: %X\n", a, b, c, d, e ); return 0; } is it safe to XOR two integers with padding bits? wouldn't I XOR whatever the padding bits are? I can't find this behavior covered in C89. furthermore is the c var guaranteed to be 0x3FFFFFFF or if for example the two padding bits were both on in a or b would c be 0xFFFFFFFF ? same question with d and e. am i manipulating the padding bits by shifting? I would expect to see this below, assuming 32 bits with the 2 most significant bits used for padding, but I want to know if something like this is guaranteed: a: 2AAAAAAA b: 15555555 c: 3FFFFFFF d: 3FFFFFE0 e: 01FFFFFF Also are padding bits always the most significant bits or could they be the least significant bits? Thanks guys EDIT 12/19/2010 5PM EST: Christoph has answered my question. Thanks! I had also asked (above) whether padding bits are always the most significant bits. This is cited in the rationale for the C99 standard, and the answer is no. I am playing it safe and assuming the same for C89. Here is specifically what the C99 rationale says for §6.2.6.2 (Representation of Integer Types): Padding bits are user-accessible in an unsigned integer type. For example, suppose a machine uses a pair of 16-bit shorts (each with its own sign bit) to make up a 32-bit int and the sign bit of the lower short is ignored when used in this 32-bit int. Then, as a 32-bit signed int, there is a padding bit (in the middle of the 32 bits) that is ignored in determining the value of the 32-bit signed int. But, if this 32-bit item is treated as a 32-bit unsigned int, then that padding bit is visible to the user’s program. The C committee was told that there is a machine that works this way, and that is one reason that padding bits were added to C99. Footnotes 44 and 45 mention that parity bits might be padding bits. The committee does not know of any machines with user-accessible parity bits within an integer. Therefore, the committee is not aware of any machines that treat parity bits as padding bits. EDIT 12/28/2010 3PM EST: I found an interesting discussion on comp.lang.c from a few months ago. Bitwise Operator Effects on Padding Bits (VelocityReviews reader) Bitwise Operator Effects on Padding Bits (Google Groups alternate link) One point made by Dietmar which I found interesting: Let's note that padding bits are not necessary for the existence of trap representations; combinations of value bits which do not represent a value of the object type would also do.

    Read the article

  • Error: No mapping exists from object type....

    - by jakesankey
    Here is the code for my simple parsing application. I am getting an error that states 'No mapping exists from type System.Text.RegularExpressions.Match to a known managed provider native type'. This started to occur when I switched from using Split('_') to RegEx.Match for defining RNumberE, RNumberD, etc. Any guidance is appreciated. using System; using System.Data; using System.Data.SQLite; using System.IO; using System.Text.RegularExpressions; using System.Threading; using System.Collections.Generic; using System.Linq; using System.Data.SqlClient; namespace JohnDeereCMMDataParser { internal class Program { public static List<string> GetImportedFileList() { List<string> ImportedFiles = new List<string>(); using (SqlConnection connect = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { connect.Open(); using (SqlCommand fmd = connect.CreateCommand()) { fmd.CommandText = @"SELECT FileName FROM CMMData;"; fmd.CommandType = CommandType.Text; SqlDataReader r = fmd.ExecuteReader(); while (r.Read()) { ImportedFiles.Add(Convert.ToString(r["FileName"])); } } } return ImportedFiles; } private static void Main(string[] args) { Console.Title = "John Deere CMM Data Parser"; Console.WriteLine("Preparing CMM Data Parser... done"); Console.WriteLine("Scanning for new CMM data..."); Console.ForegroundColor = ConsoleColor.Gray; using (SqlConnection con = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { con.Open(); using (SqlCommand insertCommand = con.CreateCommand()) { Console.WriteLine("Connecting to SQL server..."); SqlCommand cmdd = con.CreateCommand(); string[] files = Directory.GetFiles(@"C:\Documents and Settings\js91162\Desktop\CMM WENZEL\", "*_*_*.txt", SearchOption.AllDirectories); List<string> ImportedFiles = GetImportedFileList(); insertCommand.Parameters.Add(new SqlParameter("@FeatType", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@FeatName", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@Axis", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@Actual", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Nominal", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Dev", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolMin", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolPlus", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@OutOfTol", DbType.Decimal)); foreach (string file in files.Except(ImportedFiles)) { var FileNameExt1 = Path.GetFileName(file); cmdd.Parameters.Clear(); cmdd.Parameters.Add(new SqlParameter("@FileExt", FileNameExt1)); cmdd.CommandText = @" IF (EXISTS (SELECT * FROM INFORMATION_SCHEMA.TABLES WHERE TABLE_SCHEMA = 'RX_CMMData' AND TABLE_NAME = 'CMMData')) BEGIN SELECT COUNT(*) FROM CMMData WHERE FileName = @FileExt; END"; int count = Convert.ToInt32(cmdd.ExecuteScalar()); con.Close(); con.Open(); if (count == 0) { Console.WriteLine("Preparing to parse CMM data for SQL import..."); if (file.Count(c => c == '_') > 5) continue; insertCommand.CommandText = @" INSERT INTO CMMData (FeatType, FeatName, Axis, Actual, Nominal, Dev, TolMin, TolPlus, OutOfTol, PartNumber, CMMNumber, Date, FileName) VALUES (@FeatType, @FeatName, @Axis, @Actual, @Nominal, @Dev, @TolMin, @TolPlus, @OutOfTol, @PartNumber, @CMMNumber, @Date, @FileName);"; string FileNameExt = Path.GetFullPath(file); string RNumber = Path.GetFileNameWithoutExtension(file); int index2 = RNumber.IndexOf("~"); Match RNumberE = Regex.Match(RNumber, @"^(R|L)\d{6}(COMP|CRIT|TEST|SU[1-9])(?=_)", RegexOptions.IgnoreCase); Match RNumberD = Regex.Match(RNumber, @"(?<=_)\d{3}[A-Z]\d{4}|\d{3}[A-Z]\d\w\w\d(?=_)", RegexOptions.IgnoreCase); Match RNumberDate = Regex.Match(RNumber, @"(?<=_)\d{8}(?=_)", RegexOptions.IgnoreCase); if (RNumberD.Value == @"") continue; if (RNumberE.Value == @"") continue; if (RNumberDate.Value == @"") continue; if (index2 != -1) continue; /* string RNumberE = RNumber.Split('_')[0]; string RNumberD = RNumber.Split('_')[1]; string RNumberDate = RNumber.Split('_')[2]; */ DateTime dateTime = DateTime.ParseExact(RNumberDate.Value, "yyyyMMdd", Thread.CurrentThread.CurrentCulture); string cmmDate = dateTime.ToString("dd-MMM-yyyy"); string[] lines = File.ReadAllLines(file); bool parse = false; foreach (string tmpLine in lines) { string line = tmpLine.Trim(); if (!parse && line.StartsWith("Feat. Type,")) { parse = true; continue; } if (!parse || string.IsNullOrEmpty(line)) { continue; } Console.WriteLine(tmpLine); foreach (SqlParameter parameter in insertCommand.Parameters) { parameter.Value = null; } string[] values = line.Split(new[] { ',' }); for (int i = 0; i < values.Length - 1; i++) { SqlParameter param = insertCommand.Parameters[i]; if (param.DbType == DbType.Decimal) { decimal value; param.Value = decimal.TryParse(values[i], out value) ? value : 0; } else { param.Value = values[i]; } } insertCommand.Parameters.Add(new SqlParameter("@PartNumber", RNumberE)); insertCommand.Parameters.Add(new SqlParameter("@CMMNumber", RNumberD)); insertCommand.Parameters.Add(new SqlParameter("@Date", cmmDate)); insertCommand.Parameters.Add(new SqlParameter("@FileName", FileNameExt)); insertCommand.ExecuteNonQuery(); insertCommand.Parameters.RemoveAt("@PartNumber"); insertCommand.Parameters.RemoveAt("@CMMNumber"); insertCommand.Parameters.RemoveAt("@Date"); insertCommand.Parameters.RemoveAt("@FileName"); } } } Console.WriteLine("CMM data successfully imported to SQL database..."); } con.Close(); } } } }

    Read the article

  • Is there an equivalent to Java's ClassFileTransformer in .NET? (a way to replace a class)

    - by Alix
    I've been searching for this for quite a while with no luck so far. Is there an equivalent to Java's ClassFileTransformer in .NET? Basically, I want to create a class CustomClassFileTransformer (which in Java would implement the interface ClassFileTransformer) that gets called whenever a class is loaded, and is allowed to tweak it and replace it with the tweaked version. I know there are frameworks that do similar things, but I was looking for something more straightforward, like implementing my own ClassFileTransformer. Is it possible? EDIT #1. More details about why I need this: Basically, I have a C# application and I need to monitor the instructions it wants to run in order to detect read or write operations to fields (operations Ldfld and Stfld) and insert some instructions before the read/write takes place. I know how to do this (except for the part where I need to be invoked to replace the class): for every method whose code I want to monitor, I must: Get the method's MethodBody using MethodBase.GetMethodBody() Transform it to byte array with MethodBody.GetILAsByteArray(). The byte[] it returns contains the bytecode. Analyse the bytecode as explained here, possibly inserting new instructions or deleting/modifying existing ones by changing the contents of the array. Create a new method and use the new bytecode to create its body, with MethodBuilder.CreateMethodBody(byte[] il, int count), where il is the array with the bytecode. I put all these tweaked methods in a new class and use the new class to replace the one that was originally going to be loaded. An alternative to replacing classes would be somehow getting notified whenever a method is invoked. Then I'd replace the call to that method with a call to my own tweaked method, which I would tweak only the first time is invoked and then I'd put it in a dictionary for future uses, to reduce overhead (for future calls I'll just look up the method and invoke it; I won't need to analyse the bytecode again). I'm currently investigating ways to do this and LinFu looks pretty interesting, but if there was something like a ClassFileTransformer it would be much simpler: I just rewrite the class, replace it, and let the code run without monitoring anything. An additional note: the classes may be sealed. I want to be able to replace any kind of class, I cannot impose restrictions on their attributes. EDIT #2. Why I need to do this at runtime. I need to monitor everything that is going on so that I can detect every access to data. This applies to the code of library classes as well. However, I cannot know in advance which classes are going to be used, and even if I knew every possible class that may get loaded it would be a huge performance hit to tweak all of them instead of waiting to see whether they actually get invoked or not. POSSIBLE (BUT PRETTY HARDCORE) SOLUTION. In case anyone is interested (and I see the question has been faved, so I guess someone is), this is what I'm looking at right now. Basically I'd have to implement the profiling API and I'll register for the events that I'm interested in, in my case whenever a JIT compilation starts. An extract of the blogpost: In your ICorProfilerCallback2::ModuleLoadFinished callback, you call ICorProfilerInfo2::GetModuleMetadata to get a pointer to a metadata interface on that module. QI for the metadata interface you want. Search MSDN for "IMetaDataImport", and grope through the table of contents to find topics on the metadata interfaces. Once you're in metadata-land, you have access to all the types in the module, including their fields and function prototypes. You may need to parse metadata signatures and this signature parser may be of use to you. In your ICorProfilerCallback2::JITCompilationStarted callback, you may use ICorProfilerInfo2::GetILFunctionBody to inspect the original IL, and ICorProfilerInfo2::GetILFunctionBodyAllocator and then ICorProfilerInfo2::SetILFunctionBody to replace that IL with your own. The great news: I get notified when a JIT compilation starts and I can replace the bytecode right there, without having to worry about replacing the class, etc. The not-so-great news: you cannot invoke managed code from the API's callback methods, which makes sense but means I'm on my own parsing the IL code, etc, as opposed to be able to use Cecil, which would've been a breeze. I don't think there's a simpler way to do this without using AOP frameworks (such as PostSharp). If anyone has any other idea please let me know. I'm not marking the question as answered yet.

