Search Results

Search found 90049 results on 3602 pages for 'open file dialog'.

Page 49/3602 | < Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • open source project requirements

    - by skidding
    I know it's a very common question, but I don't see a previous one to be asked, since I'm interested in the basic steps, nothing in particular. It's the first time I want to license one of my projects, and it turns out, I don't know much about it. Let's say I want to use the MIT License. Do I just take the definition and paste it into my files? Does it need to be in ALL the files, or just one? or? I don't want any fancy rights so MIT has been recommended to me, do you suggest something else? I'm looking for impartial opinions. Thanks. What other aspects must I take into account? It's PHP, btw.

    Read the article

  • error come to execute the stored procedure using with open xml in sql server

    - by Muthumari
    Hi, i execute the below stored procedure.but it shows the error. The error is 'Incorrect syntax near '.'.i.e error shows in 'xmlFields.Country' please look this stored procedure also and help me thanks, in advance create procedure sp_SuUpdateSUADUsersStatus ( @FinalEMPCode nvarchar(50), @xmlFields NTEXT ) AS DECLARE @CityIDReturn INT SET NOCOUNT ON BEGIN DECLARE @hdoc INT EXEC sp_xml_preparedocument @hdoc OUTPUT, @xmlFields BEGIN EXEC @CityIDReturn=sp_SuSaveADUsersLocation @Country=xmlFields.Country, xmlFields.State,xmlFields.City FROM OPENXML(@hDoc, 'EmpCode/User', 2) WITH (Country nvarchar(500),State nvarchar(500),City nvarchar(500)) as xmlFields where xmlFields.Country <>'' and xmlFields.State <>'' and xmlFields.City <>'') END EXEC sp_xml_removedocument @hdoc End

    Read the article

  • open flash chart help needed

    - by Carlos Barbosa
    def reparto_de_ventas_por_marca #obtener los montos de las ventas en el periodo comprendido y sumarlas @ventas = Venta.find(:all) @marcas = Marca.find(:all) title = Title.new("Ingresos de este mes: #{@total}") pie = Pie.new pie.start_angle = 35 pie.animate = true pie.tooltip = '#val# de #total#<br>#percent# de 100%' pie.colours = ["#245a9c", "#fff"] pie.values = [ @marcas.each do |result| PieValue.new(result.ventas.count, result.name) end ] chart = OpenFlashChart.new chart.title = title chart.add_element(pie) chart.x_axis = nil render :text => chart.to_s end It just doesn't works i need to get the values to create a graph with flash chart. any help will be appreciated.

    Read the article

  • Open-source navigation software and 3rd party hardware

    - by anttir
    I'm a bit fed up with the current navigator (TomTom) as it turned to adware after six months of use. "Please buy new maps at www.tomtom.com, click this button to see what you wanted to do". Is there any (good) OSS navigation software with support for proprietary hardware? I'm perfectly happy to purchase separate maps and hardware for the software as long as I don't have to give my money to TomTom or Navigon.

    Read the article

  • SSH with Perl using file handles, not Net::SSH

    - by jorge
    Before I ask the question: I can not use cpan module Net::SSH, I want to but can not, no amount of begging will change this fact I need to be able to open an SSH connection, keep it open, and read from it's stdout and write to its stdin. My approach thus far has been to open it in a pipe, but I have not been able to advance past this, it dies straight away. That's what I have in mind, I understand this causes a fork to occur. I've written code accordingly for this fork (or so I think). Below is a skeleton of what I want, I just need the system to work. #!/usr/bin/perl use warnings; $| = 1; $pid = open (SSH,"| ssh user\@host"); if(defined($pid)){ if(!$pid){ #child while(<>){ print; } }else{ select SSH; $| = 1; select STDIN; #parent while(<>){ print SSH $_; while(<SSH>){ print; } } close(SSH); } } I know, from what it looks like, I'm trying to recreate "system('ssh user@host')," that is not my end goal, but knowing how to do that would bring me much closer to the end goal. Basically, I need a file handle to an open ssh connection where I can read from it the output and write to it input (not necessarily straight from my program's STDIN, anything I want, variables, yada yada) This includes password input. I know about key pairs, part of the end goal involves making key pairs, but the connection needs to happen regardless of their existence, and if they do not exist it's part of my plan to make them exist.

    Read the article

  • Open Source Simple Speech Recognition in C++ in Windows

    - by Cenoc
    Hey Everyone, I was wondering, are there any basic speech recognition tools out there? I just want something that can distinguish the difference between "yes" and "no" and is reasonably simple to implement. Most of the stuff out there seems to make you start from scratch, and I'm looking for something more high level. Thanks!

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Generic Open Source REST Client?

    - by Dean J
    I want a simple client that takes a few parameters (Method, URL, Parameters), makes an HTTP request, and shows me the results that were returned. A browser obviously can easily send GET and POST requests, but I have no good ideas on DELETE and UPDATE. Did I miss something in browser 101, or is there a common freeware tool to do this? I've seen other threads that give me Java APIs for a simple client, but that's not what I'm looking for.

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • python open does not create file if it doesnt exist

    - by Toddeman
    I am using Python. What is the best way to open a file in rw if it exists, or if it does not, then create it and open it in rw? From what i read, file = open('myfile.dat', 'rw') should do this, no? it is not working for me (python 2.6.2) and im wondering if it is a version problem, or not supposed to work like that or what. The bottom line is, i just need a solution for the problem. I am curious about the other stuff, but all i need is a nice way to do the opening part. thanks in advance

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

< Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >