Search Results

Search found 18756 results on 751 pages for 'generate images'.

Page 516/751 | < Previous Page | 512 513 514 515 516 517 518 519 520 521 522 523  | Next Page >

• Facebook like on demand meta content scraper

  - by Tobias

  you guys ever saw that FB scrapes the link you post on facebook (status, message etc.) live right after you paste it in the link field and displays various metadata, a thumb of the image, various images from the a page link or a video thumb from a video related link (like youtube). any ideas how one would copy this function? i'm thinking about a couple gearman workers or even better just javascript that does a xhr requests and parses the content based on regex's or something similar... any ideas? any links? did someone already tried to do the same and wrapped it in a nice class? anything? :) thanks!

  Read the article

• Reasons to learn MSIL

  - by mannu

  Hi, Learning MSIL is fun and all that. Understanding what is going on "under the hood" can in many ways improve how you write your code performance-wise. However, the IL that is produced by the compiler is quite verbose and does not tell the whole story since JIT will optimize away a lot of the code. I, personally, have had good use of my very basic IL understanding when I've had to make a small fix in an assembly I do not have the source code for. But, I could as well have used Reflector to generate C# code. I would like to know if you've ever had good use of MSIL understanding and/or why you think it is worth learning it (except for the fun in it, of course). I'd also like to know if you think one should not learn it and why.

  Read the article

• Web-based document merge solution?

  - by rugcutter

  We are looking for a web-based document merge solution. Our application is a web-based project management tool built using Xataface - PHP on Windows IIS + mySQL. We have a function that allows the user to generate a status report in Microsoft Word format based on data in the tool. Currently this function is implemented using LiveDocX. We have a status report template, and LiveDocX performs the merge into the template using data from our project management tool. The main drawback is LiveDocx is web-service based. We are looking to replace LiveDocX in order to reduce our dependence on the up-time of a third-party web-service that we cannot control. Does anyone have any suggestions on a web based document merge solution that I can install on my IIS or PHP based server?

  Read the article

• Refreshing a binding that uses a value converter

  - by Hadi Eskandari

  I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

  Read the article

• Rails: Generated tokens missing occasionally

  - by Vincent Chan

  We generate an unique token for each user and store it on database. Everything is working fine in the local environment. However, after we upload the codes to the production server on Engine Yard, things become weird. We tried to register an account right after the deploy. It is working fine and we can see the token in the db. But after that, when we register new accounts, we cannot see any tokens. We only have NULL in the db. Not sure what caused this problem because we can't re-produce this in the local machine. Thanks for your help.

  Read the article

• Future proof Primary Key design in postgresql

  - by John P

  I've always used either auto_generated or Sequences in the past for my primary keys. With the current system I'm working on there is the possibility of having to eventually partition the data which has never been a requirement in the past. Knowing that I may need to partition the data in the future, is there any advantage of using UUIDs for PKs instead of the database's built-in sequences? If so, is there a design pattern that can safely generate relatively short keys (say 6 characters instead of the usual long one e6709870-5cbc-11df-a08a-0800200c9a66)? 36^6 keys per-table is more than sufficient for any table I could imagine. I will be using the keys in URLs so conciseness is important.

  Read the article

• Are TestContext.Properties read only ?

  - by DBJDBJ

  Using Visual Studio generate Test Unit class. Then comment out class initialization method. Inside it add your property, using the testContext argument. //Use ClassInitialize to run code before running the first test in the class [ClassInitialize()] public static void MyClassInitialize(TestContext testContext) { /* * Any user defined testContext.Properties * added here will be erased upon this method exit */ testContext.Properties.Add("key", 1 ) ; // above works but is lost } After leaving MyClassInitialize, properties defined by user are lost. Only the 10 "official" ones are left. This effectively means TestContext.Properties is read only, for users. Which is not clearly documented in MSDN. Please discuss. --DBJ

  Read the article

• Image surrounded by text in WPF

  - by niao

  Greetings, I have some control which display bunch of textblocks and image. I would like the image to be surrounded by text. I have already implemented some functionality by using FlowDocument and custom bindable run control. (These controls are included inside user control). When I generate lots of these controls in treeview, application goes into infinite loop. I asked on forums before about this problem and the answer was that it can be WPF issue. Howver when I removed bindable run from my user control, problem dissappeared. Now I am trying to implement other solution where image will be surrounded by text. Can someone please help me? EDIT: Generally i would like to achieve something like this

  Read the article

• ImageMagick and Grails not working

  - by TripWired

  I'm trying to have ImageMagick run from grails to convert some images when I run the command to make an image nothing happens. I get no errors, no information returned nothing at all. I've tried running other commands like touch and ps ux just to see if they work and they all work fine. It just seems like the imagemagick commands are getting lost and I''m not sure what to do. Here is the code I've been working with. String command = CH.config.ImageMagickPath + "/convert -size 40x20 xc:red xc:blue -append -rotate 90 append_rotate.gif" println command command.execute() CH.config.ImageMagickPath is set up to where imagemagick/bin is. I've taken what is shown in println command and run it in a terminal and it works fine. Is there any reason why I can't get IM to work from grails?

