Search Results

Search found 19385 results on 776 pages for 'canonical link'.

Page 493/776 | < Previous Page | 489 490 491 492 493 494 495 496 497 498 499 500  | Next Page >

• How to customize the Ubuntu Live CD?

  - by karthick87

  I would like to customize Ubuntu live CD by installing some additional packages. I have followed this link but it doesn't seems to work. Can anyone provide clear instructions? Note: I do not prefer Remastersys, manual way will be appreciated. Customization Packages that I want to install: Thunderbird Samba SSH Changes that I need: Remove Games menu from the Application menu Firefox shortcut on desktop Radiance as the default theme Different default Ubuntu wallpaper Configuration file changes I want the panel to be placed at the bottom I want to paste my Samba configuration file instead of default Samba configuration I have few Firefox shortcuts and folders I would like to show that in Desktop Also it will be nice if you say me how to change the icon sets Recent Updates I have customized Ubuntu 10.10 with Firefox shortcuts and few folders on desktops. Everything went smooth. But the installer gets crashes after choosing the timezone. How do i fix this issue? Also setting wallpaper affects the login screen. The wallpaper which i set is displayed on the login screen also. I just want the default one for the login screen.

  Read the article

• A Dozen USB Chargers Analyzed; Or: Beware the Knockoffs

  - by Jason Fitzpatrick

  When it comes to buying a USB charger one is just as good as another so you might as well buy the cheapest one, right? This interesting and detailed analysis of name brand, off-brand, and counterfeit chargers will have you rethinking that stance. Ken Shirriff gathered up a dozen USB chargers including official Apple chargers, counterfeit Apple chargers, as well as offerings from Monoprice, Belkin, Motorola, and other companies. After putting them all through a battery of tests he gave them overall rankings based on nine different categories including power stability, power quality, and efficiency. The take away from his research? Quality varied widely between brands but when sticking with big companies like Apple or HP the chargers were all safe. The counterfeit chargers (like the $2 Apple iPad charger knock-off he tested) proved to be outright dangerous–several actually melted or caught fire in the course of the project. Hit up the link below for his detailed analysis including power output readings for the dozen chargers. A Dozen USB Chargers in the Lab [via O'Reilly Radar] 6 Start Menu Replacements for Windows 8 What Is the Purpose of the “Do Not Cover This Hole” Hole on Hard Drives? How To Log Into The Desktop, Add a Start Menu, and Disable Hot Corners in Windows 8

  Read the article

• SSH disconnects active session after 20 minutes

  - by Paramaeleon

  I’ve just set up a new Linux box (OpenSuSE 12.3 on VmWare). Now I stated that my SSH shell sessions are disconnected exactly after 20 minutes, clearly with activity. (Putty: “Network error: Software caused connection abort”) I already set Putty to send keep alives every 64 sec. In sshd_config, I set ClientAliveInterval 50 ClientAliveCountMax 2 and did a deamon reload. Didn’t help. About two minutes after the link breakdown, ssh reports to /var/log/messages: … … sshd[…]: Timeout, client not responding. … … sshd[…]: pam_unix(sshd:session): session closed for user root I don’t encounter this behaviour when connecting to other virtual machines, so I guess the problem isn’t in the network. Any help is appreciated.

  Read the article

• Mail.app slow to include new messages

  - by Chris Tompsett

  With Leopard I was able to link to the University's Exchange 2003 server with and IMAP connection and mail out directly vie the SMTP client. With Snow Leopard I attempted to update to a full Exchange service (Exchange 2007). Almost all has worked OK (ical, address, etc.) except that new mail posted to my email account, which is visible using a 'web' interface to Exchange remains invisible for some random number of hours. Those who are running the Exchange server have no interest in discussing the problem. Has anyone else had a similar experience?

  Read the article

• Simple CMS (separate files for multiple users) [closed]

  - by Pentium100

  I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

  Read the article

• Loign Scren hangs after entering password in Ubuntu 12.04

  - by Ravi

  When I enter my password in the login box nothing happens. It is stucked there. It was running fine earlier. Actually, I installed the package gnome-panel and cairo-dock. Then I logged out and selected gnome classic session. Then I added a ppa from the webupd8.org to install the themes(link). I opened Ubuntu Tweak tool. When I changed the theme to Evolve the whole laptop stopped responding. None of my keyboard and mouse was working. So I was forced to do a forced shutdown. Now after restart I cannot login into ubuntu. I hear a loud sound of my laptop fan when the laptop is stucked. (Probably CPU will be at 100% when it stucked). Please help me. How can I login back to ubuntu? I am using ubuntu 12.04 and have installed all the latest updates..