    Read the article

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • Problem with From field in contact form and mail() function

    - by Matthew
    I've got a contact form with 3 fields and a textarea... I use jQuery to validate it and then php to send emails. This contact form works fine but, when I receive an email, From field isn't correct. I'd like to want that From field shows text typed in the Name field of the contact form. Now I get a From field like this: <[email protected]> For example, if an user types "Matthew" in the name field, I'd like to want that this word "Matthew" appears in the From field. This is my code (XHTML, jQuery, PHP): <div id="contact"> <h3 id="formHeader">Send Us a Message!</h3> <form id="contactForm" method="post" action=""> <div id="risposta"></div> <!-- End Risposta Div --> <span>Name:</span> <input type="text" id="formName" value="" /><br /> <span>E-mail:</span> <input type="text" id="formEmail" value="" /><br /> <span>Subject:</span> <input type="text" id="formSubject" value="" /><br /> <span>Message:</span> <textarea id="formMessage" rows="9" cols="20"></textarea><br /> <input type="submit" id="formSend" value="Send" /> </form> </div> <script type="text/javascript"> $(document).ready(function(){ $("#formSend").click(function(){ var valid = ''; var nome = $("#formName").val(); var mail = $("#formEmail").val(); var oggetto = $("#formSubject").val(); var messaggio = $("#formMessage").val(); if (nome.length<1) { valid += '<span>Name field empty.</span><br />'; } if (!mail.match(/^([a-z0-9._-]+@[a-z0-9._-]+\.[a-z]{2,4}$)/i)) { valid += '<span>Email not valid or empty field.</span><br />'; } if (oggetto.length<1) { valid += '<span>Subject field empty.</span><br />'; } if (valid!='') { $("#risposta").fadeIn("slow"); $("#risposta").html("<span><b>Error:</b></span><br />"+valid); $("#risposta").css("background-color","#ffc0c0"); } else { var datastr ='nome=' + nome + '&mail=' + mail + '&oggetto=' + oggetto + '&messaggio=' + encodeURIComponent(messaggio); $("#risposta").css("display", "block"); $("#risposta").css("background-color","#FFFFA0"); $("#risposta").html("<span>Sending message...</span>"); $("#risposta").fadeIn("slow"); setTimeout("send('"+datastr+"')",2000); } return false; }); }); function send(datastr){ $.ajax({ type: "POST", url: "contactForm.php", data: datastr, cache: false, success: function(html) { $("#risposta").fadeIn("slow"); $("#risposta").html('<span>Message successfully sent.</span>'); $("#risposta").css("background-color","#e1ffc0"); setTimeout('$("#risposta").fadeOut("slow")',2000); } }); } </script> <?php $mail = $_POST['mail']; $nome = $_POST['nome']; $oggetto = $_POST['oggetto']; $text = $_POST['messaggio']; $ip = $_SERVER['REMOTE_ADDR']; $to = "[email protected]"; $message = $text."<br /><br />IP: ".$ip."<br />"; $headers = "From: $nome \n"; $headers .= "Reply-To: $mail \n"; $headers .= "MIME-Version: 1.0 \n"; $headers .= "Content-Type: text/html; charset=UTF-8 \n"; mail($to, $oggetto, $message, $headers); ?>

    Read the article

  • setIncludesSubentities: in an NSFetchRequest is broken for entities across multiple persistent store

    - by SG
    Prior art which doesn't quite address this: http://stackoverflow.com/questions/1774359/core-data-migration-error-message-model-does-not-contain-configuration-xyz I have narrowed this down to a specific issue. It takes a minute to set up, though; please bear with me. The gist of the issue is that a persistentStoreCoordinator (apparently) cannot preserve the part of an object graph where a managedObject is marked as a subentity of another when they are stored in different files. Here goes... 1) I have 2 xcdatamodel files, each containing a single entity. In runtime, when the managed object model is constructed, I manually define one entity as subentity of another using setSubentities:. This is because defining subentities across multiple files in the editor is not supported yet. I then return the complete model with modelByMergingModels. //Works! [mainEntity setSubentities:canvasEntities]; NSLog(@"confirm %@ is super for %@", [[[canvasEntities lastObject] superentity] name], [[canvasEntities lastObject] name]); //Output: "confirm Note is super for Browser" 2) I have modified the persistentStoreCoordinator method so that it sets a different store for each entity. Technically, it uses configurations, and each entity has one and only one configuration defined. //Also works! for ( NSString *configName in [[HACanvasPluginManager shared].registeredCanvasTypes valueForKey:@"viewControllerClassName"] ) { storeUrl = [NSURL fileURLWithPath:[[self applicationDocumentsDirectory] stringByAppendingPathComponent:[configName stringByAppendingPathExtension:@"sqlite"]]]; //NSLog(@"entities for configuration '%@': %@", configName, [[[self managedObjectModel] entitiesForConfiguration:configName] valueForKey:@"name"]); //Output: "entities for configuration 'HATextCanvasController': (Note)" //Output: "entities for configuration 'HAWebCanvasController': (Browser)" if (![persistentStoreCoordinator addPersistentStoreWithType:NSSQLiteStoreType configuration:configName URL:storeUrl options:options error:&error]) //etc 3) I have a fetchRequest set for the parent entity, with setIncludesSubentities: and setAffectedStores: just to be sure we get both 1) and 2) covered. When inserting objects of either entity, they both are added to the context and they both are fetched by the fetchedResultsController and displayed in the tableView as expected. // Create the fetch request for the entity. NSFetchRequest *fetchRequest = [[NSFetchRequest alloc] init]; [fetchRequest setEntity:entity]; [fetchRequest setIncludesSubentities:YES]; //NECESSARY to fetch all canvas types [fetchRequest setSortDescriptors:sortDescriptors]; [fetchRequest setFetchBatchSize:20]; // Set the batch size to a suitable number. [fetchRequest setAffectedStores:[[managedObjectContext persistentStoreCoordinator] persistentStores]]; [fetchRequest setReturnsObjectsAsFaults:NO]; Here is where it starts misbehaving: after closing and relaunching the app, ONLY THE PARENT ENTITY is fetched. If I change the entity of the request using setEntity: to the entity for 'Note', all notes are fetched. If I change it to the entity for 'Browser', all the browsers are fetched. Let me reiterate that during the run in which an object is first inserted into the context, it will appear in the list. It is only after save and relaunch that a fetch request fails to traverse the hierarchy. Therefore, I can only conclude that it is the storage of the inheritance that is the problem. Let's recap why: - Both entities can be created, inserted into the context, and viewed, so the model is working - Both entities can be fetched with a single request, so the inheritance is working - I can confirm that the files are being stored separately and objects are going into their appropriate stores, so saving is working - Launching the app with either entity set for the request works, so retrieval from the store is working - This also means that traversing different stores with the request is working - By using a single store instead of multiple, the problem goes away completely, so creating, storing, fetching, viewing etc is working correctly. This leaves only one culprit (to my mind): the inheritance I'm setting with setSubentities: is effective only for objects creating during the session. Either objects/entities are being stored stripped of the inheritance info, or entity inheritance as defined programmatically only applies to new instances, or both. Either of these is unacceptable. Either it's a bug or I am way, way off course. I have been at this every which way for two days; any insight is greatly appreciated. The current workaround - just using a single store - works completely, except it won't be future-proof in the event that I remove one of the models from the app etc. It also boggles the mind because I can't see why you would have all this infrastructure for storing across multiple stores and for setting affected stores in fetch requests if it by core definition (of setSubentities:) doesn't work.

    Read the article

  • Hibernate, Spring and SLF4J Binding

    - by asrijaal
    Hi, I'm trying to setup a webapp with maven2 managed dependcies. Here my pom.xml <project xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/maven-v4_0_0.xsd"> <modelVersion>4.0.0</modelVersion> <groupId>mtx-production</groupId> <artifactId>mtx-production</artifactId> <version>0.0.1</version> <dependencies> <dependency> <groupId>org.springframework</groupId> <artifactId>spring-core</artifactId> <version>3.0.2.RELEASE</version> </dependency> <dependency> <groupId>org.springframework</groupId> <artifactId>spring-orm</artifactId> <version>3.0.2.RELEASE</version> <type>jar</type> </dependency> <dependency> <groupId>org.springframework</groupId> <artifactId>spring-web</artifactId> <version>3.0.2.RELEASE</version> <type>jar</type> </dependency> <dependency> <groupId>mysql</groupId> <artifactId>mysql-connector-java</artifactId> <version>5.1.12</version> </dependency> <dependency> <groupId>org.hibernate</groupId> <artifactId>hibernate-core</artifactId> <version>3.5.1-Final</version> <type>jar</type> <scope>compile</scope> </dependency> <dependency> <groupId>org.hibernate</groupId> <artifactId>hibernate-annotations</artifactId> <version>3.5.1-Final</version> <type>jar</type> <scope>compile</scope> </dependency> <dependency> <groupId>org.slf4j</groupId> <artifactId>slf4j-log4j12</artifactId> <version>1.5.8</version> <type>jar</type> <scope>compile</scope> </dependency> <dependency> <groupId>log4j</groupId> <artifactId>log4j</artifactId> <version>1.2.14</version> <type>jar</type> <scope>compile</scope> </dependency> </dependencies> <repositories> <repository> <id>jboss-releases</id> <url>http://repository.jboss.org/maven2</url> </repository> </repositories> </project> Correct me if I got something wrong but this should work?! I only getting in my eclipse this exception 13.06.2010 16:48:15 org.springframework.context.support.AbstractApplicationContext$BeanPostProcessorChecker postProcessAfterInitialization INFO: Bean 'dataSource' is not eligible for getting processed by all BeanPostProcessors (for example: not eligible for auto-proxying) SLF4J: Failed to load class "org.slf4j.impl.StaticLoggerBinder". SLF4J: See http://www.slf4j.org/codes.html#StaticLoggerBinder for further details. 13.06.2010 16:48:15 org.springframework.beans.factory.support.DefaultSingletonBeanRegistry destroySingletons INFO: Destroying singletons in org.springframework.beans.factory.support.DefaultListableBeanFactory@366573: defining beans [org.springframework.context.annotation.internalConfigurationAnnotationProcessor,org.springframework.context.annotation.internalAutowiredAnnotationProcessor,org.springframework.context.annotation.internalRequiredAnnotationProcessor,org.springframework.context.annotation.internalCommonAnnotationProcessor,org.springframework.context.annotation.internalPersistenceAnnotationProcessor,org.springframework.beans.factory.config.PropertyPlaceholderConfigurer#0,dataSource,sessionFactory,org.springframework.aop.config.internalAutoProxyCreator,org.springframework.transaction.annotation.AnnotationTransactionAttributeSource#0,org.springframework.transaction.interceptor.TransactionInterceptor#0,org.springframework.transaction.config.internalTransactionAdvisor,myTxManager,org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor#0]; root of factory hierarchy 13.06.2010 16:48:15 org.springframework.web.context.ContextLoader initWebApplicationContext SCHWERWIEGEND: Context initialization failed org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor#0' defined in ServletContext resource [/WEB-INF/applicationContext.xml]: Initialization of bean failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'sessionFactory' defined in ServletContext resource [/WEB-INF/applicationContext.xml]: Invocation of init method failed; nested exception is java.lang.NoClassDefFoundError: org/slf4j/impl/StaticLoggerBinder at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:527) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:194) at org.springframework.context.support.AbstractApplicationContext.registerBeanPostProcessors(AbstractApplicationContext.java:687) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:408) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:276) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:197) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:47) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:3830) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4337) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardHost.start(StandardHost.java:719) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:516) at org.apache.catalina.core.StandardServer.start(StandardServer.java:710) at org.apache.catalina.startup.Catalina.start(Catalina.java:566) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:288) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:413) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'sessionFactory' defined in ServletContext resource [/WEB-INF/applicationContext.xml]: Invocation of init method failed; nested exception is java.lang.NoClassDefFoundError: org/slf4j/impl/StaticLoggerBinder at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1412) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:519) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:194) at org.springframework.beans.factory.support.DefaultListableBeanFactory.getBeansOfType(DefaultListableBeanFactory.java:387) at org.springframework.beans.factory.BeanFactoryUtils.beansOfTypeIncludingAncestors(BeanFactoryUtils.java:266) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.detectPersistenceExceptionTranslators(PersistenceExceptionTranslationInterceptor.java:139) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.<init>(PersistenceExceptionTranslationInterceptor.java:79) at org.springframework.dao.annotation.PersistenceExceptionTranslationAdvisor.<init>(PersistenceExceptionTranslationAdvisor.java:70) at org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor.setBeanFactory(PersistenceExceptionTranslationPostProcessor.java:99) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.invokeAwareMethods(AbstractAutowireCapableBeanFactory.java:1431) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1400) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:519) ... 25 more Caused by: java.lang.NoClassDefFoundError: org/slf4j/impl/StaticLoggerBinder What is wrong with my setup?

