Search Results

Search found 36892 results on 1476 pages for 'product line'.

Page 491/1476 | < Previous Page | 487 488 489 490 491 492 493 494 495 496 497 498  | Next Page >

  • Zeacom UC Compared To Microsoft UC

    - by Kia
    Which is a better solution? Zeacom's Unified Communications or Microsoft's Unified Communications (UC)? Which one has your company implemented? I heard Microsoft coined the term "Unified Communications" but they were slow to jumpstart it... Other companies such as Zeacom have been working on and improving on their UC product since years ago. But Microsoft is such a standard. Which one would you go with?

    Read the article

  • How to set Standby server

    - by lasko
    I have an application that connects to SQL Server 2008. What I want is to make a standby server (this standby server should be a mirror of the primary one). So that when the connection fails, the primary server should automatically switch to standby server without modifying my application. If there is way, please tell me in detail or even if there is third party product. Note that I need to set the connection in my application to one server only.

    Read the article

  • system center operation manager role combinations

    - by KAPes
    We are evaluating system center operations manager 2007 R2 product, and would like to know what all roles can be combined onto single server. Like root management server and reporting servers can be on one box or not? my environment is like 450 servers mostly Exchange and Domain Controllers plus few OCS servers.

    Read the article

  • Automating the installation using SSH

    - by RAY
    I am running a bash script from a remote host to run a binary file which installs 64 bit JDK 6 update 29 on multiple VMs across the Environment. It is installing the file but, at the last line i have to hit a enter to complete the installation. I want to fully automate the script where i do not have to hit the enter at the last line. This is what i am using ssh ${V_TIERS}@${V_TIERS} 'cd JDK; sh jdk-6u29-solaris-sparcv9.sh' It updates as desired, but during install i have to hit enter to continue and complete the installation. Can anybody please help to fully automate the update process.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • PHPMyAdmin running very slow over internet but fine locally

    - by columbo
    I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

    Read the article

  • Underlying Concept Behind Keyboard Mappings

    - by ajay
    I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

    Read the article

  • What else can I do to secure my Linux server?

    - by eric01
    I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

    Read the article

  • Can I send email after a agent job meets particular condition?

    - by Saaza Khan
    Every night. Am running a job what checks the produc expiration date.but ther products have different managers..for eg.milk comes under manager..vegetables comes under another manager ..etc so these people have different emails..I nee dot know wether it is possible to send a email to each manager when ever the product under their category is about to expire ,since it is runig as a job and in the night ..I am curious to know if I am following a correct way and if so how do I proceed

    Read the article

  • power management of USB-enclosed hard drives

    - by intuited
    With a typical USB hard drive enclosure, is the full range of drive power management functionality available? In what may be an unrelated matter: is it possible to suspend a PC without unmounting an attached USB-powered drive, and then remounting it on resume? This is the behaviour I'm currently seeing (running Ubuntu linux 10.10). Are there certain models or brands that provide more complete control over this aspect of drive operation? My Friendly Neighbourhood Computer Store carries (part of) the Vantec Nexstar product line.

    Read the article

  • What is the best way to do development with git? [closed]

    - by marlene
    I have been searching the web for best practices, but don't see anything that is consistent. If you have an excellent development process that includes successful releases of your product as well as hotfixes/patches and maintenance releases and you use git. I would love to hear how you use git to accomplish this. Do you use branches, tags, etc? How do you use them? I am looking for details, please.

    Read the article

  • Reviews Cheyney Group Marketing: What accounting softwares are available in the market for small businesses?

    - by user224313
    Accounting is the language of business, and good accounting software can save you hundreds of hours at the business equivalent of Berlitz. There's no substitute for an accounting pro who knows the ins and outs of tax law, but today's desktop packages can help you with everything from routine bookkeeping to payroll, taxes, and planning. Each package also produces files that you can hand off to an accountant as needed. Small-business managers have more accounting software options than ever, including subscription Web-based options that don't require their users to install or update software. Many businesses, however--including those that need to track large inventories or client databases, and those that prefer not to entrust their data to the cloud--may be happier with a desktop tool. We looked at three general-purpose, small-business accounting packages: Acclivity AccountEdgePro 2012 (both the product and the company were previously called MYOB), Intuit QuickBooks Premier 2012, and Sage's Sage 50 Complete 2013 (the successor to Peachtree Complete). All three packages offer a solid array of tools for tracking income and expenses, invoicing, managing payroll, and creating reports. These full-featured and highly mature programs don't come cheap. Acclivity AccountEdge Pro, at $299, is the least expensive; and prices climb if you opt to use common time-saving add-ons such as payroll services, or if you add licenses for multiple user accounts. All three are solid on the basics, but they have distinct differences in style and focus. The more you know about your accounting requirements, the more closely you'll want to look at the software you're thinking of buying. Sage 50 Complete should appeal most to people who understand the fine points of accounting and can use the product's many customization features (especially for businesses that manage inventory). QuickBooks works hard to appeal to newbies who need only the basics and might be intimidated by the level of detail and technical language exposed in the other two packages. At the same time, it also has a slew of third-party add-ons that meet specific needs and greatly expand its capabilities. AccountEdge Pro balances accessibility with a strong feature set at an affordable price. It's especially suitable for businesses that need to provide simultaneous access to multiple users.

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Disabled annotation tools in Skim

    - by Kit
    Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

    Read the article

  • PHP session files have permissions of 000 - They're ununsable

    - by vanced
    I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • Any free Exchange hosts out there?

    - by Pure.Krome
    Hi folks, Are there any free Microsoft Exchange hosted solutions? I understand that Microsoft Exchange is a paid/licensed product, but I was curious if there might be a host that has a free hosting model (e.g. for <= 3 mailboxes per domain)? Larger mail boxes per domain == cost. ?? Finally, please refrain from suggesting other mail services (eg. sendmail, etc).

    Read the article

  • Custom prompt doesn't work on Mac Terminal

    - by mareks
    I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

    Read the article

  • How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

    - by ysim
    I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

    Read the article

  • What's the advantage of using a bash script for cron jobs?

    - by AlxVallejo
    From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

    Read the article

  • Transfer disk image to larger/smaller disk

    - by forthrin
    I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

    Read the article

  • Why does Notepad "randomly" make pasted text a smaller font size?

    - by Coldblackice
    Sometimes when I copy and paste text into Notepad, it will paste the text in the default Notepad font and size, however, the latter half of the pasted line will be multiple font sizes smaller. I'm stumped as to why this is happening. I wondered if it was perhaps some type of hidden formatting that was being copied into Notepad, but I believe that Notepad strips the formatting. I've subsequently taken the same text and tried copy and pasting it into URL bars and CMD prompts to strip any potential formatting (even though it was plaintext copied from web), and then re-pasted into Notepad, but it still leaves this phenomenon. Additionally, when resizing the Notepad window, it will change what portion of the line is default sized and downsized, as seen in the screenshot posted below. The three windows are actually the same Notepad window, each with a different resizing and the resulting text resizing.

    Read the article

  • How to read iptables -L output?

    - by skrebbel
    I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

    Read the article

< Previous Page | 487 488 489 490 491 492 493 494 495 496 497 498  | Next Page >