  Read the article

• Create Adjustable Depth of Field Photos with a DSLR

  - by Jason Fitzpatrick

  If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

  Read the article

• OpenGL : sluggish performance in extracting texture from GPU

  - by Cyan

  I'm currently working on an algorithm which creates a texture within a render buffer. The operations are pretty complex, but for the GPU this is a simple task, done very quickly. The problem is that, after creating the texture, i would like to save it. This requires to extract it from GPU memory. For this operation, i'm using glGetTexImage(). It works, but the performance is sluggish. No, i mean even slower than that. For example, an 8MB texture (uncompressed) requires 3 seconds (yes, seconds) to be extracted. That's mind puzzling. I'm almost wondering if my graphic card is connected by a serial link... Well, anyway, i've looked around, and found some people complaining about the same, but no working solution so far. The most promising advise was to "extract data in the native format of the GPU". Which i've tried and tried, but failed so far. Edit : by moving the call to glGetTexImage() in a different place, the speed has been a bit improved for the most dramatic samples : looking again at the 8MB texture, it knows requires 500ms, instead of 3sec. It's better, but still much too slow. Smaller texture sizes were not affected by the change (typical timing remained into the 60-80ms range). Using glFinish() didn't help either. Note that, if i call glFinish() (without glGetTexImage), i'm getting a fixed 16ms result, whatever the texture size or complexity. It really looks like the timing for a frame at 60fps. The timing is measured for the full rendering + saving sequence. The call to glGetTexImage() alone does not really matter. That being said, it is this call which changes the performance. And yes, of course, as stated at the beginning, the texture is "created into the GPU", hence the need to save it.

  Read the article

• Microsoft Outlook 2007 Limit attachment size

  - by tasmanian_devil

  I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

  Read the article

• How to make the internal subwoofer work on an Asus G73JW?

  - by CodyLoco

  I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

  Read the article

• Windows 8 Program Sharing?

  - by Martin W. Seitz

  How do I, as the administrator, share the Skype program with a user on the same PC? I tried to download Skype to the user from the windows store that said it was blocked and I must contact the administrator. The Skype icon appears on the user desktop but with an X in the corner with no way to allow it to work as the administrator. In the administrator desktop the Skype icon appears without the x and it does work. I have tried to research this issue and so far all I have been able to find and do is the enable $admin share at this link http://www.intelliadmin.com/index.php/2012/10/windows-8-enable-the-admin-share/ Now that I have done this how do I use it to share the Skype program? Thanks in advance. Marty Seitz

  Read the article

• What is the 'cacert.pem' and for what to use that?

  - by user65567

  I am developing a web application on localhost with domains and sub-domains and I would like to use a HTTPS connection. On my Mac OS, in order to enable SSL, I need to set Apache correctly, so I followed some guide to accomplish part of that. Now it is time to choose a certificate in order to test HTTPS requests. I seen the cacert.pem, but I don't know how to use that and for what it is used (can you explain to me some about its usage?)... So, is it possible to use the cacert.pem (see the link) for all my domains and subdomains (maybe, as a wildcard certificate) on localhost? If so, how to do that? What certificate I have to take and use? If no, what I need to do in order to use a wildcard certificate for all my domains and subdomains on localhost? Of course those certificates must be accepted by browsers and working for HTTPS connection between my domains.

  Read the article

• When creating a GUI wizard, should all pages/tabs be of the same size? [closed]

  - by Job

  I understand that some libraries would force me to, but my question is general. If I have a set of buttons at the bottom: Back, Next, Cancel?, (other?), then should their location ever change? If the answer is no, then what do I do about pages with little content? Do I stretch things? Place them in the lone upper left corner? According to Steve Krug, it does not make sense to add anything to GUI that does not need to be there. I understand that there are different approaches to wizards - some have tabs, others do not. Some tabs are lined horizontally at the top; others - vertically on the left. Some do not show pages/tabs, and are simply sequences of dialogs. This is probably a must when the wizard is "non-linear", e.g. some earlier choices can result in branching. Either way the problem is the same - sacrifice on the consistency of the "big picture" (outline of the page/tab + location of buttons), or the consistency of details (some tabs might be somewhat packed; others having very little content). A third choice, I suppose is putting extra effort in the content in order to make sure that organizing the content such that it is more or less evenly distributed from page to page. However, this can be difficult to do (say, when the very first tab contains only a choice of three things, and then branches off from there; there are probably other examples), and hard to maintain this balance if any of the content changes later. Can you recommend a good approach? A link to a relevant good blog post or a chapter of a book is also welcome. Let me know if you have questions.

  Read the article

• QNAP TS-419p as a VPN Gateway?