    Read the article

  • Intellij Idea 13.x and ASM 5.x library incompatible?

    - by Jarrod Roberson
    I can't get Intellij Idea 13.0 to compile my code against ASM 5.0.3 I have a multi-module Maven project. It compiles and installs successfully. Apparently com.google.findbugs:findbugs has a dependency on asm:asm:3.3 and I want to use org.ow2.asm:asm:5.0.3 to manipulate some bytecode. So in the parent pom.xml I exclude the asm:asm:3.3 dependencies from the classpath. This works fine when I run mvn install from the command line. I can't get the Build - Make Project menu selection to work in Intellij Idea. Here is the relevant parts of my pom.xml files. parent.pom <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-tree</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-util</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-commons</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>com.google.code.findbugs</groupId> <artifactId>findbugs</artifactId> <version>2.0.3</version> <exclusions> <exclusion> <groupId>asm</groupId> <artifactId>asm</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-commons</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-tree</artifactId> </exclusion> </exclusions> </dependency> Here is the code that is failing 18 public static void main(final String[] args) throws IOException 19 { 20 final InputStream is = NotEmptyTest.class.getResourceAsStream("/com/vertigrated/annotation/NotEmptyTest.class"); 21 final ClassReader cr = new ClassReader(is); 22 final ClassNode cn = new ClassNode(); 23 cr.accept(cn, 0); 24 for (final MethodNode mn : cn.methods) 25 { 26 - 38 snipped for brevity 39 } 40 } 41 } Here is the error message: Information:Using javac 1.7.0_25 to compile java sources Information:java: Errors occurred while compiling module 'tests' Information:Compilation completed with 1 error and 2 warnings in 2 sec Information:1 error Information:2 warnings /<path to my source code>/NotEmptyTest.java Error:Error:line (24)java: incompatible types required: org.objectweb.asm.tree.MethodNode found: java.lang.Object Warning:Warning:java: /<path to my project>//NotEmptyTest.java uses unchecked or unsafe operations. Warning:Warning:java: Recompile with -Xlint:unchecked for details. As you can see in the screen capture, it reports the correct version of the libraries in the Javadoc but the AutoComplete shows the old 3.3 non-typesafe return value of List instead of List<MethodNode>: Here is what Maven knows, which is correct: [INFO] --- maven-dependency-plugin:2.8:list (default-cli) @ tests --- [INFO] [INFO] The following files have been resolved: [INFO] com.google.code.findbugs:bcel:jar:2.0.1:compile [INFO] junit:junit:jar:4.11:test [INFO] xml-apis:xml-apis:jar:1.0.b2:compile [INFO] com.apple:AppleJavaExtensions:jar:1.4:compile [INFO] javax.inject:javax.inject:jar:1:compile [INFO] jaxen:jaxen:jar:1.1.6:compile [INFO] org.ow2.asm:asm-util:jar:5.0.3:compile [INFO] com.google.inject:guice:jar:3.0:compile [INFO] dom4j:dom4j:jar:1.6.1:compile [INFO] com.google.code.findbugs:jFormatString:jar:2.0.1:compile [INFO] net.jcip:jcip-annotations:jar:1.0:compile [INFO] org.ow2.asm:asm-tree:jar:5.0.3:compile [INFO] commons-lang:commons-lang:jar:2.6:compile [INFO] com.google.code.findbugs:jsr305:jar:2.0.1:compile [INFO] org.hamcrest:hamcrest-core:jar:1.3:test [INFO] aopalliance:aopalliance:jar:1.0:compile [INFO] com.google.code.findbugs:findbugs:jar:2.0.3:compile [INFO] org.ow2.asm:asm-commons:jar:5.0.3:compile [INFO] org.ow2.asm:asm:jar:5.0.3:compile How do I get Intellij Idea to use the correct dependency internally?

    Read the article

  • Mutating the expression tree of a predicate to target another type

    - by Jon
    Intro In the application I 'm currently working on, there are two kinds of each business object: the "ActiveRecord" type, and the "DataContract" type. So for example, we have: namespace ActiveRecord { class Widget { public int Id { get; set; } } } namespace DataContracts { class Widget { public int Id { get; set; } } } The database access layer takes care of "translating" between hierarchies: you can tell it to update a DataContracts.Widget, and it will magically create an ActiveRecord.Widget with the same property values and save that. The problem I have surfaced when attempting to refactor this database access layer. The Problem I want to add methods like the following to the database access layer: // Widget is DataContract.Widget interface DbAccessLayer { IEnumerable<Widget> GetMany(Expression<Func<Widget, bool>> predicate); } The above is a simple general-use "get" method with custom predicate. The only point of interest is that I 'm not passing in an anonymous function but rather an expression tree. This is done because inside DbAccessLayer we have to query ActiveRecord.Widget efficiently (LINQ to SQL) and not have the database return all ActiveRecord.Widget instances and then filter the enumerable collection. We need to pass in an expression tree, so we ask for one as the parameter for GetMany. The snag: the parameter we have needs to be magically transformed from an Expression<Func<DataContract.Widget, bool>> to an Expression<Func<ActiveRecord.Widget, bool>>. This is where I haven't managed to pull it off... Attempted Solution What we 'd like to do inside GetMany is: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( predicate.Body, predicate.Parameters); // use lambda to query ActiveRecord.Widget and return some value } This won't work because in a typical scenario, for example if: predicate == w => w.Id == 0; ...the expression tree contains a MemberAccessExpression instance which has a MemberInfo property (named Member) that point to members of DataContract.Widget. There are also ParameterExpression instances both in the expression tree and in its parameter expression collection (predicate.Parameters); After searching a bit, I found System.Linq.Expressions.ExpressionVisitor (its source can be found here in the context of a how-to, very helpful) which is a convenient way to modify an expression tree. Armed with this, I implemented a visitor. This simple visitor only takes care of changing the types in member access and parameter expressions. It may not be complete, but it's fine for the expression w => w.Id == 0. internal class Visitor : ExpressionVisitor { private readonly Func<Type, Type> dataContractToActiveRecordTypeConverter; public Visitor(Func<Type, Type> dataContractToActiveRecordTypeConverter) { this.dataContractToActiveRecordTypeConverter = dataContractToActiveRecordTypeConverter; } protected override Expression VisitMember(MemberExpression node) { var dataContractType = node.Member.ReflectedType; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); var converted = Expression.MakeMemberAccess( base.Visit(node.Expression), activeRecordType.GetProperty(node.Member.Name)); return converted; } protected override Expression VisitParameter(ParameterExpression node) { var dataContractType = node.Type; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); return Expression.Parameter(activeRecordType, node.Name); } } With this visitor, GetMany becomes: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var visitor = new Visitor(...); var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( visitor.Visit(predicate.Body), predicate.Parameters.Select(p => visitor.Visit(p)); var widgets = ActiveRecord.Widget.Repository().Where(lambda); // This is just for reference, see below Expression<Func<ActiveRecord.Widget, bool>> referenceLambda = w => w.Id == 0; // Here we 'd convert the widgets to instances of DataContract.Widget and // return them -- this has nothing to do with the question though. } Results The good news is that lambda is constructed just fine. The bad news is that it isn't working; it's blowing up on me when I try to use it (the exception messages are really not helpful at all). I have examined the lambda my code produces and a hardcoded lambda with the same expression; they look exactly the same. I spent hours in the debugger trying to find some difference, but I can't. When predicate is w => w.Id == 0, lambda looks exactly like referenceLambda. But the latter works with e.g. IQueryable<T>.Where, while the former does not (I have tried this in the immediate window of the debugger). I should also mention that when predicate is w => true, it all works just fine. Therefore I am assuming that I 'm not doing enough work in Visitor, but I can't find any more leads to follow on. Can someone point me in the right direction? Thanks in advance for your help!

    Read the article

  • Why does this XML validation via XSD fail in libxml2 (but succeed in xmllint) and how do I fix it?

    - by mtree
    If I run this XML validation via xmllint: xmllint --noout --schema schema.xsd test.xml I get this success message: .../test.xml validates However if I run the same validation via libxml2's C API: int result = xmlSchemaValidateDoc(...) I get a return value of 1845 and this failure message: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Which I can make absolutely no sense of. :( schema.xsd: <?xml version="1.0" encoding="utf-8" ?> <!DOCTYPE xs:schema PUBLIC "-//W3C//DTD XMLSCHEMA 200102//EN" "XMLSchema.dtd" > <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://example.com/XMLSchema/1.0" targetNamespace="http://example.com/XMLSchema/1.0" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xs:element name="foo"> </xs:element> </xs:schema> test.xml: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> main.c: #include <stdio.h> #include <sys/stat.h> #include <sys/types.h> #include <string.h> #include <libxml/parser.h> #include <libxml/valid.h> #include <libxml/xmlschemas.h> u_int32_t get_file_size(const char *file_name) { struct stat buf; if ( stat(file_name, &buf) != 0 ) return(0); return (unsigned int)buf.st_size; } void handleValidationError(void *ctx, const char *format, ...) { char *errMsg; va_list args; va_start(args, format); vasprintf(&errMsg, format, args); va_end(args); fprintf(stderr, "Validation Error: %s", errMsg); free(errMsg); } int main (int argc, const char * argv[]) { const char *xsdPath = argv[1]; const char *xmlPath = argv[2]; printf("\n"); printf("XSD File: %s\n", xsdPath); printf("XML File: %s\n", xmlPath); int xmlLength = get_file_size(xmlPath); char *xmlSource = (char *)malloc(sizeof(char) * xmlLength); FILE *p = fopen(xmlPath, "r"); char c; unsigned int i = 0; while ((c = fgetc(p)) != EOF) { xmlSource[i++] = c; } printf("\n"); printf("XML Source:\n\n%s\n", xmlSource); fclose(p); printf("\n"); int result = 42; xmlSchemaParserCtxtPtr parserCtxt = NULL; xmlSchemaPtr schema = NULL; xmlSchemaValidCtxtPtr validCtxt = NULL; xmlDocPtr xmlDocumentPointer = xmlParseMemory(xmlSource, xmlLength); parserCtxt = xmlSchemaNewParserCtxt(xsdPath); if (parserCtxt == NULL) { fprintf(stderr, "Could not create XSD schema parsing context.\n"); goto leave; } schema = xmlSchemaParse(parserCtxt); if (schema == NULL) { fprintf(stderr, "Could not parse XSD schema.\n"); goto leave; } validCtxt = xmlSchemaNewValidCtxt(schema); if (!validCtxt) { fprintf(stderr, "Could not create XSD schema validation context.\n"); goto leave; } xmlSetStructuredErrorFunc(NULL, NULL); xmlSetGenericErrorFunc(NULL, handleValidationError); xmlThrDefSetStructuredErrorFunc(NULL, NULL); xmlThrDefSetGenericErrorFunc(NULL, handleValidationError); result = xmlSchemaValidateDoc(validCtxt, xmlDocumentPointer); leave: if (parserCtxt) { xmlSchemaFreeParserCtxt(parserCtxt); } if (schema) { xmlSchemaFree(schema); } if (validCtxt) { xmlSchemaFreeValidCtxt(validCtxt); } printf("\n"); printf("Validation successful: %s (result: %d)\n", (result == 0) ? "YES" : "NO", result); return 0; } console output: XSD File: /Users/dephiniteloop/Desktop/xml_validate/schema.xsd XML File: /Users/dephiniteloop/Desktop/xml_validate/test.gkml XML Source: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> Validation Error: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Validation successful: NO (result: 1845) In case it matters: I'm on OSX 10.6.7 with its default libxml2.dylib (/Developer/SDKs/MacOSX10.6.sdk/usr/lib/libxml2.2.7.3.dylib)

