Search Results

Search found 169 results on 7 pages for 'dis'.

Page 5/7 | < Previous Page | 1 2 3 4 5 6 7  | Next Page >

  • Several border firewalls in the same network

    - by nimai
    I'm currently analyzing the consequences of multipath connections for the firewalls. In that context, I'm wondering if it's really uncommon to have several firewalls at the borders of a network to protect it. The typical case I'd imagine would be a multihomed network, for which the administrator would have different policies for links from different (or not) ISPs. Or maybe even in an ISP's network. What would be the practical (dis)advantages of such a configuration? Could you provide an example of an existing topology using several border firewalls?

    Read the article

  • Hard Disk recovery

    - by Shaihi
    I have 3 disks of the same type model and year of production. All the disks were used part of a generic solution of an IBM server solution. My problem is that all 3 disks suffered the same malfunction at the same exact time and are now dis-functional. I went to two different expert's laboratories and got the same answer: To recover the data they need another identical disk from which they can take spare parts. Can my case really be that clinical? Anyway, I am not sure if this question belongs to this forum, but I am looking to buy the following disk: IIBM ESERVER XSERIES IBM P/N 24P3707 IBM FRU 24P3708 146.8GB USCSI 10K RPM PART NOMBER 9V2005-027 I already bought a disk with the same part number, but the labs said that apparently I need a disk that was manufactured in the same factory. That means that all the numbers have to be exactly the same. If anybody know where I can purchase such a disk (the information on the lost disks is really important to me), please tell me the place.

    Read the article

  • why in /proc file system have this infomation

    - by liutaihua
    run: lsof|grep delete can find some process open fd, but system dis that it had to delete: mingetty 2031 root txt REG 8,2 15256 49021039 /sbin/mingetty (deleted) I look the /proce filesystem: ls -l /proc/[pid] lrwxrwxrwx 1 root root 0 9? 17 16:12 exe -> /sbin/mingetty (deleted) but actually, the executable(/sbin/mingetty) is normal at /sbin/mingetty path. and some soket like this situation: ls -l /proc/[pid]/fd 82 -> socket:[23716953] but, use the commands: netstat -ae|grep [socket id] can find it. why the OS display this infomation??

    Read the article

  • Reusable VS clean code - where's the balance?

    - by Radek Šimko
    Let's say I have a data model for a blog posts and have two use-cases of that model - getting all blogposts and getting only blogposts which were written by specific author. There are basically two ways how I can realize that. 1st model class Articles { public function getPosts() { return $this->connection->find() ->sort(array('creation_time' => -1)); } public function getPostsByAuthor( $authorUid ) { return $this->connection->find(array('author_uid' => $authorUid)) ->sort(array('creation_time' => -1)); } } 1st usage (presenter/controller) if ( $GET['author_uid'] ) { $posts = $articles->getPostsByAuthor($GET['author_uid']); } else { $posts = $articles->getPosts(); } 2nd one class Articles { public function getPosts( $authorUid = NULL ) { $query = array(); if( $authorUid !== NULL ) { $query = array('author_uid' => $authorUid); } return $this->connection->find($query) ->sort(array('creation_time' => -1)); } } 2nd usage (presenter/controller) $posts = $articles->getPosts( $_GET['author_uid'] ); To sum up (dis)advantages: 1) cleaner code 2) more reusable code Which one do you think is better and why? Is there any kind of compromise between those two?

    Read the article

  • Game works on netbeans but not outside netbeans in jar file?

    - by Michael Haywood
    I am creating a basic game of 'Pong'. I have finished the game apart from a few glitches I need to remove. The game runs perfectly in netbeans but if I create a jar file errors come up causing it to not work. I am quite new to java but I believe it is something to do with my code looking for the images but the images have not been loaded up yet. Here is the error. How can I get this to work outside of netbeans in a jar file? C:\Users\michael>java -jar "C:\Users\michael\Documents\NetBeansProjects\Pong\dis t\Pong.jar" Exception in thread "main" java.lang.NullPointerException at javax.swing.ImageIcon.<init>(Unknown Source) at pong.BallMainMenu.<init>(BallMainMenu.java:19) at pong.Board.gameInit(Board.java:93) at pong.Board.addNotify(Board.java:86) at java.awt.Container.addNotify(Unknown Source) at javax.swing.JComponent.addNotify(Unknown Source) at java.awt.Container.addNotify(Unknown Source) at javax.swing.JComponent.addNotify(Unknown Source) at java.awt.Container.addNotify(Unknown Source) at javax.swing.JComponent.addNotify(Unknown Source) at javax.swing.JRootPane.addNotify(Unknown Source) at java.awt.Container.addNotify(Unknown Source) at java.awt.Window.addNotify(Unknown Source) at java.awt.Frame.addNotify(Unknown Source) at java.awt.Window.show(Unknown Source) at java.awt.Component.show(Unknown Source) at java.awt.Component.setVisible(Unknown Source) at java.awt.Window.setVisible(Unknown Source) at pong.Pong.<init>(Pong.java:16) at pong.Pong.main(Pong.java:23)

    Read the article

  • hdmi audio works only with aplay -D alsa test wavs; open source radeon drivers; kernel 3.5 vgaswitcheroo

    - by user108754
    I've trolled the internets to make hdmi work on my system Ubuntu 12.04 software center kernel 3.5 uname: Linux ubuntu 3.5.0-18-generic #29~precise1-Ubuntu SMP...x86_64 x86_64 x86_64 GNU/Linux open source radeon drivers vgaswitcheroo (hybrid intel/radeon gpu): I boot with intel, not radeon, running. (and recall that with kernel 3.5, vgaswitcheroo now gives info on a third item, "DIS-Audio"; it indicates pwr on my system) ( /etc/rc.local: chown user:user /sys/kernel/debug/ # change "username" with your user name echo OFF /sys/kernel/debug/vgaswitcheroo/switch ) grub indeed now has "radeon.audio=1" for testing audio, I did aplay -l which gave me the card and device, which made me try aplay -D plughw:1,3 /usr/share/sounds/alsa/Front_Center.wav and lo! I get crystal clear sound on my hdtv. If I play an mp3 file as the argument to that command, I get noise as, I guess, aplay interprets the mp3 code as a wav. If I play a .wav that is not in the /usr/share/sounds/alsa/ directory, I get nothing. Internet flash video in browser plays no sound over hdmi. Both system sounds control and pavucontrol have hdmi cedar selected. Alas, I can not get sound for any gui test (left, right). Why would only aplay, and only when directed with "-D plughw", yield sound over hdmi? I've also tried only using one sound program at a time, if it was a limitation of alsa, so I tried aplay with web browser and even the sound control gui closed. I tried each of the last two, running alone. No improvement. alsamixer only shows hda intel and I think it's only the intel audio, not the hdmi.

    Read the article

  • Should ATI catalyst be installed for sake of openCL?