  - by heisenberg

  Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

  Read the article

• Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

  - by cdowen

  I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Set Up Remote Desktop at Home

  - by Rev

  I'm sure this has been asked before, but I'm unable to find a clear set of instructions. I'm currently using LogMeIn Hamachi to enable Windows 8's Remote Desktop feature on my home computer (running Win8 Pro x64). Unfortunatley, I can't use this method to access my home computer from my Surface Tablet, as I can't install in the Hamachi client. So how can I set up Remote Desktop without using LogMeIn Hamachi? A link to a noob-friendly tutorial would be greatly appreciated. I haven't been able to find anything that I understand (and I am pretty technical, router stuff just stumps me for some reason). EDIT: And I don't want to use a third party service like TeamViewer, in my experience those tools are laggy and quite horrible. The Remote Desktop feature has been excellent.

  Read the article

• Software for Company internal Website [closed]

  - by LordT

  hope this is the right stackexchange site to ask this: We've a group of webpages/services at work (SE Startup), ranging from SVN, trac, continous integration to link collections to a DMS. Nearly everything has an RSS Feed to get the info I need, with the exception of SVN. I'm looking for some kind of software that can integrate these well on a kind of start-page. The most recent changes, upcoming events etc should be clearly visible, as well as an option to search (the search will be provided from a different tool). A news area should be included as well. Currently, I'm pondering doing this with either wordpress or TWiki, although wordpress seems to be the simpler solution in terms of getting something good looking quickly. Authentication should be handled by HTTP-Basic Auth, which we already have in place and working well. I normally would consider Sharepoint a viable option for this, but we're exclusively mac and linux, I won't put up a windows server just for this.

  Read the article

• Why are my Google searches redirected?

  - by Please Help

  This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

  Read the article

• Why doesn't wireless work on Wubi 12.04 with a Broadcom BCM4312 card?

  - by Kristin

  I have recently set up ubuntu 12.04 on my laptop using the Wubi installer. I am having a very difficult time setting up a wireless internet connection. I am currently set up with an ethernet connection which I have used to download all new updates and to activate the Broadcom STA wireless driver. I have tried several things in the terminal based on other people's posts: ~$ rfkill list 0: brcmwl-0: Wireless LAN Soft blocked: no Hard blocked: yes ~$ rfkill unblock all It doesn't change anything. I also tried rebooting and connecting to the internet on my Windows Vista OS, and it worked, so I know that the connection should not be hard blocked. I have also tried installing b43 firmware (lp/phy version) that is supposed to work with my chip (BCM4312). It seems to have no effect. Then I tried: ~$ iwconfig lo no wireless extensions. eth1 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. This is my first time trying to work with ubuntu, so I would appreciate any help. Thanks. Also sorry this is poorly formatted. I'm having troubles with that too.

  Read the article

• Firefox 11 Bookmarks Toolbar too Tall

  - by tba

  After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

  Read the article

• no driver found error showing while installing windows 7

  - by Shyam s

  I accidentally deleted all my windows 7 drive partitions while installing Ubuntu in my laptop.On booting into ubuntu it is showing 450gb NTFs file partition.30 GB drive linux file system partition. so when i was reinstalling my Os with windows 7.i am not able to view my drives.it is showing drivers not found.I have searched the google followed the steps mentioned in this link. http://social.technet.microsoft.com/Forums/en/w7itproinstall/thread/d460efd3-eac4-4ef8-b95f-b8208b24f44f my laptop is i3 machine and i changed sata to ACHI.still it is showing same error. How can reinstall windows 7. thanks in advance.

  Read the article

• My Router is fast when i reset it but slows down seconds later

  - by hglocke

  I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

  Read the article

• What is the world wide web? [closed]

  - by think123

  I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

  Read the article

• Update 3 for "NetBeans Platform for Beginners"

  - by Geertjan

  The latest monthly update of NetBeans Platform for Beginners was released during the last few days. Without any question at all, this book is awesome. I love how it is a 'living book' and that on a monthly basis new updates are made available. In this particular update, as before, reader comments and questions have led to changes and enhancements in the book. In addition, there's now a tighter integration between the long list of samples on GitHub and the book, since wherever a sample relates to a text in the book, the book has a handy icon, so that you know when to hop over to GitHub to get a related sample. Do you have comments or questions about the book? That's what the feedback link is for: https://leanpub.com/nbp4beginners/feedback And there's also a free sample, just in case you'd like to get a feel for the book prior to buying it: http://samples.leanpub.com/nbp4beginners-sample.pdf If you're from a company where you're all sharing a single copy of the book, it would be great if you'd go back and support this great project (and hopefully encourage future books being written) by buying additional copies, ideally one for each developer. Let's show the authors that writing books on the NetBeans Platform is a really profitable thing to do (and I'm hoping they'll write one on Maven and the NetBeans Platform, as well)!

  Read the article

< Previous Page | 489 490 491 492 493 494 495 496 497 498 499 500  | Next Page >