    Read the article

  • MediaElement.js setSrc() Loading The File But Not Changing pluginType

    - by doubleJ
    I'm working on a page that uses mediaelement.js to play mp3/mp4/wmv (yes, we have a lot of wmv). I have a list of links and those links should change the player. My effort is to make the changes to the player through javascript so that the page doesn't refresh. This code is working, but it refreshes every time. See a live demo of the non-ajax version. <?php $file = null; $file = $_GET["file"]; $format = null; if (preg_match("/mp4/i", $file)) $format = "mp4"; if (preg_match("/webm/i", $file)) $format = "webm"; if (preg_match("/wmv/i", $file)) $format = "wmv"; if (preg_match("/mp3/i", $file)) $format = "mp3"; if (preg_match("/ogg/i", $file)) $format = "ogg"; $mime = null; if ($format == "mp4") $mime = "video/mp4"; if ($format == "webm") $mime = "video/webm"; if ($format == "wmv") $mime = "video/wmv"; if ($format == "mp3") $mime = "audio/mp3"; if ($format == "ogg") $mime = "audio/ogg"; $element = "video"; if ($format == "mp3" || $format == "ogg") $element = "audio"; // you have to escape (\) the escape (\) character (hehehe...) $poster = "media\\120701Video.jpg"; $height = "360"; if ($format == "mp3") $height = "30"; ?> <!doctype html> <html> <head> <meta charset="utf-8"> <title>Embed</title> <link rel="stylesheet" href="include/johndyer-mediaelement-b090320/build/mediaelementplayer.min.css"> <style> audio {width:640px; height:30px;} video {width:640px; height:360px;} </style> <script src="include/johndyer-mediaelement-b090320/build/jquery.js"></script> <script src="include/johndyer-mediaelement-b090320/build/mediaelement-and-player.js"></script> </head> <body> <ul> <li><a href="embed.php">Reset</a></li> <li><a href="?file=media/120701Video-AnyVideoConverter.mp4">Alternative (mp4)</a></li> <li><a href="?file=media/120701Video-Ffmpeg-Defaults.webm">Alternative (webm)</a></li> <li><a href="?file=media/AreYouHurting-Death.wmv">Alternative (wmv)</a><li> <li><a href="?file=media/AreYouHurting-Death.mp3">Alternative (mp3)</a></li> </ul> <?php if ($file) { ?> <video src="<?php echo $file; ?>" controls poster="<?php echo $poster; ?>" width="640" height="360"></video> <div id="type"></div> <script> var video = document.getElementsByTagName("video")[0]; var player = new MediaElementPlayer(video, { success: function(player) { $('#type').html(player.pluginType); } }); <?php } ?> </script> </body> </html> This code requires <video> to be loaded, initially and with a file, so that the player mode (pluginType) is set. It will, then, only play formats that the pre-established mode supports (firefox in native mode won't play mp4). See a live demo of the ajax version. <!doctype html> <html> <head> <meta charset="utf-8"> <title>Embed</title> <link rel="stylesheet" href="http://www.mediaelementjs.com/js/mejs-2.9.2/mediaelementplayer.min.css"> <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.2/jquery.min.js"></script> <script src="http://www.mediaelementjs.com/js/mejs-2.9.2/mediaelement-and-player.js"></script> </head> <body> <ul> <li><a href="javascript:player.pause(); player.setSrc('media/120701Video-AnyVideoConverter.mp4'); player.load(); player.play();">Alternative (mp4)</a></li> <li><a href="javascript:player.pause(); player.setSrc('media/120701Video-Ffmpeg-Defaults.webm'); player.load(); player.play();">Alternative (webm)</a></li> <li><a href="javascript:player.pause(); player.setSrc('media/AreYouHurting-Death.wmv'); player.load(); player.play();">Alternative (wmv)</a></li> <li><a href="javascript:player.pause(); player.setSrc('media/AreYouHurting-Death.mp3'); player.load(); player.play();">Alternative (mp3)</a></li> </ul> <video controls src="media/WordProductionCenter.mp4"></video> <div id="type"></div> <script> var video = document.getElementsByTagName("video")[0]; var player = new MediaElementPlayer(video, { success: function(player) { $('#type').html(player.pluginType); } }); </script> </body> </html> It seems like I need something like setType(), but I see no such option. I've read a couple pages that referenced refreshing the DOM after the javascript runs, but I haven't been able to successfully do it (I know enough about javascript to hack things around and get stuff working, but not enough to create whole new things). It is worth noting that Silverlight doesn't work with Internet Explorer 8 or Safari (not sure if it's my code, mejs, or the browsers). Also, neither Silverlight nor Flash play mp3 or webm (again, not sure where the problem lies). Is there a way to dynamically load different types of files into mediaelement?

    Read the article

  • Will these optimizations to my Ruby implementation of diff improve performance in a Rails app?

    - by grg-n-sox
    <tl;dr> In source version control diff patch generation, would it be worth it to use the optimizations listed at the very bottom of this writing (see <optimizations>) in my Ruby implementation of diff for making diff patches? </tl;dr> <introduction> I am programming something I have never done before and there might already be tools out there to do the exact thing I am programming but at this point I am having too much fun to care so I am still going to do it from scratch, even if there is a tool for this. So anyways, I am working on a Ruby on Rails app and need a certain feature. Basically I want each entry in a table of mine, let's say for example a table of video games, to have a stored chunk of text that represents a review or something of the sort for that table entry. However, I want this text to be both editable by any registered user and also keep track of different submissions in a version control system. The simplest solution I could think of is just implement a solution that keeps track of the text body and the diff patch history of different versions of the text body as objects in Ruby and then serialize it, preferably in human readable form (so I'll most likely use YAML for this) for editing if needed due to corruption by a software bug or a mistake is made by an admin doing some version editing. So at first I just tried to dive in head first into this feature to find that the problem of generating a diff patch is more difficult that I thought to do efficiently. So I did some research and came across some ideas. Some I have implemented already and some I have not. However, it all pretty much revolves around the longest common subsequence problem, as you would already know if you have already done anything with diff or diff-like features, and optimization the function that solves it. Currently I have it so it truncates the compared versions of the text body from the beginning and end until non-matching lines are found. Then it solves the problem using a comparison matrix, but instead of incrementing the value stored in a cell when it finds a matching line like in most longest common subsequence algorithms I have seen examples of, I increment when I have a non-matching line so as to calculate edit distance instead of longest common subsequence. Although as far as I can tell between the two approaches, they are essentially two sides of the same coin so either could be used to derive an answer. It then back-traces through the comparison matrix and notes when there was an incrementation and in which adjacent cell (West, Northwest, or North) to determine that line's diff entry and assumes all other lines to be unchanged. Normally I would leave it at that, but since this is going into a Rails environment and not just some stand-alone Ruby script, I started getting worried about needing to optimize at least enough so if a spammer that somehow knew how I implemented the version control system and knew my worst case scenario entry still wouldn't be able to hit the server that bad. After some searching and reading of research papers and articles through the internet, I've come across several that seem decent but all seem to have pros and cons and I am having a hard time deciding how well in this situation that the pros and cons balance out. So are the ones listed here worth it? I have listed them with known pros and cons. </introduction> <optimizations> Chop the compared sequences into multiple chucks of subsequences by splitting where lines are unchanged, and then truncating each section of unchanged lines at the beginning and end of each section. Then solve the edit distance of each subsequence. Pro: Changes the time increase as the changed area gets bigger from a quadratic increase to something more similar to a linear increase. Con: Figuring out where to split already seems like you have to solve edit distance except now you don't care how it is changed. Would be fine if this was solvable by a process closer to solving hamming distance but a single insertion would throw this off. Use a cryptographic hash function to both convert all sequence elements into integers and ensure uniqueness. Then solve the edit distance comparing the hash integers instead of the sequence elements themselves. Pro: The operation of comparing two integers is faster than the operation of comparing two strings, so a slight performance gain is received after every comparison, which can be a lot overall. Con: Using a cryptographic hash function takes time to convert all the sequence elements and may end up costing more time to do the conversion that you gain back from the integer comparisons. You could use the built in hash function for a string but that will not guarantee uniqueness. Use lazy evaluation to only calculate the three center-most diagonals of the comparison matrix and then only calculate additional diagonals as needed. And then also use this approach to possibly remove the need on some comparisons to compare all three adjacent cells as desribed here. Pro: Can turn an algorithm that always takes O(n * m) time and make it so only worst case scenario is that time, best case becomes practically linear, and average case is somewhere between the two. Con: It is an algorithm I've only seen implemented in functional programming languages and I am having a difficult time comprehending how to convert this into Ruby based on how it is described at the site linked to above. Make a C module and do the hard work at the native level in C and just make a Ruby wrapper for it so Ruby can make all the calls to it that it needs. Pro: I have to imagine that evaluating something like this in could be a LOT faster. Con: I have no idea how Rails handles apps with ruby code that has C extensions and it hurts the portability of the app. This is an optimization for after the solving of edit distance, but idea is to store additional combined diffs with the ones produced by each version to make a delta-tree data structure with the most recently made diff as the root node of the tree so getting to any version takes worst case time of O(log n) instead of O(n). Pro: Would make going back to an old version a lot faster. Con: It would mean every new commit, the delta-tree would get a new root node that will cost time to reorganize the delta-tree for an operation that will be carried out a lot more often than going back a version, not to mention the unlikelihood it will be an old version. </optimizations> So are these things worth the effort?