    - by G Sree Teja Simha
    I have a HP Envy 4 1025tx with Hybrid graphics. Although this is a 64bit system, I've installed 32bit Ubuntu on it for some reasons.(Hybrid graphics don't do well with 64bit Ubuntu.-"Some one on some forum") I had heating problems with the GPU but I've fixed them all with vgaswitcheroo. But now I wanted to use my Blender on my Ubuntu. To my surprise Blender didn't detect the dedicated 7670m card in my machine. I've confirmed with cat /sys/kernel/debug/vgaswitcheroo/switch Both IGD and DIS were up and running. I dont seem to have libopencl on my /usr/lib even though my synaptic manager says that I have installed it. I'm not quite sure what I've installed. It says that I've installed "ocl-icd-libopencl1". So my question is... Do I have opencl on my system? If not do I have to get propreitary ATI drivers for sake of opencl(fglrx wrecks up my unity totally on my system I need directions to fix it if this is the choice)? Should I get a 64bit Ubuntu installed on this system?

    Read the article

  • Hybrid Graphics on Ubuntu 12.04 switching to discrete

    - by cfstras
    I have a Sony Vaio VPCCB-27FX with hybrid graphics. Using vgaswitcheroo enables me to switch my discrete card off to save power. Now when i want to switch to the discrete card for performance, my system freezes. I already tried logging out and killing x with service lightdm stop, but still, it freezes as soon as I echo DIS > switch. typing blindly, echo IGD > switch returns me to my console where it reads [ 179.555171] i915: switched off, but it seems the discrete card never gets switched on... running echo DDIS > switch gives me the following: [540....] [drm:atop_op_jump] *ERROR* atombios stuck in loop for more than 5secs aborting [540....] [drm:atom_execute_table_locked] *ERROR* atombios stuck executing CEE2 (len 62, WS 0, PS 0) @ 0xCEFE [540....] [drm:atom_execute_table_locked] *ERROR* atombios stuck executing BBF6 (len 1036, WS 4, PS 0) @ 0xBCF3 [540....] [drm:atom_execute_table_locked] *ERROR* atombios stuck executing BB8C (len 76, WS 0, PS 0) @ 0xBB94 [541....] [drm:r600_RING_TEST] *ERROR* radeon: ring test failed (scratch(0x8504)=0xFFFFFFFF) [541....] [drm:evergreen_resume] *ERROR* evergreen startup failed on resume after that, the atombios part repeats a few times. also, the terminal locks up again and sysrq+REISUB is my only rescue. Has anybody an idea how I can switch to my discrete card without the system locking up? #uname -srvmpio Linux 3.2.0-24-generic #39-Ubuntu SMP Mon May 21 16:52:17 UTC 2012 x86_64 x86_64 x86_64 GNU/Linux #lsb_release -r Description: Ubuntu 12.04 LTS

    Read the article

  • Oracle OpenWorld Highlights

    - by Doug Reid
    We are in the final days of Oracle OpenWorld 2012 and the data integration team have been hard at work giving sessions, meeting customers, demonstrating product and conducting hands-on labs.    It has been a great conference, but the best part is meeting our customers and learning about all the great implementations of our products.  Wednesday was the last day that the exhibition hall was open and attendees were getting in their final opportunities to see our products and meet with the product management team.   Two hours before the close of the hall, people lined up to learn about GoldenGate 11gR2, Monitor, Adapters, Veridata, and all the different use cases.    Here's a picture of Sjaak Vossepoel, who is our DIS Sales Consulting Manager for EMEA speaking to a potential customer on the options of using Oracle GoldenGate for heterogenous data replication.  Over the last two days, the GoldenGate team ran two labs; Introduction to Oracle GoldenGate Veridata and Deep Dive into Oracle GoldenGate.   Both of the labs were completely booked out and unfortunately we had to turn away people.   BUT,  all of our labs were recorded recently so if you were not able to get into the lab or did not have enough time to complete your labs, visit youtube.com/oraclegoldengate to see a  complete recording of the labs we used at OpenWorld plus more.  Here are a couple pictures from the Deep Dive into Oracle GoldenGate lead by Chis Lawless from the Product Management team.   Thanks to the GoldenGate Hands-on Lab team for putting on a great session!!! We will post more information about where you can find additional details on OpenWorld as they become public.   

    Read the article

  • Terrible App Review of the Week&ndash;October 2nd

    - by David Paquette
    As some people know, I have a few apps in the Windows Phone Store.  One of these apps was intended to be a gimmicky app that did NOT really do anything useful.  It was just a funny little app that you probably try it once, then almost immediately uninstall.  To my surprise, this app ended up in some of the Top App lists and actually got a large number of downloads (for the Windows Phone Store).  Along with these downloads came a large number of really terrible and offensive reviews.  People are insulting me and saying awful things that they would never say to someone in person (I hope).  I am ok with this.  I can take the bad reviews and it doesn’t really bother me, but I still think that people are incredibly dis-respectful with their app reviews.  So..I am going to start sharing the best of the worst reviews.  If by chance this is your review, please contact me.  I would love to have a quick chat… Literally THE crappiest app I could of downloaded. You might as well rub dog *** in your eyes..... You'd see more!!! Stan8976   P.S. I am not particularly proud of this app, so I am not going to reveal the name. However, as you see more of these amazing reviews, I think you might be able to guess which app it is.