  Read the article

• QScrollArea widget content promoted to QWidget

  - by ocell

  Hi folks, First of all, thanks for you time reading my question. I created my own Qt Widget (parent of QWidget) and has a QImage "inside" to manipulate images. The problem I have is the following: when I promote the content of a QScrollArea to my widget, the scroll features doesn't works; I haven't any scroll bar or I can't see any result when I use the method 'ensureVisible(..)'. Please can you tell me if I need to overload or override any method in my own widget. Regards and thanks in advance, Oscar.

  Read the article

• onclick event not working after ie7 reload

  - by Charles

  I am using Javascript to dynamically create part of my page content. A routine that generates a set of img tags is called from the window.onload event. Those img tags are assigned attributes, including an onclick event. The img tags host thumbnail images that, when clicked, change the src property of the image in the main view div. Everything works properly in FF 3.5. I can reload the page and the dynamically generated onclick events continue to fire as expected. In IE7 everything works normally until I reload the page. At that point events that were hard coded into the xhtml section continue to work as expected, and the dynamically generated img tags are shown on the page, but their onclick events fail to work. How can I get IE7 to implement the dynamically generated click events on reload?

  Read the article

• Can we represent bit fields in JSON/BSON?

  - by zubair

  We have a dozen simulators talking to each other on UDP. The interface definition is managed in a database. The simulators are written using different languages; mostly C++, some in Java and C#. Currently, when systems engineer makes changes in the interface definition database, simulator developers manually update the communication data structures in their code. The data is mostly 2-5 bytes with bit fields for each signal. What I want to do is to generate one file from interface definition database describing byte and bit field definitions and let each developer add it to his simulator code with minimal fuss. I looked at JSON/BSON but couldn't find a way to represent bit fields in it. Thanks Zubair

  Read the article

• What algorithm can calculate the power set of a given set?

  - by ross

  I would like to efficiently generate a unique list of combinations of numbers based on a starting list of numbers. example start list = [1,2,3,4,5] but the algorithm should work for [1,2,3...n] result = [1],[2],[3],[4],[5] [1,2],[1,3],[1,4],[1,5] [1,2,3],[1,2,4],[1,2,5] [1,3,4],[1,3,5],[1,4,5] [2,3],[2,4],[2,5] [2,3,4],[2,3,5] [3,4],[3,5] [3,4,5] [4,5] Note. I don't want duplicate combinations, although I could live with them, eg in the above example I don't really need the combination [1,3,2] because it already present as [1,2,3]

  Read the article

• ASP.NET MVC thinks my virtual directory is a controller

  - by kmehta

  I have a virtual directory under my MVC website in IIS called "Files". This directory is at the same level as my Views directory. When I link to a file from my MVC app to a file under my Files directory, I get the following error: The controller for path '/Files/Images/1c7f7eb8-5d66-4bca-a73a-4ba6340a7805.JPG' was not found or does not implement IController. It thinks that my Files VD is a controller. How do I access my files like a normal VD without MVC interfering? Thanks.

  Read the article

• Python Imaging: YCbCr problems

  - by daver

  Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

  Read the article

• Probability Random Number Generator

  - by Excl

  Let's say I'm writing a simple luck game - each player presses Enter and the game assign him a random number between 1-6. Just like a cube. At the end of the game, the player with the highest number wins. Now, let's say I'm a cheater. I want to write the game so player #1 (which will be me) has a probability of 90% to get six, and 2% to get each of the rest numbers (1, 2, 3, 4, 5). So, how can I generate a number random, and set the probability for each number? Thanks.

  Read the article

• Showing a loading spinner only if the data has not been cached.

  - by Aaron Mc Adam

  Hi guys, Currently, my code shows a loading spinner gif, returns the data and caches it. However, once the data has been cached, there is a flicker of the loading gif for a split second before the data gets loaded in. It's distracting and I'd like to get rid of it. I think I'm using the wrong method in the beforeSend function here: $.ajax({ type : "GET", cache : false, url : "book_data.php", data : { keywords : keywords, page : page }, beforeSend : function() { $('.jPag-pages li:not(.cached)').each(function (i) { $('#searchResults').html('<p id="loader">Loading...<img src="../assets/images/ajax-loader.gif" alt="Loading..." /></p>'); }); }, success : function(data) { $('.jPag-current').parent().addClass('cached'); $('#searchResults').replaceWith($(data).find('#searchResults')).find('table.sortable tbody tr:odd').addClass('odd'); detailPage(); selectForm(); } });