    Read the article

  • Implementation question involving implementing an interface

    - by Vivin Paliath
    I'm writing a set of collection classes for different types of Trees. I'm doing this as a learning exercise and I'm also hoping it turns out to be something useful. I really want to do this the right way and so I've been reading Effective Java and I've also been looking at the way Joshua Bloch implemented the collection classes by looking at the source. I seem to have a fair idea of what is being done, but I still have a few things to sort out. I have a Node<T> interface and an AbstractNode<T> class that implements the Node interface. I then created a GenericNode<T> (a node that can have 0 to n children, and that is part of an n-ary tree) class that extends AbstractNode<T> and implements Node<T>. This part was easy. Next, I created a Tree<T> interface and an AbstractTree<T> class that implements the Tree<T> interface. After that, I started writing a GenericTree<T> class that extends AbstractTree<T> and implements Tree<T>. This is where I started having problems. As far as the design is concerned, a GenericTree<T> can only consist of nodes of type GenericTreeNode<T>. This includes the root. In my Tree<T> interface I have: public interface Tree<T> { void setRoot(Node<T> root); Node<T> getRoot(); List<Node<T>> postOrder(); ... rest omitted ... } And, AbstractTree<T> implements this interface: public abstract class AbstractTree<T> implements Tree<T> { protected Node<T> root; protected AbstractTree() { } protected AbstractTree(Node<T> root) { this.root = root; } public void setRoot(Node<T> root) { this.root = root; } public Node<T> getRoot() { return this.root; } ... rest omitted ... } In GenericTree<T>, I can have: public GenericTree(Node<T> root) { super(root); } But what this means is that you can create a generic tree using any subtype of Node<T>. You can also set the root of a tree to any subtype of Node<T>. I want to be able to restrict the type of the node to the type of the tree that it can represent. To fix this, I can do this: public GenericTree(GenericNode<T> root) { super(root); } However, setRoot still accepts a parameter of type Node<T>. Which means a user can still create a tree with the wrong type of root node. How do I enforce this constraint? The only way I can think of doing is either: Do an instanceof which limits the check to runtime. I'm not a huge fan of this. Remove setRoot from the interface and have the base class implement this method. This means that it is not part of the contract and anyone who wants to make a new type of tree needs to remember to implement this method. Is there a better way? The second question I have concerns the return type of postOrder which is List<Node<T>>. This means that if a user is operating on a GenericTree<T> object and calls postOrder, he or she receives a list that consists of Node<T> objects. This means when iterating through (using a foreach construct) they would have perform an explicit cast to GenericNode<T> if they want to use methods that are only defined in that class. I don't like having to place this burden on the user. What are my options in this case? I can only think of removing the method from the interface and have the subclass implement this method making sure that it returns a list of appropriate subtype of Node<T>. However, this once again removes it from the contract and it's anyone who wants to create a new type of tree has to remember to implement this method. Is there a better way?

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • linux thread synchronization

    - by johnnycrash
    I am new to linux and linux threads. I have spent some time googling to try to understand the differences between all the functions available for thread synchronization. I still have some questions. I have found all of these different types of synchronizations, each with a number of functions for locking, unlocking, testing the lock, etc. gcc atomic operations futexes mutexes spinlocks seqlocks rculocks conditions semaphores My current (but probably flawed) understanding is this: semaphores are process wide, involve the filesystem (virtually I assume), and are probably the slowest. Futexes might be the base locking mechanism used by mutexes, spinlocks, seqlocks, and rculocks. Futexes might be faster than the locking mechanisms that are based on them. Spinlocks dont block and thus avoid context swtiches. However they avoid the context switch at the expense of consuming all the cycles on a CPU until the lock is released (spinning). They should only should be used on multi processor systems for obvious reasons. Never sleep in a spinlock. The seq lock just tells you when you finished your work if a writer changed the data the work was based on. You have to go back and repeat the work in this case. Atomic operations are the fastest synch call, and probably are used in all the above locking mechanisms. You do not want to use atomic operations on all the fields in your shared data. You want to use a lock (mutex, futex, spin, seq, rcu) or a single atomic opertation on a lock flag when you are accessing multiple data fields. My questions go like this: Am I right so far with my assumptions? Does anyone know the cpu cycle cost of the various options? I am adding parallelism to the app so we can get better wall time response at the expense of running fewer app instances per box. Performances is the utmost consideration. I don't want to consume cpu with context switching, spinning, or lots of extra cpu cycles to read and write shared memory. I am absolutely concerned with number of cpu cycles consumed. Which (if any) of the locks prevent interruption of a thread by the scheduler or interrupt...or am I just an idiot and all synchonization mechanisms do this. What kinds of interruption are prevented? Can I block all threads or threads just on the locking thread's CPU? This question stems from my fear of interrupting a thread holding a lock for a very commonly used function. I expect that the scheduler might schedule any number of other workers who will likely run into this function and then block because it was locked. A lot of context switching would be wasted until the thread with the lock gets rescheduled and finishes. I can re-write this function to minimize lock time, but still it is so commonly called I would like to use a lock that prevents interruption...across all processors. I am writing user code...so I get software interrupts, not hardware ones...right? I should stay away from any functions (spin/seq locks) that have the word "irq" in them. Which locks are for writing kernel or driver code and which are meant for user mode? Does anyone think using an atomic operation to have multiple threads move through a linked list is nuts? I am thinking to atomicly change the current item pointer to the next item in the list. If the attempt works, then the thread can safely use the data the current item pointed to before it was moved. Other threads would now be moved along the list. futexes? Any reason to use them instead of mutexes? Is there a better way than using a condition to sleep a thread when there is no work? When using gcc atomic ops, specifically the test_and_set, can I get a performance increase by doing a non atomic test first and then using test_and_set to confirm? *I know this will be case specific, so here is the case. There is a large collection of work items, say thousands. Each work item has a flag that is initialized to 0. When a thread has exclusive access to the work item, the flag will be one. There will be lots of worker threads. Any time a thread is looking for work, they can non atomicly test for 1. If they read a 1, we know for certain that the work is unavailable. If they read a zero, they need to perform the atomic test_and_set to confirm. So if the atomic test_and_set is 500 cpu cycles because it is disabling pipelining, causes cpu's to communicate and L2 caches to flush/fill .... and a simple test is 1 cycle .... then as long as I had a better ratio of 500 to 1 when it came to stumbling upon already completed work items....this would be a win.* I hope to use mutexes or spinlocks to sparilngly protect sections of code that I want only one thread on the SYSTEM (not jsut the CPU) to access at a time. I hope to sparingly use gcc atomic ops to select work and minimize use of mutexes and spinlocks. For instance: a flag in a work item can be checked to see if a thread has worked it (0=no, 1=yes or in progress). A simple test_and_set tells the thread if it has work or needs to move on. I hope to use conditions to wake up threads when there is work. Thanks!

    Read the article

  • Reverse engineering windows mobile live search CellID location awareness protocol (yikes)...

    - by Jean-Charles
    I wasn't sure of how to form the question so I apologize if the title is misleading. Additionally, you may want to get some coffee and take a seat for this one ... It's long. Basically, I'm trying to reverse engineer the protocol used by the Windows Mobile Live Search application to get location based on cellID. Before I go on, I am aware of other open source services (such as OpenCellID) but this is more for the sake of education and a bit for redundancy. According to the packets I captured, a POST request is made to ... mobile.search.live.com/positionlookupservice_1/service.aspx ... with a few specific headers (agent, content-length, etc) and no body. Once this goes through, the server sends back a 100-Continue response. At this point, the application submits this data (I chopped off the packet header): 00 00 00 01 00 00 00 05 55 54 ........UT 46 2d 38 05 65 6e 2d 55 53 05 65 6e 2d 55 53 01 F-8.en-US.en-US. 06 44 65 76 69 63 65 05 64 75 6d 6d 79 01 06 02 .Device.dummy... 50 4c 08 0e 52 65 76 65 72 73 65 47 65 6f 63 6f PL..ReverseGeoco 64 65 01 07 0b 47 50 53 43 68 69 70 49 6e 66 6f de...GPSChipInfo 01 20 06 09 43 65 6c 6c 54 6f 77 65 72 06 03 43 . ..CellTower..C 47 49 08 03 4d 43 43 b6 02 07 03 4d 4e 43 03 34 GI..MCC....MNC.4 31 30 08 03 4c 41 43 cf 36 08 02 43 49 fd 01 00 10..LAC.6..CI... 00 00 00 ... And receives this in response (packet and HTTP response headers chopped): 00 00 00 01 00 00 00 00 01 06 02 50 4c ...........PL 06 08 4c 6f 63 61 6c 69 74 79 06 08 4c 6f 63 61 ..Locality..Loca 74 69 6f 6e 07 03 4c 61 74 09 34 32 2e 33 37 35 tion..Lat.42.375 36 32 31 07 04 4c 6f 6e 67 0a 2d 37 31 2e 31 35 621..Long.-71.15 38 39 33 38 00 07 06 52 61 64 69 75 73 09 32 30 8938...Radius.20 30 30 2e 30 30 30 30 00 42 07 0c 4c 6f 63 61 6c 00.0000.B..Local 69 74 79 4e 61 6d 65 09 57 61 74 65 72 74 6f 77 ityName.Watertow 6e 07 16 41 64 6d 69 6e 69 73 74 72 61 74 69 76 n..Administrativ 65 41 72 65 61 4e 61 6d 65 0d 4d 61 73 73 61 63 eAreaName.Massac 68 75 73 65 74 74 73 07 10 50 6f 73 74 61 6c 43 husetts..PostalC 6f 64 65 4e 75 6d 62 65 72 05 30 32 34 37 32 07 odeNumber.02472. 0b 43 6f 75 6e 74 72 79 4e 61 6d 65 0d 55 6e 69 .CountryName.Uni 74 65 64 20 53 74 61 74 65 73 00 00 00 ted States... Now, here is what I've determined so far: All strings are prepended with one byte that is the decimal equivalent of their length. There seem to be three different casts that are used throughout the request and response. They show up as one byte before the length byte. I've concluded that the three types map out as follows: 0x06 - parent element (subsequent values are children, closed with 0x00) 0x07 - string 0x08 - int? Based on these determinations, here is what the request and response look like in a more readable manner (values surrounded by brackets denote length and values surrounded by parenthesis denote a cast): \0x00\0x00\0x00\0x01\0x00\0x00\0x00 [5]UTF-8 [5]en-US [5]en-US \0x01 [6]Device [5]dummy \0x01 (6)[2]PL (8)[14]ReverseGeocode\0x01 (7)[11]GPSChipInfo[1]\0x20 (6)[9]CellTower (6)[3]CGI (8)[3]MCC\0xB6\0x02 //310 (7)[3]MNC[3]410 //410 (8)[3]LAC\0xCF\0x36 //6991 (8)[2]CI\0xFD\0x01 //259 \0x00 \0x00 \0x00 \0x00 and.. \0x00\0x00\0x00\0x01\0x00\0x00\0x00 \0x00\0x01 (6)[2]PL (6)[8]Locality (6)[8]Location (7)[3]Lat[9]42.375621 (7)[4]Long[10]-71.158938 \0x00 (7)[6]Radius[9]2000.0000 \0x00 \0x42 //"B" ... Has to do with GSM (7)[12]LocalityName[9]Watertown (7)[22]AdministrativeAreaName[13]Massachusetts (7)[16]PostalCodeNumber[5]02472 (7)[11]CountryName[13]United States \0x00 \0x00\0x00 My analysis seems to work out pretty well except for a few things: The 0x01s throughout confuse me ... At first I thought they were some sort of base level element terminators but I'm not certain. I'm not sure the 7-byte header is, in fact, a seven byte header. I wonder if it's maybe 4 bytes and that the three remaining 0x00s are of some other significance. The trailing 0x00s. Why is it that there is only one on the request but two on the response? The type 8 cast mentioned above ... I can't seem to figure out how those values are being encoded. I added comments to those lines with what the values should correspond to. Any advice on these four points will be greatly appreciated. And yes, these packets were captured in Watertown, MA. :)