    Read the article

  • Sell good Dumps, track 1&2, CVV, Paypal, WU TRANSFER Service

    - by gOOD dUMPS cvv
    my products for sale: Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers I am here to sell, supply good and quality CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... In last 5 years my Job Is This. PRESTIGE is my first motto. Not easy to build the good PRESTIGE. My motto is Always make customers satisfied & happy ! I have unlocked many softwares make good money, example: -Software to make the bug and crack MTCN of the Western Union. Version : 2.0.1.1 ( new update ) -Software to open balance in PayPal and Bank Login -Software hacking credit card, debit card Version 1.0 **I only sell it for my good customers, and my familiarity ***I update more than 200 CC + CVV everyday. Fresh + good valid + Strong,private + high balance with best price Our products are checked by a partner who works in a bank. Our products are better than 5-7 days after they are dead. They are raised mainly for money atm. Can be used in most countries. ** If you are a serious buyer, let contact via : Yahoo ID: goodcvv_dumps Mail: [email protected] ICQ: 667686221 * Sell CVV; Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers. CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... I promise CC of mine are good,high balance and fresh all with good price. PRESTIGE is my first motto. I sure u will be happy All I need is good & serious buyer to business for a long time * SELL GOOD CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;...!IF NOT GOOD, WILL CHANGE IMMEDIATELY * Contact me to negotiate about the price if buying bulk. I really need more serious buyers to do long business. You will be given many endow when we have long time business,you do good for me, I do good for u too. Long & good business.This is all I need :) - US (vis,mas)= $3/CC; US (amex,dis)= $5/CC; US BIN; US fullz; USA Visa VBV info for sale. - UK (vis,mas)= $8/CC; UK (amex,dis)= $20/CC; UK BIN; UK DOB; UK with Postcode; UK fullz; UK pass VBV - EU (vis,mas)= $20/CC; EU Amex = $30/CC; EU DOB; EU fullz; EU pass VBV. Include: Italy CVV; Spain CVV; France CVV; Sweden CVV; Denmark CVV; Slovakia CVV; Portugal CVV; Norway CVV; Belgium CVV Greece CVV; Germany CVV; Ireland CVV; Newzealand CVV; Switzerland CVV; Finland CVV; Turkey CVV; Netherland CVV - CA (vis,mas)= $8/CC; CA BIN; CA GOLD; CA Amex; CA Fullz; CA pass VBV - AU (vis,mas)= $10/CC; AU BIN; AU Amex; AU DOB; AU fullz; AU pass VBV - Brazil random = $15/CC; Brazil BIN - Middle East: UAE = $15/CC; Qatar= $10/CC; Saudi Arabia;... - ASIA ( Malay; Indo; Japan;China; Hongkong; Singapore...) = $10/CC - South Africa = $10/CC - And All CC; CC pass VBV; CVV pass VBV; CCN SSN- INTER ( BIN,DOB,SSN,FULLZ) of another Countries. Good CC, CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers] [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers] ------------------------------ CONTACT via Y!H: goodcvv_dumps or ICQ: 667686221 or Mail: [email protected] ------------------------------------ * WARNING!!! BEFORE MAKE BUSINESS or add my ID, let read carefull my rule because i really hate Spammers,Rippers and Scammers - Dont trust, dont talk more - Don't Spamm And Don't Scam! I very hate do spam or rip and I don't want who spam me. - All my CVV are tested before sell, that's sure - I accept LR; WU or MoneyGram. - I only work with reliable buyers. Need good & serious buyer to business for a long time - I work with only one slogan: prestige and quality to satisfy my clients !!! - I was so happy to see you actually make more big money from the business with me Once you trust me, work with me. And if not trust,dont contact me, dont waste time! --------------------------THANKS, LOOK FORWARD TO WORKING WITH ALL of YOU !!!---------------------------- * Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts,Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers. CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts,Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers] * Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected] ===================== WESTERN UNION TRANSFER SERVICE ======================= We are Very PROFESSIONAL in WESTION UNION. Our Special Job Is this We Have big Western Union Service for everywhere and every when for you. We transfer money to all country in world. We can transfer big amount. And you can receive this money from your country. Our service accept payment 15% of transfer amount for small transfer . And 10% of big transfer. For large transfer . We make is very safe. And this service is very fast. We start to run software to make transfer to your WU info very fast,without delay and immediately. We give you MTCN and sender info and all cashout info, 15 mins after your payment complete. CONTACT US via Y!H: goodcvv_dumps or ICQ: 667686221 or Mail: [email protected] to know more info, price list of WU TRANSFER SERVICE ====================== Verified Paypal Accounts for sale ======================== If u are interested in it, contact me to know the price list & have the Tips for using above accounts safely,not be suspended when using accounts. I will not responsible if you get suspended. ===================== Dumps, Track1&2 with PIN & without PIN for ATM Cashout ======================= - Tracks 1&2 US;Tracks 1&2 UK;Tracks 1&2 CA,AU; Tracks 1&2 EU, with PIN and without PIN. - Dumps US; Dumps CA; Dumps EU; Dumps ASIA; Dumps AU, Brazil with good quality & price. Update Types of Dumps having now: Mix; Debit Classic; MC Standard;MC World; Gold; Platinum; Business/Corporate; Purchasing/Signature; Infinite - Contact me via Y!H: goodcvv_dumps (ICQ: 667686221) to know more info & price list of dumps, tracks ! ======================== Bank Logins Account (US UK CA AU EU) ======================== Sell Bank acc: Bank BOA, Bank HSBC USA, HSBC UK, Chase,Washovia, Halifax, Barclays, Abbey,... I make sure that my BANK LOGIN are security & easily to use. If u are interested in this, contact me to know more info about balance, price list,...! ================= Top-up Prepaid Cards, Debit Cards ========================= - If you hold any prepaid cards, debit cards, any country or any company. - I can top you funds into your prepaid cards, debit cards or any virtual cards. - top up your debit cards with hacked credit cards - top up your prepaid card with bank account login - top up you card with paypal account or any other - Have all tools to top your cards account - Top up does not take more then 10 minutes - Payoneer Cards top up available at cheap ================= Service: Provide Ebay - Apple - Amazon - Itunes GIFT CARD & Game Card with best price ===================== Contact me to negotiate about the price if buying bulk - PlayStation® Network Card - Xbox LIVE 12 Month Gold Membership = 30$ Xbox LIVE 4000 Microsoft Points = 30$ Zynga $50 Game Card (World Wide) = 30$ Ultimate game card 50$ = 30$ Ultimate game card 20$ = 10$ Key Diablo 3 = 25$ ITUNES GIFT CARD AMAZON GIFT CARD Ebay gift card Visa gift card ---------------- Our products are checked by a partner who works in a bank -------------------- Our products are better than 5-7 days after they are dead. They are raised mainly for money atm. Can be used in most countries. ---------------- Contact Via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected] ------------------------ Need good & serious buyer to business for a long time [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]]