  Read the article

• NHibernate WCF Bidirectional and Lazy loading

  - by ChrisKolenko

  Hi everyone, I'm just looking for some direction when it comes to NHibernate and WCF. At the moment i have a many to one association between a person and address. The first problem. I have to eager load the list of addresses so it doesn't generate a lazy loaded proxy. Is there a way to disable lazy loading completely? I never want to see it generated. The second problem. The bidirectional association between my poco's is killing my standard serialization. What's the best way forward. Should I remove the Thanks for all your help

  Read the article

• Un-readable files uploaded via PHP FTP functions

  - by Mike

  I just setup a LAMP development server and am still trouble-shooting some things. The server is installed on one computer and I use a Windows laptop to write my code and test the site via the web browser. My file uploading script works in that JPEG image files are successfully uploaded to the server, but when I try to view the images in the web browser, permission is denied. I check the permissions on the file via the server and they are 600. I can fix the issue by chmod 777 theimage.jpg, but this doesn't seem like a good solution at all. Does the solution have something to do with Apache configuration? Or is there something else I should be doing. Thank-you, Mike

  Read the article

• MVC Implementation PHP Zend PDF generation

  - by zod

  Am using Zend framework and PHP Am going to generate a PDF using Zend . So the View is PDF.There is no PHTML. But if i dont use PHTML in view , is it a perfect MVC? if i want to be a perfect MVC shall i do the db retrieval and variable declaration and assigning in controller and use view and use all pdf functions in view phtml file will it make a perfect MVC? What is the advantage of MVC in this case? :-) can i do the include of zend pdf in phtml file or controller php file? what is the difference ?

  Read the article

• Math with interpolated variables?

  - by Idan Gazit

  Consider the following sass: $font-size: 18; $em: $font-size; $column: $font-size * 3; // The column-width of my grid in pixels $gutter: $font-size * 1; // The gutter-width of my grid in pixels $gutter-em: #{$gutter / $em}em; // The gutter-width in ems. $column-em: #{$column / $em}em; // The column-width in ems; $foo = $gutter-em / 2; // This results in a value like "1em/2". :( $bar = ($gutter-em / 2); // this doesn't work either, same as above. How can I generate a $foo that works, and that I can reuse further in other expressions?

  Read the article

• Nerd Dinner - labels for textfields are broken

  - by AspNewbie

  Hello. I am trying to learn ASP.NET (since I know C#) so I have decided to follow Nerd Dinner Tutorial. I am having trouble in part 5 of tutorial. I exactly followed tutorial, even pasted whole code to my visual studio, but when I was supposed to create EDIT VIEW, my result was different than one in tutorial. Please take a look at following pictures and think, where might problem be. I did not customise anything, everything is default. Please look at the images below (I cant upload them here directly or post more than one hyperlink,system says I need to have reputation points) shttp://i49.tinypic.com/wweooi.png shttp://i46.tinypic.com/21oaufd.jpg NOTE : Please remove "S" letter before HTTP, or I hope there will be kind moderator to do so and remove my NOTE

  Read the article

• Changing <img src="XXX" />, js event when new image has finished loading?

  - by carillonator

  I have a photo gallery web page where a single <img src="XXX" /> element's src is changed (on a click) with javascript to show the next image—a poor man's ajax I guess. Works great on faster connections when the new image appears almost immediately. Even if it takes a few seconds to load, every browser I've tested it on keeps the old image in place until the new one is completely loaded. It's a little confusing waiting those few seconds on a slow connection, though, and I'm wondering if there's some javascript event that fires when the new image is done loading, allowing me to put a little working... animated gif or something up in the meantime. I know I could use AJAX for real (I'm using jQuery already), but this is such a nice and simple solution. Besides this lag, is there any other reason I should stay away from this approach to changing images? thanks.

  Read the article

• Creating combinations that have no more one intersecting element

  - by khuss

  I am looking to create a special type of combination in which no two sets have more than one intersecting element. Let me explain with an example: Let us say we have 9 letter set that contains A, B, C, D, E, F, G, H, and I If you create the standard non-repeating combinations of three letters you will have 9C3 sets. These will contain sets like ABC, ABD, BCD, etc. I am looking to create sets that have at the most only 1 common letter. So in this example, we will get following sets: ABC, ADG, AEI, AFH, BEH, BFG, BDI, CFI, CDH, CEG, DEF, and GHI - note that if you take any two sets there are no more than 1 repeating letter. What would be a good way to generate such sets? It should be scalable solution so that I can do it for a set of 1000 letters, with sub set size of 4. Any help is highly appreciated. Thanks

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

< Previous Page | 512 513 514 515 516 517 518 519 520 521 522 523  | Next Page >