    Read the article

  • C# Reading and Writing a Char[] to and from a Byte[] - Updated with Solution

    - by Simon G
    Hi, I have a byte array of around 10,000 bytes which is basically a blob from delphi that contains char, string, double and arrays of various types. This need to be read in and updated via C#. I've created a very basic reader that gets the byte array from the db and converts the bytes to the relevant object type when accessing the property which works fine. My problem is when I try to write to a specific char[] item, it doesn't seem to update the byte array. I've created the following extensions for reading and writing: public static class CharExtension { public static byte ToByte( this char c ) { return Convert.ToByte( c ); } public static byte ToByte( this char c, int position, byte[] blob ) { byte b = c.ToByte(); blob[position] = b; return b; } } public static class CharArrayExtension { public static byte[] ToByteArray( this char[] c ) { byte[] b = new byte[c.Length]; for ( int i = 1; i < c.Length; i++ ) { b[i] = c[i].ToByte(); } return b; } public static byte[] ToByteArray( this char[] c, int positon, int length, byte[] blob ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, positon, length ); return b; } } public static class ByteExtension { public static char ToChar( this byte[] b, int position ) { return Convert.ToChar( b[position] ); } } public static class ByteArrayExtension { public static char[] ToCharArray( this byte[] b, int position, int length ) { char[] c = new char[length]; for ( int i = 0; i < length; i++ ) { c[i] = b.ToChar( position ); position += 1; } return c; } } to read and write chars and char arrays my code looks like: Byte[] _Blob; // set from a db field public char ubin { get { return _tariffBlob.ToChar( 14 ); } set { value.ToByte( 14, _Blob ); } } public char[] usercaplas { get { return _tariffBlob.ToCharArray( 2035, 10 ); } set { value.ToByteArray( 2035, 10, _Blob ); } } So to write to the objects I can do: ubin = 'C'; // this will update the byte[] usercaplas = new char[10] { 'A', 'B', etc. }; // this will update the byte[] usercaplas[3] = 'C'; // this does not update the byte[] I know the reason is that the setter property is not being called but I want to know is there a way around this using code similar to what I already have? I know a possible solution is to use a private variable called _usercaplas that I set and update as needed however as the byte array is nearly 10,000 bytes in length the class is already long and I would like a simpler approach as to reduce the overall code length and complexity. Thank Solution Here's my solution should anyone want it. If you have a better way of doing then let me know please. First I created a new class for the array: public class CharArrayList : ArrayList { char[] arr; private byte[] blob; private int length = 0; private int position = 0; public CharArrayList( byte[] blob, int position, int length ) { this.blob = blob; this.length = length; this.position = position; PopulateInternalArray(); SetArray(); } private void PopulateInternalArray() { arr = blob.ToCharArray( position, length ); } private void SetArray() { foreach ( char c in arr ) { this.Add( c ); } } private void UpdateInternalArray() { this.Clear(); SetArray(); } public char this[int i] { get { return arr[i]; } set { arr[i] = value; UpdateInternalArray(); } } } Then I created a couple of extension methods to help with converting to a byte[] public static byte[] ToByteArray( this CharArrayList c ) { byte[] b = new byte[c.Count]; for ( int i = 0; i < c.Count; i++ ) { b[i] = Convert.ToChar( c[i] ).ToByte(); } return b; } public static byte[] ToByteArray( this CharArrayList c, byte[] blob, int position, int length ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, position, length ); return b; } So to read and write to the object: private CharArrayList _usercaplass; public CharArrayList usercaplas { get { if ( _usercaplass == null ) _usercaplass = new CharArrayList( _tariffBlob, 2035, 100 ); return _usercaplass; } set { _usercaplass = value; _usercaplass.ToByteArray( _tariffBlob, 2035, 100 ); } } As mentioned before its not an ideal solutions as I have to have private variables and extra code in the setter but I couldnt see a way around it.

    Read the article

  • Edit Contact code worked in 1.6 but doesn't work on Droid 2.1?

    - by user225405
    Hi All, I had some fairly simple code in my app to invoke Edit Contact activity on a known good contact index that worked in Android 1.6 but is broken for me now in Android 2.1 on the Droid. I built a sample activity/app 'EdCon' to show this: package com.jbh; import android.app.Activity; import android.content.Intent; import android.net.Uri; import android.os.Bundle; public class EdCon extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); // Build an intent to edit a known good contact index Intent i; i = new Intent(Intent.ACTION_EDIT); i.setData(Uri.parse("content://contacts/people/10")); startActivity(i); } } When I run this on my G1 running 1.6 it works as expected i.e. brings up the Edit Contact screen for the known index and then I can hit BACK to return to "Hello World, EdCon". When I run this on the Droid under 2.1 I get the following: 05-07 15:35:57.787: INFO/ActivityManager(1013): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.jbh/.EdCon } 05-07 15:35:57.826: DEBUG/AndroidRuntime(13780): Shutting down VM 05-07 15:35:57.826: DEBUG/dalvikvm(13780): DestroyJavaVM waiting for non-daemon threads to exit 05-07 15:35:57.928: DEBUG/dalvikvm(13780): DestroyJavaVM shutting VM down 05-07 15:35:57.928: DEBUG/dalvikvm(13780): HeapWorker thread shutting down 05-07 15:35:57.928: DEBUG/dalvikvm(13780): HeapWorker thread has shut down 05-07 15:35:57.928: DEBUG/jdwp(13780): JDWP shutting down net... 05-07 15:35:57.928: DEBUG/jdwp(13780): Got wake-up signal, bailing out of select 05-07 15:35:57.928: INFO/dalvikvm(13780): Debugger has detached; object registry had 1 entries 05-07 15:35:57.928: DEBUG/dalvikvm(13780): VM cleaning up 05-07 15:35:57.935: INFO/ActivityManager(1013): Start proc com.jbh for activity com.jbh/.EdCon: pid=13802 uid=10052 gids={1015} 05-07 15:35:57.967: ERROR/AndroidRuntime(13780): ERROR: thread attach failed 05-07 15:35:58.053: INFO/ActivityThread(13792): Publishing provider com.android.vending.SuggestionsProvider: com.android.vending.SuggestionsProvider 05-07 15:35:58.154: INFO/dalvikvm(13802): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=38) 05-07 15:35:58.209: DEBUG/dalvikvm(13780): LinearAlloc 0x0 used 639500 of 5242880 (12%) 05-07 15:35:58.365: INFO/dalvikvm(13802): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=18) 05-07 15:35:58.639: INFO/ActivityManager(1013): Starting activity: Intent { act=android.intent.action.EDIT dat=content://contacts/people/10 cmp=com.android.contacts/.ui.EditContactActivity } 05-07 15:35:58.975: DEBUG/dalvikvm(13137): GC freed 2902 objects / 166768 bytes in 61ms 05-07 15:35:59.100: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.run(): Syncing local DB with package manager... 05-07 15:35:59.100: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.syncLocalDbWithPackageManager(): No INSTALLING or UNINSTALLING assets. 05-07 15:35:59.115: INFO/ActivityManager(1013): Displayed activity com.android.contacts/.ui.EditContactActivity: 387 ms (total 1296 ms) 05-07 15:35:59.185: DEBUG/Sources(13137): Creating external source for type=com.facebook.auth.login, packageName=com.facebook.katana 05-07 15:35:59.225: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.run(): Syncing done. 05-07 15:35:59.232: WARN/dalvikvm(13137): threadid=27: thread exiting with uncaught exception (group=0x4001b180) 05-07 15:35:59.232: ERROR/AndroidRuntime(13137): Uncaught handler: thread AsyncTask #1 exiting due to uncaught exception 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): java.lang.RuntimeException: An error occured while executing doInBackground() 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.os.AsyncTask$3.done(AsyncTask.java:200) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:273) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask.setException(FutureTask.java:124) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:307) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask.run(FutureTask.java:137) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.lang.Thread.run(Thread.java:1096) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): Caused by: android.database.sqlite.SQLiteException: no such column: raw_contact_id: , while compiling: SELECT account_name, account_type, sourceid, version, dirty, data_id, res_package, mimetype, data1, data2, data3, data4, data5, data6, data7, data8, data9, data10, data11, data12, data13, data14, data15, data_sync1, data_sync2, data_sync3, data_sync4, _id, is_primary, is_super_primary, data_version, group_sourceid, sync1, sync2, sync3, sync4, deleted, contact_id, starred, is_restricted FROM contact_entities_view WHERE (1) AND (raw_contact_id=10) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.native_compile(Native Method) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.compile(SQLiteProgram.java:110) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.(SQLiteProgram.java:59) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteQuery.(SQLiteQuery.java:49) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteDirectCursorDriver.query(SQLiteDirectCursorDriver.java:49) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteDatabase.rawQueryWithFactory(SQLiteDatabase.java:1221) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteQueryBuilder.query(SQLiteQueryBuilder.java:316) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.query(ContactsProvider2.java:3850) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.query(ContactsProvider2.java:3840) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2$RawContactsEntityIterator.(ContactsProvider2.java:4498) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.queryEntities(ContactsProvider2.java:4751) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentProvider$Transport.queryEntities(ContentProvider.java:140) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentProviderClient.queryEntities(ContentProviderClient.java:98) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentResolver.queryEntities(ContentResolver.java:296) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.model.EntitySet.fromQuery(EntitySet.java:72) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.ui.EditContactActivity$QueryEntitiesTask.doInBackground(EditContactActivity.java:191) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.ui.EditContactActivity$QueryEntitiesTask.doInBackground(EditContactActivity.java:154) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.util.WeakAsyncTask.doInBackground(WeakAsyncTask.java:45) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.os.AsyncTask$2.call(AsyncTask.java:185) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): ... 4 more 05-07 15:35:59.303: INFO/Process(1013): Sending signal. PID: 13137 SIG: 3 05-07 15:35:59.303: INFO/dalvikvm(13137): threadid=7: reacting to signal 3 05-07 15:35:59.303: ERROR/dalvikvm(13137): Unable to open stack trace file '/data/anr/traces.txt': Permission denied 05-07 15:35:59.506: INFO/DumpStateReceiver(1013): Added state dump to 1 crashes 05-07 15:36:07.053: DEBUG/dalvikvm(12901): GC freed 389 objects / 25056 bytes in 145ms 05-07 15:36:17.287: DEBUG/dalvikvm(11649): GC freed 154 objects / 6816 bytes in 136ms 05-07 15:36:22.365: DEBUG/dalvikvm(13574): GC freed 348 objects / 67848 bytes in 112ms 05-07 15:36:27.451: DEBUG/dalvikvm(11836): GC freed 267 objects / 17432 bytes in 65ms 05-07 15:36:32.553: DEBUG/dalvikvm(12757): GC freed 1888 objects / 92440 bytes in 67ms 05-07 15:36:38.803: INFO/power(1013): * set_screen_state 0 05-07 15:36:38.813: DEBUG/SurfaceFlinger(1013): About to give-up screen, flinger = 0x114c30 05-07 15:36:38.826: DEBUG/Sensors(1013): using accelerometer (name=accelerometer) 05-07 15:36:38.834: DEBUG/PhoneWindow(13137): couldn't save which view has focus because the focused view android.widget.ScrollView@44883558 has no id. 05-07 15:36:38.865: DEBUG/WifiService(1013): ACTION_SCREEN_OFF 05-07 15:36:38.889: DEBUG/WifiService(1013): setting ACTION_DEVICE_IDLE timer for 900000ms 05-07 15:36:44.107: DEBUG/dalvikvm(1013): GC freed 7351 objects / 521440 bytes in 130ms 05-07 15:36:49.373: DEBUG/dalvikvm(13553): GC freed 321 objects / 12056 bytes in 102ms The no such column: raw_contact_id: looks like the issue but I'm not sure how or why that would happen or what it means. Any help appreciated! [email protected]