    Read the article

  • Sell good CVV, Dumps track 1&2, Paypal, WU TRANSFER

    - by Good Dumps CVV for sale
    My products for sale: Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers I am here to sell, supply good and quality CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... In last 5 years my Job Is This. PRESTIGE is my first motto. Not easy to build the good PRESTIGE. My motto is Always make customers satisfied & happy ! I have unlocked many softwares make good money, example: -Software to make the bug and crack MTCN of the Western Union. Version : 2.0.1.1 ( new update ) -Software to open balance in PayPal and Bank Login -Software hacking credit card, debit card Version 1.0 **I only sell it for my good customers, and my familiarity ***I update more than 200 CC + CVV everyday. Fresh + good valid + Strong,private + high balance with best price Our products are checked by a partner who works in a bank. Our products are better than 5-7 days after they are dead. They are raised mainly for money atm. Can be used in most countries. ** If you are a serious buyer, let contact via : Yahoo ID: goodcvv_dumps Mail: [email protected] ICQ: 667686221 * Sell CVV; Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers. CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... I promise CC of mine are good,high balance and fresh all with good price. PRESTIGE is my first motto. I sure u will be happy All I need is good & serious buyer to business for a long time * SELL GOOD CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;...!IF NOT GOOD, WILL CHANGE IMMEDIATELY * Contact me to negotiate about the price if buying bulk. I really need more serious buyers to do long business. You will be given many endow when we have long time business,you do good for me, I do good for u too. Long & good business.This is all I need :) - US (vis,mas)= $3/CC; US (amex,dis)= $5/CC; US BIN; US fullz; USA Visa VBV info for sale. - UK (vis,mas)= $8/CC; UK (amex,dis)= $20/CC; UK BIN; UK DOB; UK with Postcode; UK fullz; UK pass VBV - EU (vis,mas)= $20/CC; EU Amex = $30/CC; EU DOB; EU fullz; EU pass VBV. Include: Italy CVV; Spain CVV; France CVV; Sweden CVV; Denmark CVV; Slovakia CVV; Portugal CVV; Norway CVV; Belgium CVV Greece CVV; Germany CVV; Ireland CVV; Newzealand CVV; Switzerland CVV; Finland CVV; Turkey CVV; Netherland CVV - CA (vis,mas)= $8/CC; CA BIN; CA GOLD; CA Amex; CA Fullz; CA pass VBV - AU (vis,mas)= $10/CC; AU BIN; AU Amex; AU DOB; AU fullz; AU pass VBV - Brazil random = $15/CC; Brazil BIN - Middle East: UAE = $15/CC; Qatar= $10/CC; Saudi Arabia;... - ASIA ( Malay; Indo; Japan;China; Hongkong; Singapore...) = $10/CC - South Africa = $10/CC - And All CC; CC pass VBV; CVV pass VBV; CCN SSN- INTER ( BIN,DOB,SSN,FULLZ) of another Countries. Good CC, CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers] [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts;Ebay Accounts Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers] ------------------------------ CONTACT via Y!H: goodcvv_dumps or ICQ: 667686221 or Mail: [email protected] ------------------------------------ * WARNING!!! BEFORE MAKE BUSINESS or add my ID, let read carefull my rule because i really hate Spammers,Rippers and Scammers - Dont trust, dont talk more - Don't Spamm And Don't Scam! I very hate do spam or rip and I don't want who spam me. - All my CVV are tested before sell, that's sure - I accept LR; WU or MoneyGram. - I only work with reliable buyers. Need good & serious buyer to business for a long time - I work with only one slogan: prestige and quality to satisfy my clients !!! - I was so happy to see you actually make more big money from the business with me Once you trust me, work with me. And if not trust,dont contact me, dont waste time! --------------------------THANKS, LOOK FORWARD TO WORKING WITH ALL of YOU !!!---------------------------- * Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts,Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers. CVV for shipping;booking airline ticket;shopping online;ordering Laptop,Iphone;... [Sell CVV; Dumps, track1&2; Bank logins; Paypal Accounts,Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Cards, ATM Card; MSR, ATM SKIMMERS. Do WU Transfers and Bank Transfers] * Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected] ===================== WESTERN UNION TRANSFER SERVICE ======================= We are Very PROFESSIONAL in WESTION UNION. Our Special Job Is this We Have big Western Union Service for everywhere and every when for you. We transfer money to all country in world. We can transfer big amount. And you can receive this money from your country. Our service accept payment 15% of transfer amount for small transfer . And 10% of big transfer. For large transfer . We make is very safe. And this service is very fast. We start to run software to make transfer to your WU info very fast,without delay and immediately. We give you MTCN and sender info and all cashout info, 15 mins after your payment complete. CONTACT US via Y!H: goodcvv_dumps or ICQ: 667686221 or Mail: [email protected] to know more info, price list of WU TRANSFER SERVICE ====================== Verified Paypal Accounts for sale ======================== If u are interested in it, contact me to know the price list & have the Tips for using above accounts safely,not be suspended when using accounts. I will not responsible if you get suspended. ===================== Dumps, Track1&2 with PIN & without PIN for ATM Cashout ======================= - Tracks 1&2 US;Tracks 1&2 UK;Tracks 1&2 CA,AU; Tracks 1&2 EU, with PIN and without PIN. - Dumps US; Dumps CA; Dumps EU; Dumps ASIA; Dumps AU, Brazil with good quality & price. Update Types of Dumps having now: Mix; Debit Classic; MC Standard;MC World; Gold; Platinum; Business/Corporate; Purchasing/Signature; Infinite - Contact me via Y!H: goodcvv_dumps (ICQ: 667686221) to know more info & price list of dumps, tracks ! ======================== Bank Logins Account (US UK CA AU EU) ======================== Sell Bank acc: Bank BOA, Bank HSBC USA, HSBC UK, Chase,Washovia, Halifax, Barclays, Abbey,... I make sure that my BANK LOGIN are security & easily to use. If u are interested in this, contact me to know more info about balance, price list,...! ================= Top-up Prepaid Cards, Debit Cards ========================= - If you hold any prepaid cards, debit cards, any country or any company. - I can top you funds into your prepaid cards, debit cards or any virtual cards. - top up your debit cards with hacked credit cards - top up your prepaid card with bank account login - top up you card with paypal account or any other - Have all tools to top your cards account - Top up does not take more then 10 minutes - Payoneer Cards top up available at cheap ================= Service: Provide Ebay - Apple - Amazon - Itunes GIFT CARD & Game Card with best price ===================== Contact me to negotiate about the price if buying bulk - PlayStation® Network Card - Xbox LIVE 12 Month Gold Membership = 30$ Xbox LIVE 4000 Microsoft Points = 30$ Zynga $50 Game Card (World Wide) = 30$ Ultimate game card 50$ = 30$ Ultimate game card 20$ = 10$ Key Diablo 3 = 25$ ITUNES GIFT CARD AMAZON GIFT CARD Ebay gift card Visa gift card ---------------- Our products are checked by a partner who works in a bank -------------------- Our products are better than 5-7 days after they are dead. They are raised mainly for money atm. Can be used in most countries. ---------------- Contact Via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected] ------------------------ Need good & serious buyer to business for a long time [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]] [Sell CVV, Dumps,track1&2; Bank logins; Paypal Accounts;Ebay Accounts; Mailpass; SMTP;RDP;VPS;CCN;SSN; Sell Amazon gift card & itunes gift card; Game Card, ATM Card, MSR, ATM SKIMMERS. Do WU Transfer and Bank Transfers....Contact via Y!H: goodcvv_dumps or ICQ: 667686221. Mail: [email protected]]

    Read the article

  • Scheme: Detecting duplicate elements in a list

    - by Kyle Krull
    Does R6RS or Chez Scheme v7.9.4 have a library function to check if a list contains duplicate elements? Alternatively, do either have any built in functionality for sets (which dis-allow duplicate elements)? So far, I've only been able to find an example here. The problem with that is that it doesn't appear to actually be part of the Chez Scheme library. Although I could write my own version of this, I'd much rather use a well known, tested, and maintained library function - especially given how basic an operation this is. So a simple "use these built-in functions" or a "no built-in library implements this" will suffice. Thanks!

