aman garg - Page 5 - Developer IT

How to release my view from stack ?

- by aman-gupta

Hi, In my application I m using following coding convention to open my default screen :-- AppDelegate *ptrDefaultScreen = (AppDelegate *)[[UIApplication sharedApplication]delegate]; [self.navigationController presentModalViewController:ptrDefaultScreen.FrmFlashScreenLink animated:YES]; but when I move to other screen after default screen ,my default screen is still exists even i used [self dismissModelViewController:YES]; to dimiss default screen from view. where I m wrong I want my default screen will be completely removed from view. Is any other way to call default screen before actual application. Please help me out.Thanks in advance

Read the article

Starting an Intent to Launch an app to Background in Android

- by Tista

Hi all, I'm using Wikitude API 1.1 as an AR viewer in my application. The problem with Wikitude, if I haven't launched the actual Wikitude application since the phone's bootup, I will get a NullPointerException everytime I start my own application. So I figure if I can start my app first and them check if Wikitude is installed and or running. If it's not installed, go to market n download. If it's not running, then we should run it straight to background so that my app doesn't loose its focus. // Workaround for Wikitude this.WIKITUDE_PACKAGE_NAME = "com.wikitude"; PackageManager pacMan = Poligamy.this.getPackageManager(); try { PackageInfo pacInfo = pacMan.getPackageInfo(this.WIKITUDE_PACKAGE_NAME, pacMan.GET_SERVICES); Log.i("CheckWKTD", "Wikitude is Installed"); ActivityManager aMan = (ActivityManager) this.getSystemService(ACTIVITY_SERVICE); List<RunningAppProcessInfo> runningApps = aMan.getRunningAppProcesses(); int numberOfApps = runningApps.size(); for(int i=0; i<numberOfApps; i++) { if(runningApps.get(i).processName.equals(this.WIKITUDE_PACKAGE_NAME)) { this.WIKITUDE_RUNNING = 1; Log.i("CheckWKTD", "Wikitude is Running"); } } if(this.WIKITUDE_RUNNING == 0) { Log.i("CheckWKTD", "Wikitude is NOT Running"); /*final Intent wIntent = new Intent(Intent.ACTION_MAIN, null); wIntent.addCategory(Intent.CATEGORY_LAUNCHER); final ComponentName cn = new ComponentName("com.wikitude", "com.mobilizy.wikitudepremium.initial.Splash"); wIntent.setComponent(cn); wIntent.setFlags(Intent.FLAG_ACTIVITY_NO_USER_ACTION); startActivityIfNeeded(wIntent, 0);*/ } } catch (NameNotFoundException e) { // TODO Auto-generated catch block Log.i("CheckWKTD", "Wikitude is NOT Installed"); e.printStackTrace(); //finish(); } The part I block commented is the intent to start Wikitude. But I always failed in restricting Wikitude to background. Any help? Thanks before. Best, Tista

Read the article

Problem with Arcam rpac and Ubuntu 12.04

- by user108393

I have recently (?mistakenly) purchased an Arcam rpac USB DAC for my Ubuntu (12.04) PC. I have torn out all but 3 of my hairs trying to get this to work and have had absolutely no luck so far. I can see the Arcam USB audio device when i run aplay -l, however I cannot see it listed under the Sound settings. I can see the soundcard device when running alsamixer also, but if I try and select it, alsamixer crashes, stating "cannot load mixer controls: Invalid argument". Any ideas how to get this working (if it's even possible)? Does anyone else out there have the rpac with ubuntu? Thank you! Aman

Read the article

SQL SERVER – Winners – Contest Win Joes 2 Pros Combo (USD 198)