    Read the article

  • Pointers to Derived Class Objects Losing vfptr

    - by duckworthd
    To begin, I am trying to write a run-of-the-mill, simple Ray Tracer. In my Ray Tracer, I have multiple types of geometries in the world, all derived from a base class called "SceneObject". I've included the header for it here. /** Interface for all objects that will appear in a scene */ class SceneObject { public: mat4 M, M_inv; Color c; SceneObject(); ~SceneObject(); /** The transformation matrix to be applied to all points of this object. Identity leaves the object in world frame. */ void setMatrix(mat4 M); void setMatrix(MatrixStack mStack); void getMatrix(mat4& M); /** The color of the object */ void setColor(Color c); void getColor(Color& c); /** Alter one portion of the color, leaving the rest as they were. */ void setDiffuse(vec3 rgb); void setSpecular(vec3 rgb); void setEmission(vec3 rgb); void setAmbient(vec3 rgb); void setShininess(double s); /** Fills 'inter' with information regarding an intersection between this object and 'ray'. Ray should be in world frame. */ virtual void intersect(Intersection& inter, Ray ray) = 0; /** Returns a copy of this SceneObject */ virtual SceneObject* clone() = 0; /** Print information regarding this SceneObject for debugging */ virtual void print() = 0; }; As you can see, I've included a couple virtual functions to be implemented elsewhere. In this case, I have only two derived class -- Sphere and Triangle, both of which implement the missing member functions. Finally, I have a Parser class, which is full of static methods that do the actual "Ray Tracing" part. Here's a couple snippets for relevant portions void Parser::trace(Camera cam, Scene scene, string outputFile, int maxDepth) { int width = cam.getNumXPixels(); int height = cam.getNumYPixels(); vector<vector<vec3>> colors; colors.clear(); for (int i = 0; i< width; i++) { vector<vec3> ys; for (int j = 0; j<height; j++) { Intersection intrsct; Ray ray; cam.getRay(ray, i, j); vec3 color; printf("Obtaining color for Ray[%d,%d]\n", i,j); getColor(color, scene, ray, maxDepth); ys.push_back(color); } colors.push_back(ys); } printImage(colors, width, height, outputFile); } void Parser::getColor(vec3& color, Scene scene, Ray ray, int numBounces) { Intersection inter; scene.intersect(inter,ray); if(inter.isIntersecting()){ Color c; inter.getColor(c); c.getAmbient(color); } else { color = vec3(0,0,0); } } Right now, I've forgone the true Ray Tracing part and instead simply return the color of the first object hit, if any. As you have no doubt noticed, the only way the computer knows that a ray has intersected an object is through Scene.intersect(), which I also include. void Scene::intersect(Intersection& i, Ray r) { Intersection result; result.setDistance(numeric_limits<double>::infinity()); result.setIsIntersecting(false); double oldDist; result.getDistance(oldDist); /* Cycle through all objects, making result the closest one */ for(int ind=0; ind<objects.size(); ind++){ SceneObject* thisObj = objects[ind]; Intersection betterIntersect; thisObj->intersect(betterIntersect, r); double newDist; betterIntersect.getDistance(newDist); if (newDist < oldDist){ result = betterIntersect; oldDist = newDist; } } i = result; } Alright, now for the problem. I begin by creating a scene and filling it with objects outside of the Parser::trace() method. Now for some odd reason, I cast Ray for i=j=0 and everything works wonderfully. However, by the time the second ray is cast all of the objects stored in my Scene no longer recognize their vfptr's! I stepped through the code with a debugger and found that the information to all the vfptr's are lost somewhere between the end of getColor() and the continuation of the loop. However, if I change the arguments of getColor() to use a Scene& instead of a Scene, then no loss occurs. What crazy voodoo is this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • InputDispatcher Error

    - by StarDust
    INFO/ActivityManager(68): Process com.example (pid 390) has died. ERROR/InputDispatcher(68): channel '406ed580 com.example/com.example.afeTest (server)' ~ Consumer closed input channel or an error occurred. events=0x8 ERROR/InputDispatcher(68): channel '406ed580 com.example/com.example.afeTest (server)' ~ Channel is unrecoverably broken and will be disposed! ERROR/InputDispatcher(68): Received spurious receive callback for unknown input channel. fd=165, events=0x8 Can anyone tell what may be the reason behind this error? I've ported a native code on the Android-ndk. One thing I noticed regarding fd (that may be some reason :S) My code uses fd_sets which was defined in winsock2.h But I didn't find fd_sets defined in android-ndk. So I had included "select.h" where fd_set is a typedef in the android-ndk: typedef __kernel_fd_set fd_set; Here is the log cat: 04-06 11:15:32.405: INFO/DEBUG(31): *** *** *** *** *** *** *** *** *** *** *** *** *** *** *** *** 04-06 11:15:32.405: INFO/DEBUG(31): Build fingerprint: 'generic/sdk/generic:2.3.3/GRI34/101070:eng/test-keys' 04-06 11:15:32.415: INFO/DEBUG(31): pid: 335, tid: 348 >>> com.example <<< 04-06 11:15:32.426: INFO/DEBUG(31): signal 11 (SIGSEGV), code 1 (SEGV_MAPERR), fault addr deadbaad 04-06 11:15:32.426: INFO/DEBUG(31): r0 deadbaad r1 0000000c r2 00000027 r3 00000000 04-06 11:15:32.445: INFO/DEBUG(31): r4 00000080 r5 afd46668 r6 0000a000 r7 00000078 04-06 11:15:32.445: INFO/DEBUG(31): r8 804ab00d r9 002a9778 10 00100000 fp 00000001 04-06 11:15:32.445: INFO/DEBUG(31): ip ffffffff sp 44295d10 lr afd19375 pc afd15ef0 cpsr 00000030 04-06 11:15:32.756: INFO/DEBUG(31): #00 pc 00015ef0 /system/lib/libc.so 04-06 11:15:32.756: INFO/DEBUG(31): #01 pc 00013852 /system/lib/libc.so 04-06 11:15:32.767: INFO/DEBUG(31): code around pc: 04-06 11:15:32.785: INFO/DEBUG(31): afd15ed0 68241c23 d1fb2c00 68dae027 d0042a00 04-06 11:15:32.785: INFO/DEBUG(31): afd15ee0 20014d18 6028447d 48174790 24802227 04-06 11:15:32.785: INFO/DEBUG(31): afd15ef0 f7f57002 2106eb56 ec92f7f6 0563aa01 04-06 11:15:32.796: INFO/DEBUG(31): afd15f00 60932100 91016051 1c112006 e818f7f6 04-06 11:15:32.807: INFO/DEBUG(31): afd15f10 2200a905 f7f62002 f7f5e824 2106eb42 04-06 11:15:32.815: INFO/DEBUG(31): code around lr: 04-06 11:15:32.815: INFO/DEBUG(31): afd19354 b0834a0d 589c447b 26009001 686768a5 04-06 11:15:32.825: INFO/DEBUG(31): afd19364 220ce008 2b005eab 1c28d003 47889901 04-06 11:15:32.836: INFO/DEBUG(31): afd19374 35544306 d5f43f01 2c006824 b003d1ee 04-06 11:15:32.836: INFO/DEBUG(31): afd19384 bdf01c30 000281a8 ffffff88 1c0fb5f0 04-06 11:15:32.846: INFO/DEBUG(31): afd19394 43551c3d a904b087 1c16ac01 604d9004 04-06 11:15:32.856: INFO/DEBUG(31): stack: 04-06 11:15:32.856: INFO/DEBUG(31): 44295cd0 00000408 04-06 11:15:32.867: INFO/DEBUG(31): 44295cd4 afd18407 /system/lib/libc.so 04-06 11:15:32.875: INFO/DEBUG(31): 44295cd8 afd4270c /system/lib/libc.so 04-06 11:15:32.875: INFO/DEBUG(31): 44295cdc afd426b8 /system/lib/libc.so 04-06 11:15:32.885: INFO/DEBUG(31): 44295ce0 00000000 04-06 11:15:32.896: INFO/DEBUG(31): 44295ce4 afd19375 /system/lib/libc.so 04-06 11:15:32.896: INFO/DEBUG(31): 44295ce8 804ab00d /data/data/com.example/lib/libAFE.so 04-06 11:15:32.896: INFO/DEBUG(31): 44295cec afd183d9 /system/lib/libc.so 04-06 11:15:32.906: INFO/DEBUG(31): 44295cf0 00000078 04-06 11:15:32.906: INFO/DEBUG(31): 44295cf4 00000000 04-06 11:15:32.906: INFO/DEBUG(31): 44295cf8 afd46668 04-06 11:15:32.906: INFO/DEBUG(31): 44295cfc 0000a000 [heap] 04-06 11:15:32.916: INFO/DEBUG(31): 44295d00 00000078 04-06 11:15:32.927: INFO/DEBUG(31): 44295d04 afd18677 /system/lib/libc.so 04-06 11:15:32.927: INFO/DEBUG(31): 44295d08 df002777 04-06 11:15:32.945: INFO/DEBUG(31): 44295d0c e3a070ad 04-06 11:15:32.945: INFO/DEBUG(31): #00 44295d10 002c43a0 [heap] 04-06 11:15:32.945: INFO/DEBUG(31): 44295d14 002a9900 [heap] 04-06 11:15:32.956: INFO/DEBUG(31): 44295d18 afd46608 04-06 11:15:32.966: INFO/DEBUG(31): 44295d1c afd11010 /system/lib/libc.so 04-06 11:15:32.976: INFO/DEBUG(31): 44295d20 002c4298 [heap] 04-06 11:15:32.976: INFO/DEBUG(31): 44295d24 fffffbdf 04-06 11:15:33.006: INFO/DEBUG(31): 44295d28 000000da 04-06 11:15:33.006: INFO/DEBUG(31): 44295d2c afd46450 04-06 11:15:33.006: INFO/DEBUG(31): 44295d30 000001b4 04-06 11:15:33.026: INFO/DEBUG(31): 44295d34 afd13857 /system/lib/libc.so 04-06 11:15:33.026: INFO/DEBUG(31): #01 44295d38 afd46450 04-06 11:15:33.035: INFO/DEBUG(31): 44295d3c afd13857 /system/lib/libc.so 04-06 11:15:33.056: INFO/DEBUG(31): 44295d40 804ab00d /data/data/com.example/lib/libAFE.so 04-06 11:15:33.056: INFO/DEBUG(31): 44295d44 44295e8c 04-06 11:15:33.056: INFO/DEBUG(31): 44295d48 804ab00d /data/data/com.example/lib/libAFE.so 04-06 11:15:33.056: INFO/DEBUG(31): 44295d4c 804bfec3 /data/data/com.example/lib/libAFE.so 04-06 11:15:33.056: INFO/DEBUG(31): 44295d50 002c43a0 [heap] 04-06 11:15:33.066: INFO/DEBUG(31): 44295d54 44295e8c 04-06 11:15:33.066: INFO/DEBUG(31): 44295d58 804ab00d /data/data/com.example/lib/libAFE.so 04-06 11:15:33.076: INFO/DEBUG(31): 44295d5c 002a9778 [heap] 04-06 11:15:33.085: INFO/DEBUG(31): 44295d60 00000078 04-06 11:15:33.085: INFO/DEBUG(31): 44295d64 afd14769 /system/lib/libc.so 04-06 11:15:33.085: INFO/DEBUG(31): 44295d68 44295e8c 04-06 11:15:33.085: INFO/DEBUG(31): 44295d6c 805d9763 /data/data/com.example/lib/libAFE.so 04-06 11:15:33.085: INFO/DEBUG(31): 44295d70 44295e8c 04-06 11:15:33.085: INFO/DEBUG(31): 44295d74 8051dc35 /data/data/com.example/lib/libAFE.so 04-06 11:15:33.085: INFO/DEBUG(31): 44295d78 0000003a 04-06 11:15:33.085: INFO/DEBUG(31): 44295d7c 002a9900 [heap] 04-06 11:15:37.126: DEBUG/Zygote(33): Process 335 terminated by signal (11) 04-06 11:15:37.146: INFO/ActivityManager(68): Process com.example (pid 335) has died. 04-06 11:15:37.178: ERROR/InputDispatcher(68): channel '406f03a0 com.example/com.example.afeTest (server)' ~ Consumer closed input channel or an error occurred. events=0x8 04-06 11:15:37.178: ERROR/InputDispatcher(68): channel '406f03a0 com.example/com.example.afeTest (server)' ~ Channel is unrecoverably broken and will be disposed! 04-06 11:15:37.185: INFO/BootReceiver(68): Copying /data/tombstones/tombstone_09 to DropBox (SYSTEM_TOMBSTONE) 04-06 11:15:37.576: DEBUG/dalvikvm(68): GC_FOR_MALLOC freed 266K, 47% free 4404K/8199K, external 3520K/3903K, paused 306ms 04-06 11:15:37.835: DEBUG/dalvikvm(68): GC_FOR_MALLOC freed 203K, 47% free 4457K/8391K, external 3520K/3903K, paused 120ms 04-06 11:15:37.886: INFO/WindowManager(68): WIN DEATH: Window{406f03a0 com.example/com.example.afeTest paused=false} 04-06 11:15:38.095: DEBUG/dalvikvm(68): GC_FOR_MALLOC freed 67K, 47% free 4518K/8391K, external 3511K/3903K, paused 94ms 04-06 11:15:38.095: INFO/dalvikvm-heap(68): Grow heap (frag case) to 10.575MB for 196628-byte allocation 04-06 11:15:38.126: DEBUG/dalvikvm(126): GC_EXPLICIT freed 110K, 51% free 2903K/5895K, external 4701K/5293K, paused 2443ms 04-06 11:15:38.217: DEBUG/dalvikvm(68): GC_FOR_MALLOC freed 1K, 46% free 4708K/8647K, external 3511K/3903K, paused 96ms 04-06 11:15:38.225: INFO/WindowManager(68): WIN DEATH: Window{406f72f8 com.example/com.example.afeTest paused=false} 04-06 11:15:38.405: DEBUG/dalvikvm(68): GC_FOR_MALLOC freed 492K, 50% free 4345K/8647K, external 3511K/3903K, paused 96ms 04-06 11:15:38.485: ERROR/InputDispatcher(68): Received spurious receive callback for unknown input channel. fd=164, events=0x8