    Read the article

  • What are modern and old compilers written in?

    - by ulum
    As a compiler, other than an interpreter, only needs to translate the input and not run it the performance of itself should be not that problematic as with an interpreter. Therefore, you wouldn't write an interpreter in, let's say Ruby or PHP because it would be far too slow. However, what about compilers? If you would write a compiler in a scripting language maybe even featuring rapid development you could possibly cut the source code and initial development time by halv, at least I think so. To be sure: With scripting language I mean interpreted languages having typical features that make programming faster, easier and more enjoyable for the programmer, usually at least. Examples: PHP, Ruby, Python, maybe JavaScript though that may be an odd choice for a compiler What are compilers normally written in? As I suppose you will respond with something low-level like C, C++ or even Assembler, why? Are there compilers written in scripting languages? What are the (dis)advantages of using low or high level programming languages for compiler writing?

    Read the article

  • Language Design: Combining Gotos and Functions

    - by sub
    I'm designing and currently rethinking a low-level interpreted programming language with similarities to assembler. I very soon came across the functions/loops/gotos decision problem and thought that while loops like while and for would be too high-level and unfitting, gotos would be too low level, unmaintainable and generally evil again. Functions like you know them from most languages that have return values and arguments aren't fitting in the language's concept either. So I tried to figure out something between a function and a goto which is capable of Recursion Efficient loops After some thinking I came up with the idea of subroutines: They have a beginning and an end like a function They have a name but no arguments like a goto You can go into one with jump and go out of it again before its end with return (doesn't give back any result, only stops the subroutine) Handled just like normal code - Global scope like goto So I wanted to know: Is the idea above good? What are the (dis)advantages? Would there be a better combination of function and goto or even a completely new idea?

    Read the article

  • Resulting .exe from PyInstaller with wxPython crashing

    - by Helgi Hrafn Gunnarsson
    I'm trying to compile a very simple wxPython script into an executable by using PyInstaller on Windows Vista. The Python script is nothing but a Hello World in wxPython. I'm trying to get that up and running as a Windows executable before I add any of the features that the program needs to have. But I'm already stuck. I've jumped through some loops in regards to MSVCR90.DLL, MSVCP90.DLL and MSVCPM90.DLL, which I ended up copying from my Visual Studio installation (C:\Program Files\Microsoft Visual Studio 9.0\VC\redist\x86\Microsoft.VC90.CRT). As according to the instructions for PyInstaller, I run: Command: Configure.py Output: I: computing EXE_dependencies I: Finding TCL/TK... I: could not find TCL/TK I: testing for Zlib... I: ... Zlib available I: Testing for ability to set icons, version resources... I: ... resource update available I: Testing for Unicode support... I: ... Unicode available I: testing for UPX... I: ...UPX available I: computing PYZ dependencies... So far, so good. I continue. Command: Makespec.py -F guitest.py Output: wrote C:\Code\PromoUSB\guitest.spec now run Build.py to build the executable Then there's the final command. Command: Build.py guitest.spec Output: checking Analysis building Analysis because out0.toc non existent running Analysis out0.toc Analyzing: C:\Python26\pyinstaller-1.3\support\_mountzlib.py Analyzing: C:\Python26\pyinstaller-1.3\support\useUnicode.py Analyzing: guitest.py Warnings written to C:\Code\PromoUSB\warnguitest.txt checking PYZ rebuilding out1.toc because out1.pyz is missing building PYZ out1.toc checking PKG rebuilding out3.toc because out3.pkg is missing building PKG out3.pkg checking ELFEXE rebuilding out2.toc because guitest.exe missing building ELFEXE out2.toc I get the resulting 'guitest.exe' file, but upon execution, it "simply crashes"... and there is no debug info. It's just one of those standard Windows Vista crashes. The script itself, guitest.py runs just fine by itself. It only crashes as an executable, and I'm completely lost. I don't even know what to look for, since nothing I've tried has returned any relevant results. Another file is generated as a result of the compilation process, called 'warnguitest.txt'. Here are its contents. W: no module named posix (conditional import by os) W: no module named optik.__all__ (top-level import by optparse) W: no module named readline (delayed, conditional import by cmd) W: no module named readline (delayed import by pdb) W: no module named pwd (delayed, conditional import by posixpath) W: no module named org (top-level import by pickle) W: no module named posix (delayed, conditional import by iu) W: no module named fcntl (conditional import by subprocess) W: no module named org (top-level import by copy) W: no module named _emx_link (conditional import by os) W: no module named optik.__version__ (top-level import by optparse) W: no module named fcntl (top-level import by tempfile) W: __all__ is built strangely at line 0 - collections (C:\Python26\lib\collections.pyc) W: delayed exec statement detected at line 0 - collections (C:\Python26\lib\collections.pyc) W: delayed conditional __import__ hack detected at line 0 - doctest (C:\Python26\lib\doctest.pyc) W: delayed exec statement detected at line 0 - doctest (C:\Python26\lib\doctest.pyc) W: delayed conditional __import__ hack detected at line 0 - doctest (C:\Python26\lib\doctest.pyc) W: delayed __import__ hack detected at line 0 - encodings (C:\Python26\lib\encodings\__init__.pyc) W: __all__ is built strangely at line 0 - optparse (C:\Python26\pyinstaller-1.3\optparse.pyc) W: __all__ is built strangely at line 0 - dis (C:\Python26\lib\dis.pyc) W: delayed eval hack detected at line 0 - os (C:\Python26\lib\os.pyc) W: __all__ is built strangely at line 0 - __future__ (C:\Python26\lib\__future__.pyc) W: delayed conditional __import__ hack detected at line 0 - unittest (C:\Python26\lib\unittest.pyc) W: delayed conditional __import__ hack detected at line 0 - unittest (C:\Python26\lib\unittest.pyc) W: __all__ is built strangely at line 0 - tokenize (C:\Python26\lib\tokenize.pyc) W: __all__ is built strangely at line 0 - wx (C:\Python26\lib\site-packages\wx-2.8-msw-unicode\wx\__init__.pyc) W: __all__ is built strangely at line 0 - wx (C:\Python26\lib\site-packages\wx-2.8-msw-unicode\wx\__init__.pyc) W: delayed exec statement detected at line 0 - bdb (C:\Python26\lib\bdb.pyc) W: delayed eval hack detected at line 0 - bdb (C:\Python26\lib\bdb.pyc) W: delayed eval hack detected at line 0 - bdb (C:\Python26\lib\bdb.pyc) W: delayed __import__ hack detected at line 0 - pickle (C:\Python26\lib\pickle.pyc) W: delayed __import__ hack detected at line 0 - pickle (C:\Python26\lib\pickle.pyc) W: delayed conditional exec statement detected at line 0 - iu (C:\Python26\pyinstaller-1.3\iu.pyc) W: delayed conditional exec statement detected at line 0 - iu (C:\Python26\pyinstaller-1.3\iu.pyc) W: delayed eval hack detected at line 0 - gettext (C:\Python26\lib\gettext.pyc) W: delayed __import__ hack detected at line 0 - optik.option_parser (C:\Python26\pyinstaller-1.3\optik\option_parser.pyc) W: delayed conditional eval hack detected at line 0 - warnings (C:\Python26\lib\warnings.pyc) W: delayed conditional __import__ hack detected at line 0 - warnings (C:\Python26\lib\warnings.pyc) W: __all__ is built strangely at line 0 - optik (C:\Python26\pyinstaller-1.3\optik\__init__.pyc) W: delayed exec statement detected at line 0 - pdb (C:\Python26\lib\pdb.pyc) W: delayed conditional eval hack detected at line 0 - pdb (C:\Python26\lib\pdb.pyc) W: delayed eval hack detected at line 0 - pdb (C:\Python26\lib\pdb.pyc) W: delayed conditional eval hack detected at line 0 - pdb (C:\Python26\lib\pdb.pyc) W: delayed eval hack detected at line 0 - pdb (C:\Python26\lib\pdb.pyc) I don't know what the heck to make of any of that. Again, my searches have been fruitless.