- by pinaldave

Earlier this week we had contest ran over the blog where we are giving away USD 198 worth books of Joes 2 Pros. We had over 500+ responses during the five days of the contest. After removing duplicate and incorrect responses we had a total of 416 valid responses combined total 5 days. We got maximum correct answer on day 2 and minimum correct answer on day 5. Well, enough of the statistics. Let us go over the winners’ names. The winners have been selected randomly by one of the book editors of Joes 2 Pros. SQL Server Joes 2 Pros Learning Kit 5 Books Day 1 Winner USA: Philip Dacosta India: Sandeep Mittal Day 2 Winner USA: Michael Evans India: Satyanarayana Raju Pakalapati Day 3 Winner USA: Ratna Pulapaka India: Sandip Pani Day 4 Winner USA: Ramlal Raghavan India: Dattatrey Sindol Day 5 Winner USA: David Hall India: Mohit Garg I congratulate all the winners for their participation. All of you will receive emails from us. You will have to reply the email with your physical address. Once you receive an email please reply within 3 days so we can ship the 5 book kits to you immediately. Bonus Winners Additionally, I had announced that every day I will select a winner from the readers who have left comments with their favorite blog post. Here are the winners with their favorite blog post. Day 1: Prasanna kumar.D [Favorite Post] Day 2: Ganesh narim [Favorite Post] Day 3: Sreelekha [Favorite Post] Day 4: P.Anish Shenoy [Favorite Post] Day 5: Rikhil [Favorite Post] All the bonus winners will receive my print book SQL Wait Stats if your shipping address is in India or Pluralsight Subscription if you are outside India. If you are not winner of the contest but still want to learn SQL Server you can get the book from here. Amazon | 1 | 2 | 3 | 4 | 5 | Flipkart | Indiaplaza Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Joes 2 Pros, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

Read the article

AIOUG TechDay @ Lovely Professional University, Jalandhar, India

- by Tori Wieldt

by guest blogger Jitendra Chittoda, co-leader, Delhi and NCR JUG On 30 August 2013, Lovely Professional University (LPU) Jalandhar organized an All India Oracle User Group (AIOUG) TechDay event on Oracle and Java. This was a full day event with various sessions on J2EE 6, Java Concurrency, NoSQL, MongoDB, Oracle 12c, Oracle ADF etc. It was an overwhelming response from students, auditorium was jam packed with 600+ LPU energetic students of B.Tech and MCA stream. Navein Juneja Sr. Director LPU gave the keynote and introduced the speakers of AIOUG and Delhi & NCR Java User Group (DaNJUG). Mr. Juneja explained about the LPU and its students. He explained how Oracle and Java is most used and accepted technologies in world. Rohit Dhand Additional Dean LPU came on stage and share about how his career started with Oracle databases. He encouraged students to learn these technologies and build their career. Satyendra Kumar vice-president AIOUG thanked LPU and their stuff for organizing such a good technical event and students for their overwhelming response. He talked about the India Oracle group and its events at various geographical locations all over India. Jitendra Chittoda Co-Leader DaNJUG explained how to make a new Java User Groups (JUG), what are its benefits and how to promote it. He explained how the Indian JUGs are contributing to the different initiatives like Adopt-a-JSR and Adopt-OpenJDK. After the inaugural address event started with two different tracks one for Oracle Database and another for Java and its related technologies. Speakers: Satyendra Kumar Pasalapudi (Co-founder and Vice President of AIOUG) Aman Sharma (Oracle Database Consultant and Instructor) Shekhar Gulati (OpenShift Developer Evangelist at RedHat) Rohan Walia (Oracle ADF Consultant at Oracle) Jitendra Chittoda (Co-leader Delhi & NCR JUG and Senior Developer at ION Trading)

Read the article

OBJC_CLASS_$_MTSCRA", referenced from

- by user1078841

I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

Read the article

UITextField with the lookup

- by leon

Hello, I would like to achive the same functinoanlity in the UUTextField control as Google search web site (which uses Ajax for this): as user start typing, list of suggestion searches is shown. Then more letteres you type, suggestion list changes. So imaging I have array of words: Apple Abc Aman As user types A, all thress suggesions are shown, if user type one more letter p, then Apple is suggested. How would I do something like this? Mail type of applicatins do it, when receipent name is typed in the To: edit control I guess I can use UITableView with the search, is it correct approach?

Read the article

2 dimensional array

- by ankit

we have these arrays.... $cities = array("nagpur","kanpur","delhi","chd","Noida","mumbai","nagpur"); $names = array("munish","imteyaz","ram","shyam","ankit","Rahul","mohan"); now i want a 2 dimensional array with name of city as key and all the corresponding names as its values. <?php $cities = array("nagpur","kanpur","nagpur","delhi","kanpur"); $names = array("ankit","atul","aman","amit","manu"); foreach ($cities as $i => $value) { echo "\n"; echo $value; $city=$value; $k=0; foreach ($cities as $ii => $m) { If($city==$m) { echo$names[$ii] ; $final[$i][$k]=$names[$ii]; $arr = array($city => array($k =>$names[$ii] )); $k++; } } echo"\n<tr></tr>"; } wat i tried is this.but it doesnt work.help me

Read the article

Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\$",""); b[i][j]=b[i][j].replaceAll("\$",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Developer IT