    Read the article

  • asp .net MVC 2.0 Validation

    - by ANDyW
    Hi I’m trying to do some validation in asp .net MVC 2.0 for my application. I want to have some nice client side validation. Validation should be done most time on model side with DataAnnotations with custom attributes( like CompareTo, StringLenght, MinPasswordLenght (from Membership.MinimumumpassworkdLenght value). For that purpose I tried to use xval with jquery.validation. Some specific thing is that most of forms will be working with ajax and most problems are when I want to validate form with ajax. Here is link for sample project http://www.sendspace.com/file/m9gl54 . I got two forms as controls ValidFormControl1.ascx, ValidFormControl2.ascx <% using (Ajax.BeginForm("CreateValidForm", "Test", new AjaxOptions { HttpMethod = "Post" })) {%> <div id="validationSummary1"> <%= Html.ValidationSummary(true)%> </div> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Name)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Name)%> <%= Html.ValidationMessageFor(model => model.Name)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Email)%> <%= Html.ValidationMessageFor(model => model.Email)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Password)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Password)%> <%= Html.ValidationMessageFor(model => model.Password)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.ConfirmPassword)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.ConfirmPassword)%> <%= Html.ValidationMessageFor(model => model.ConfirmPassword)%> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> <% } %> <%= Html.ClientSideValidation<ValidModel>() .UseValidationSummary("validationSummary1", "Please fix the following problems:") %> Both look same the difference is only validation summaryID (validationSummary1, validationSummary2). Both controls are rendered on one page : Form2 <%Html.RenderPartial("~/Views/Test/ValidFormControl2.ascx", null); %> Form1 <%Html.RenderPartial("~/Views/Test/ValidFormControl.ascx", null); %> Validation property First problem, when we have two controls with same type to validate it don’t work becosue html elements are rendered by field name ( so we have two element with same name “Password” ). Only first form will be validated by client side. The worst thing is that even if we have different types and their fields name is same validation won’t work too ( this thing is what I need to repair it will be stupid to name some unique properites for validation ). Is there any solution for this ? Custom attributes validation Next thing custom attributes validation ( All those error are when I use Ajax for on normal form validation is working without problem. ): CompareTo - Simple compare to that is done in mvc template for account model ( class attribute saying with two property will be compared ) , and it wasn’t show on page. To do it I created own CachingRulesProvider with compareRule and my Attribute. Maybe there is more easy way to do it? StringLenght with minimum and maximum value, I won’t describe how I done it but is there any easy whey to do it? Validation summary When I have two two control on page all summary validation information goes to first control validation summary element, even xval generated script say that elementID are different for summary. Any one know how to repair it? Validation Information Is there any option to turn on messages on place where is Html.ValidationMessageFor(model = model.ConfirmPassword). Becsoue for me it isn’t show up. I would like to have summary and near field information too not only red border. Any one know how to do it? Ajax submit Anyone know how to do easy without massive code in javascript to do submit via javascript. This will be used to change input submit to href element (a). Both look same the difference is only validation summaryID

    Read the article

  • C++0x rvalue references - lvalues-rvalue binding

    - by Doug
    This is a follow-on question to http://stackoverflow.com/questions/2748866/c0x-rvalue-references-and-temporaries In the previous question, I asked how this code should work: void f(const std::string &); //less efficient void f(std::string &&); //more efficient void g(const char * arg) { f(arg); } It seems that the move overload should probably be called because of the implicit temporary, and this happens in GCC but not MSVC (or the EDG front-end used in MSVC's Intellisense). What about this code? void f(std::string &&); //NB: No const string & overload supplied void g1(const char * arg) { f(arg); } void g2(const std::string & arg) { f(arg); } It seems that, based on the answers to my previous question that function g1 is legal (and is accepted by GCC 4.3-4.5, but not by MSVC). However, GCC and MSVC both reject g2 because of clause 13.3.3.1.4/3, which prohibits lvalues from binding to rvalue ref arguments. I understand the rationale behind this - it is explained in N2831 "Fixing a safety problem with rvalue references". I also think that GCC is probably implementing this clause as intended by the authors of that paper, because the original patch to GCC was written by one of the authors (Doug Gregor). However, I don't this is quite intuitive. To me, (a) a const string & is conceptually closer to a string && than a const char *, and (b) the compiler could create a temporary string in g2, as if it were written like this: void g2(const std::string & arg) { f(std::string(arg)); } Indeed, sometimes the copy constructor is considered to be an implicit conversion operator. Syntactically, this is suggested by the form of a copy constructor, and the standard even mentions this specifically in clause 13.3.3.1.2/4, where the copy constructor for derived-base conversions is given a higher conversion rank than other implicit conversions: A conversion of an expression of class type to the same class type is given Exact Match rank, and a conversion of an expression of class type to a base class of that type is given Conversion rank, in spite of the fact that a copy/move constructor (i.e., a user-defined conversion function) is called for those cases. (I assume this is used when passing a derived class to a function like void h(Base), which takes a base class by value.) Motivation My motivation for asking this is something like the question asked in http://stackoverflow.com/questions/2696156/how-to-reduce-redundant-code-when-adding-new-c0x-rvalue-reference-operator-over ("How to reduce redundant code when adding new c++0x rvalue reference operator overloads"). If you have a function that accepts a number of potentially-moveable arguments, and would move them if it can (e.g. a factory function/constructor: Object create_object(string, vector<string>, string) or the like), and want to move or copy each argument as appropriate, you quickly start writing a lot of code. If the argument types are movable, then one could just write one version that accepts the arguments by value, as above. But if the arguments are (legacy) non-movable-but-swappable classes a la C++03, and you can't change them, then writing rvalue reference overloads is more efficient. So if lvalues did bind to rvalues via an implicit copy, then you could write just one overload like create_object(legacy_string &&, legacy_vector<legacy_string> &&, legacy_string &&) and it would more or less work like providing all the combinations of rvalue/lvalue reference overloads - actual arguments that were lvalues would get copied and then bound to the arguments, actual arguments that were rvalues would get directly bound. Questions My questions are then: Is this a valid interpretation of the standard? It seems that it's not the conventional or intended one, at any rate. Does it make intuitive sense? Is there a problem with this idea that I"m not seeing? It seems like you could get copies being quietly created when that's not exactly expected, but that's the status quo in places in C++03 anyway. Also, it would make some overloads viable when they're currently not, but I don't see it being a problem in practice. Is this a significant enough improvement that it would be worth making e.g. an experimental patch for GCC?

    Read the article

  • Condition Variable in Shared Memory - is this code POSIX-conformant?

    - by GrahamS
    We've been trying to use a mutex and condition variable to synchronise access to named shared memory on a LynuxWorks LynxOS-SE system (POSIX-conformant). One shared memory block is called "/sync" and contains the mutex and condition variable, the other is "/data" and contains the actual data we are syncing access to. We're seeing failures from pthread_cond_signal() if both processes don't perform the mmap() calls in exactly the same order, or if one process mmaps in some other piece of shared memory before it mmaps the sync memory. This example code is about as short as I can make it: #include <sys/types.h> #include <sys/stat.h> #include <sys/mman.h> #include <sys/file.h> #include <stdlib.h> #include <pthread.h> #include <errno.h> #include <iostream> #include <string> using namespace std; static const string shm_name_sync("/sync"); static const string shm_name_data("/data"); struct shared_memory_sync { pthread_mutex_t mutex; pthread_cond_t condition; }; struct shared_memory_data { int a; int b; }; //Create 2 shared memory objects // - sync contains 2 shared synchronisation objects (mutex and condition) // - data not important void create() { // Create and map 'sync' shared memory int fd_sync = shm_open(shm_name_sync.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_sync, sizeof(shared_memory_sync)); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // init the cond and mutex pthread_condattr_t cond_attr; pthread_condattr_init(&cond_attr); pthread_condattr_setpshared(&cond_attr, PTHREAD_PROCESS_SHARED); pthread_cond_init(&(p_sync->condition), &cond_attr); pthread_condattr_destroy(&cond_attr); pthread_mutexattr_t m_attr; pthread_mutexattr_init(&m_attr); pthread_mutexattr_setpshared(&m_attr, PTHREAD_PROCESS_SHARED); pthread_mutex_init(&(p_sync->mutex), &m_attr); pthread_mutexattr_destroy(&m_attr); // Create the 'data' shared memory int fd_data = shm_open(shm_name_data.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_data, sizeof(shared_memory_data)); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); // Run the second process while it sleeps here. sleep(10); int res = pthread_cond_signal(&(p_sync->condition)); assert(res==0); // <--- !!!THIS ASSERT WILL FAIL ON LYNXOS!!! munmap(addr_sync, sizeof(shared_memory_sync)); shm_unlink(shm_name_sync.c_str()); munmap(addr_data, sizeof(shared_memory_data)); shm_unlink(shm_name_data.c_str()); } //Open the same 2 shared memory objects but in reverse order // - data // - sync void open() { sleep(2); int fd_data = shm_open(shm_name_data.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); int fd_sync = shm_open(shm_name_sync.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // Wait on the condvar pthread_mutex_lock(&(p_sync->mutex)); pthread_cond_wait(&(p_sync->condition), &(p_sync->mutex)); pthread_mutex_unlock(&(p_sync->mutex)); munmap(addr_sync, sizeof(shared_memory_sync)); munmap(addr_data, sizeof(shared_memory_data)); } int main(int argc, char** argv) { if(argc>1) { open(); } else { create(); } return (0); } Run this program with no args, then another copy with args, and the first one will fail at the assert checking the pthread_cond_signal(). But change the open() function to mmap() the "/sync" memory first and it will all work fine. This seems like a major bug in LynxOS but LynuxWorks claim that using mutex and condition variable in this way is not covered by the POSIX standard, so they are not interested. Can anyone determine if this code does violate POSIX? Or does anyone have any convincing documentation that it is POSIX compliant?

    Read the article

< Previous Page | 482 483 484 485 486 487 488 489 490 491 492 493  | Next Page >