    Read the article

  • PHP - a different open_basedir per each virtual host

    - by Lopoc
    Hi I've came across on this problem, I have a sever running apache and php. We have many virtual hosts but we've noticed that a potentially malicious user could use his web space to browse other user's files(via a simple php script) and even system files, this could happens due to the php permissions. A way to avoid it is to set the open_basedir var in php.ini, yhis is very simple in a single host system, but in case of virtual hosts there would be a basebir per each host. Ho can I set dis basedir per each user/host? is there a way to let apache hereditate php privileges of the php file that has been requested E.G. /home/X_USER/index.php has as owner X_USER, when apache read the file index.php it checks its path and owner, simply I'm looking for a system set php basedir variable to that path. Thank in advance Lopoc

    Read the article

  • Why my application ask for a codec to pla the MVI(.MOV) video files while i can play them on WMP and QuickTime?

    - by Daniel Lip
    I have an application i did some time ago when im loading the video file its ok when trying to play/use the file im getting the messageBox message say that its need a codec to use gspot or search the internet. Wehn im playing this files on my hard disk with Windows Media Play or either QuickTime there is no problems. The Video files for example name are: MVI_2483 in the file name properties i see its type: Quick Time Movie (.MOV) In my application im using DirectShowLib-2005.dll this is the class im using in my case to extract the video file im using it in my application to extract only lightnings from the video file name. In Form1 i have a button click event that just starting the action: private void button8_Click(object sender, EventArgs e) { viewToolStripMenuItem.Enabled = false; fileToolStripMenuItem.Enabled = false; button2.Enabled = false; label14.Visible = false; label15.Visible = false; label21.Visible = false; label22.Visible = false; label24.Visible = false; label25.Visible = false; ExtractAutomatic = true; DirectoryInfo info = new DirectoryInfo(_videoFile); string dirName = info.Name; automaticModeDirectory = dirName + "_Automatic"; subDirectoryName = _outputDir + "\\" + automaticModeDirectory; if (secondPass == true) { Start(true); } Start(false); } This is the function start in Form1: private void Start(bool secondpass) { setpicture(-1); if (Directory.Exists(_outputDir) && secondpass == false) { } else { Directory.CreateDirectory(_outputDir); } if (ExtractAutomatic == true) { string subDirectory_Automatic_Name = _outputDir + "\\" + automaticModeDirectory; Directory.CreateDirectory(subDirectory_Automatic_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Automatic_Name)); } else { string subDirectory_Manual_Name; if (Directory.Exists(subDirectoryName)) { subDirectory_Manual_Name = subDirectoryName; f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } else { subDirectory_Manual_Name = _outputDir + "\\" + averagesListTextFileDirectory + "_Manual"; Directory.CreateDirectory(subDirectory_Manual_Name); f = new WmvAdapter(_videoFile, Path.Combine(subDirectory_Manual_Name)); } } button1.Enabled = false; f.Secondpass = secondpass; f.FramesToSave = _fts; f.FrameCountAvailable += new WmvAdapter.FrameCountEventHandler(f_FrameCountAvailable); f.StatusChanged += new WmvAdapter.EventHandler(f_StatusChanged); f.ProgressChanged += new WmvAdapter.ProgressEventHandler(f_ProgressChanged); this.Text = "Processing Please Wait..."; label5.ForeColor = Color.Green; label5.Text = "Processing Please Wait"; button8.Enabled = false; button5.Enabled = false; label5.Visible = true; pictureBox1.Image = Lightnings_Extractor.Properties.Resources.Weather_Michmoret; Hrs = 0; //number of hours Min = 0; //number of Minutes Sec = 0; //number of Sec timeElapsed = 0; label10.Text = "00:00:00"; label11.Visible = false; label12.Visible = false; label9.Visible = false; label8.Visible = false; this.button1.Enabled = false; myTrackPanelss1.trackBar1.Enabled = false; this.checkBox2.Enabled = false; this.checkBox1.Enabled = false; numericUpDown1.Enabled = false; timer1.Start(); label2.Text = ""; label1.Visible = true; label2.Visible = true; label3.Visible = true; label4.Visible = true; f.Start(); } And this is the class wich is not my oqn class i just just defined it in some places wich making the problem: using System; using System.Diagnostics; using System.Drawing; using System.Drawing.Imaging; using System.IO; using System.Runtime.InteropServices; using DirectShowLib; using System.Collections.Generic; using Extracting_Frames; using System.Windows.Forms; namespace Polkan.DataSource { internal class WmvAdapter : ISampleGrabberCB, IDisposable { #region Fields_Properties_and_Events bool dis = false; int count = 0; const string fileName = @"d:\histogramValues.dat"; private IFilterGraph2 _filterGraph; private IMediaControl _mediaCtrl; private IMediaEvent _mediaEvent; private int _width; private int _height; private readonly string _outFolder; private int _frameId; //better use a custom EventHandler that passes the results of the action to the subscriber. public delegate void EventHandler(object sender, EventArgs e); public event EventHandler StatusChanged; public delegate void FrameCountEventHandler(object sender, FrameCountEventArgs e); public event FrameCountEventHandler FrameCountAvailable; public delegate void ProgressEventHandler(object sender, ProgressEventArgs e); public event ProgressEventHandler ProgressChanged; private IMediaSeeking _mSeek; private long _duration = 0; private long _avgFrameTime = 0; //just save the averages to a List (not to fs) public List<double> AveragesList { get; set; } public List<long> histogramValuesList; public bool Secondpass { get; set; } public List<int> FramesToSave { get; set; } #endregion #region Constructors and Destructors public WmvAdapter(string file, string outFolder) { _outFolder = outFolder; try { SetupGraph(file); } catch { Dispose(); MessageBox.Show("A codec is required to load this video file. Please use http://www.headbands.com/gspot/ or search the web for the correct codec"); } } ~WmvAdapter() { CloseInterfaces(); } #endregion public void Dispose() { CloseInterfaces(); } public void Start() { EstimateFrameCount(); int hr = _mediaCtrl.Run(); WaitUntilDone(); DsError.ThrowExceptionForHR(hr); } public void WaitUntilDone() { int hr; const int eAbort = unchecked((int)0x80004004); do { System.Windows.Forms.Application.DoEvents(); EventCode evCode; if (dis == true) { return; } hr = _mediaEvent.WaitForCompletion(100, out evCode); }while (hr == eAbort); DsError.ThrowExceptionForHR(hr); OnStatusChanged(); } //Edit: added events protected virtual void OnStatusChanged() { if (StatusChanged != null) StatusChanged(this, new EventArgs()); } protected virtual void OnFrameCountAvailable(long frameCount) { if (FrameCountAvailable != null) FrameCountAvailable(this, new FrameCountEventArgs() { FrameCount = frameCount }); } protected virtual void OnProgressChanged(int frameID) { if (ProgressChanged != null) ProgressChanged(this, new ProgressEventArgs() { FrameID = frameID }); } /// <summary> build the capture graph for grabber. </summary> private void SetupGraph(string file) { ISampleGrabber sampGrabber = null; IBaseFilter capFilter = null; IBaseFilter nullrenderer = null; _filterGraph = (IFilterGraph2)new FilterGraph(); _mediaCtrl = (IMediaControl)_filterGraph; _mediaEvent = (IMediaEvent)_filterGraph; _mSeek = (IMediaSeeking)_filterGraph; var mediaFilt = (IMediaFilter)_filterGraph; try { // Add the video source int hr = _filterGraph.AddSourceFilter(file, "Ds.NET FileFilter", out capFilter); DsError.ThrowExceptionForHR(hr); // Get the SampleGrabber interface sampGrabber = new SampleGrabber() as ISampleGrabber; var baseGrabFlt = sampGrabber as IBaseFilter; ConfigureSampleGrabber(sampGrabber); // Add the frame grabber to the graph hr = _filterGraph.AddFilter(baseGrabFlt, "Ds.NET Grabber"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the file filter to the sample grabber // Hopefully this will be the video pin, we could check by reading it's mediatype IPin iPinOut = DsFindPin.ByDirection(capFilter, PinDirection.Output, 0); // Get the input pin from the sample grabber IPin iPinIn = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Add the null renderer to the graph nullrenderer = new NullRenderer() as IBaseFilter; hr = _filterGraph.AddFilter(nullrenderer, "Null renderer"); DsError.ThrowExceptionForHR(hr); // --------------------------------- // Connect the sample grabber to the null renderer iPinOut = DsFindPin.ByDirection(baseGrabFlt, PinDirection.Output, 0); iPinIn = DsFindPin.ByDirection(nullrenderer, PinDirection.Input, 0); hr = _filterGraph.Connect(iPinOut, iPinIn); DsError.ThrowExceptionForHR(hr); // Turn off the clock. This causes the frames to be sent // thru the graph as fast as possible hr = mediaFilt.SetSyncSource(null); DsError.ThrowExceptionForHR(hr); // Read and cache the image sizes SaveSizeInfo(sampGrabber); //Edit: get the duration hr = _mSeek.GetDuration(out _duration); DsError.ThrowExceptionForHR(hr); } finally { if (capFilter != null) { Marshal.ReleaseComObject(capFilter); } if (sampGrabber != null) { Marshal.ReleaseComObject(sampGrabber); } if (nullrenderer != null) { Marshal.ReleaseComObject(nullrenderer); } GC.Collect(); } } private void EstimateFrameCount() { try { //1sec / averageFrameTime double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); OnFrameCountAvailable((long)frameCount); } catch { } } public double framesCounts() { double fr = 10000000.0 / _avgFrameTime; double frameCount = fr * (_duration / 10000000.0); return frameCount; } private void SaveSizeInfo(ISampleGrabber sampGrabber) { // Get the media type from the SampleGrabber var media = new AMMediaType(); int hr = sampGrabber.GetConnectedMediaType(media); DsError.ThrowExceptionForHR(hr); if ((media.formatType != FormatType.VideoInfo) || (media.formatPtr == IntPtr.Zero)) { throw new NotSupportedException("Unknown Grabber Media Format"); } // Grab the size info var videoInfoHeader = (VideoInfoHeader)Marshal.PtrToStructure(media.formatPtr, typeof(VideoInfoHeader)); _width = videoInfoHeader.BmiHeader.Width; _height = videoInfoHeader.BmiHeader.Height; //Edit: get framerate _avgFrameTime = videoInfoHeader.AvgTimePerFrame; DsUtils.FreeAMMediaType(media); GC.Collect(); } private void ConfigureSampleGrabber(ISampleGrabber sampGrabber) { var media = new AMMediaType { majorType = MediaType.Video, subType = MediaSubType.RGB24, formatType = FormatType.VideoInfo }; int hr = sampGrabber.SetMediaType(media); DsError.ThrowExceptionForHR(hr); DsUtils.FreeAMMediaType(media); GC.Collect(); hr = sampGrabber.SetCallback(this, 1); DsError.ThrowExceptionForHR(hr); } private void CloseInterfaces() { try { if (_mediaCtrl != null) { _mediaCtrl.Stop(); _mediaCtrl = null; dis = true; } } catch (Exception ex) { Debug.WriteLine(ex); } if (_filterGraph != null) { Marshal.ReleaseComObject(_filterGraph); _filterGraph = null; } GC.Collect(); } int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { if (Form1.ExtractAutomatic == true) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { long[] HistogramValues = Form1.GetHistogram(bitmap); long t = Form1.GetTopLumAmount(HistogramValues, 1000); Form1.averagesTest.Add(t); } else { //this is the changed part if (_frameId > 0) { if (Form1.averagesTest[_frameId] / 1000.0 - Form1.averagesTest[_frameId - 1] / 1000.0 > 150.0) { count = 6; } if (count > 0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); count --; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } else { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); //***************************\\ //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } } return 0; } /* int ISampleGrabberCB.SampleCB(double sampleTime, IMediaSample pSample) { Marshal.ReleaseComObject(pSample); return 0; } int ISampleGrabberCB.BufferCB(double sampleTime, IntPtr pBuffer, int bufferLen) { using (var bitmap = new Bitmap(_width, _height, _width * 3, PixelFormat.Format24bppRgb, pBuffer)) { if (!this.Secondpass) { //get avg double average = GetAveragePixelValue(bitmap); if (AveragesList == null) AveragesList = new List<double>(); //save avg AveragesList.Add(average); //***************************\\ // for (int i = 0; i < (int)framesCounts(); i++) // { // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); long t = Form1.GetTopLumAmount(HistogramValues, 1000); //***************************\\ Form1.averagesTest.Add(t); // to add this list to a text file or binary file and read the averages from the file when its is Secondpass !!!!! //} } else { if (FramesToSave != null && FramesToSave.Contains(_frameId)) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); // get histogram values long[] HistogramValues = Form1.GetHistogram(bitmap); if (histogramValuesList == null) histogramValuesList = new List<long>(256); histogramValuesList.AddRange(HistogramValues); using (BinaryWriter binWriter = new BinaryWriter(File.Open(fileName, FileMode.Create))) { for (int i = 0; i < histogramValuesList.Count; i++) { binWriter.Write(histogramValuesList[(int)i]); } binWriter.Close(); } } for (int x = 1; x < Form1.averagesTest.Count; x++) { double fff = Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0; if (Form1.averagesTest[x] / 1000.0 - Form1.averagesTest[x - 1] / 1000.0 > 180.0) { bitmap.RotateFlip(RotateFlipType.Rotate180FlipX); bitmap.Save(Path.Combine(_outFolder, _frameId.ToString("D6") + ".bmp")); _frameId++; } } } _frameId++; //let only report each 100 frames for performance if (_frameId % 100 == 0) OnProgressChanged(_frameId); } return 0; }*/ private unsafe double GetAveragePixelValue(Bitmap bmp) { BitmapData bmData = null; try { bmData = bmp.LockBits(new Rectangle(0, 0, bmp.Width, bmp.Height), ImageLockMode.ReadOnly, PixelFormat.Format24bppRgb); int stride = bmData.Stride; IntPtr scan0 = bmData.Scan0; int w = bmData.Width; int h = bmData.Height; double sum = 0; long pixels = bmp.Width * bmp.Height; byte* p = (byte*)scan0.ToPointer(); for (int y = 0; y < h; y++) { p = (byte*)scan0.ToPointer(); p += y * stride; for (int x = 0; x < w; x++) { double i = ((double)p[0] + p[1] + p[2]) / 3.0; sum += i; p += 3; } //no offset incrementation needed when getting //the pointer at the start of each row } bmp.UnlockBits(bmData); double result = sum / (double)pixels; return result; } catch { try { bmp.UnlockBits(bmData); } catch { } } return -1; } } public class FrameCountEventArgs { public long FrameCount { get; set; } } public class ProgressEventArgs { public int FrameID { get; set; } } } I remember i had this codec problem/s before and i installed the codec/'s that were needed but in this case both quick time and windows media player can play the video files so why the application cant detect and find the codec/'s on my computer ? Gspot say that the codec is AVC1 but again wmp and quicktime play the video files no problems. The video files are from my digital camera !

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • onclickView not working...runuithread solution????

    - by nivedita
    hi..i m new to android....i m stuck at a point would really appreciate if ne1 cn help pls.. i m developing an pp which has grid of colored rectangles..made changing the background of textView..dere are 3 buttons which cause the backgroundcolor to change according to some algo..n 2 textview which show the current sts f game now the problem is i hv button example (one f the three buttons) which chnges example.setOnClickListener (new Button.OnClickListener() {public void onClick(View v) { status_val.setText("true board-example working"); level_1_true(); } } ); level_1_true();-sets background color f rectangles dis above code results in "activity not responding"..ie onclick listner does not change the view. someone suggested me runonuithread..but i cnt get how n what to do.. how do i change the d view of screen by clicking the button???

    Read the article

  • "Compiling" content with short tags to var, without eval()

    - by Spot
    To start off, let me clear the air by saying we are aware of the dis/advantages to using short tag syntax in PHP. That is not what this question is about. Is there a way to "include" a file containing short tag code, into a variable, and have PHP actually parse the code? include/require obviously do not provide the data in a workable form, and output buffering does not parse the short tag code because it happens at runtime. Using eval() is simply not an option. Suggestions?

    Read the article

  • Sub reports find the sub total and grand total of each sub report in the main report

    - by sonia
    i want to find the grand total from sub report subtotal. i have three subreports. 1. itemreport 2.laborreport 3. machine report. i have find total of that reports using shared variable. like using formula: shared numbervar totalitem=sum({storedprocedrename.columnname}) i have done dis in all the sbreports. now i m want the grand total of all these. i have written the formula in main report is: shared numbervar totalitem; // same variable used in subreport item shared numbervar labtotal; // same variable sed in subreport labor shared numbervar machinetotal; // same variable used in subreport machine numbervar total; total=totalitem+labtotal+machinetotal; total but it is not giving correct result.. it is not giving result in correct format plz tell me code of main report in detail.. thanks

    Read the article

  • Tcp Socket Closed

    - by Michael Covelli
    I always thought that if you didn't implement a heartbeat, there was no way to know if one side of a TCP connection died unexpectedly. If the process was just killed on one side and didn't exit gracefully, there was no way for the socket to send FIN or let the other side know that it was closed. (See some of the comments here for example http://www.perlmonks.org/?node_id=566568 ) But there is a stock order server that I connect to that has a new "cancel all orders on disconnect feature" that cancels live orders if the client dis-connects. It works even when I kill the process on my end, and there is definitely no heartbeat from my app to it. So how is it able to detect when I've killed the process? My app is running on Windows Server 2003 and the order server is on Suse Linux Enterprise Server 10. Does Windows detect that the process associated with the socket is no longer alive and send the FIN?

    Read the article

  • Building FFmpeg for Android

    - by varevarao
    I've spent almost a week on this now, trying to get FFmpeg "Angel" to build for Android. I've tried build scripts from all over the internet to no avail. I got closest was using this. A sthe author himself says the script doesn't work for newer versions of FFmpeg due to this bug, which has been dismissed on that ticket saying "I found a Makefile that does it." This was dis-heartening, being the only post on all of the cast Google world that was anywhere close to my problem. So, question time: Is there a way to get around the above bug? I'm trying to use the newest ffmpeg API, and "Love" is just giving me "undefined reference" errors while trying to use av_encode_video2(), and av_free_frame(). The code I was working on the lines of is at the ffmpeg git repo, under /doc/examples/decoding_encoding.c (the function starting on line 338)

    Read the article

  • how to parse from command line arguements in yacc ?

    - by user205688
    how to parse from command line arguements in yacc ? of course i undefined input in both lex & yacc and then wrote int input(void) { printf("in input\n:"); char c; if(target > limit) return 0; if((c = target[0][offset++]) != '\0') return (c); target++; offset =0; return (' '); } where target contains the command line arguements. But only the standard input is getting excueted how to make dis input function get executed.

    Read the article

< Previous Page | 1 2 3 4 5 6 7  | Next Page >