Search Results

Search found 46178 results on 1848 pages for 'java home'.

Page 516/1848 | < Previous Page | 512 513 514 515 516 517 518 519 520 521 522 523  | Next Page >

  • How to determine JAVA_HOME on Debian/Ubuntu?

    - by Witek
    On Ubuntu it is possible to have multiple JVMs at the same time. The default one is selected with update-alternatives. But this does not set the JAVA_HOME environment variable, due to a debian policy. I am writing a launcher script (bash), which starts a java application. This java application needs the JAVA_HOME environment variable. So how to get the path of the JVM which is currently selected by update-alternatives?

    Read the article

  • Error:Unable to acsess jarfile

    - by user2539617
    Whenever I turn on my HP Pavilion slimline (type of computer) it says Error:Unable to acsess jarfile C:/Users/Private/Appdata/RoamingServer258261055 The tab name is Java Virtual Machine Launcher Somehow. This effects me connecting to java programs that require online on a downloaded platform such as .exe or .bin. So if you try to login on Minecraft it won't connect. Raidcall,Skype,Sony Vegas. I really need help!

    Read the article

  • Synchronizing issue: I want the main thread to be run before another thread but it sometimes doesn´t

    - by Rox
    I have done my own small concurrency framework (just for learning purposes) inspired by the java.util.concurrency package. This is about the Callable/Future mechanism. My code below is the whole one and is compilable and very easy to understand. My problem is that sometimes I run into a deadlock where the first thread (the main thread) awaits for a signal from the other thread. But then the other thread has already notified the main thread before the main thread went into waiting state, so the main thread cannot wake up. FutureTask.get() should always be run before FutureTask.run() but sometimes the run() method (which is called by new thread) runs before the get() method (which is called by main thread). I don´t know how I can prevent that. This is a pseudo code of how I want the two threads to be run. //From main thread: Executor.submit().get() (in get() the main thread waits for new thread to notify) ->submit() calls Executor.execute(FutureTask object) -> execute() starts new thread -> new thread shall notify `main thread` I cannot understand how the new thread can start up and run faster than the main thread that actually starts the new thread. Main.java: public class Main { public static void main(String[] args) { new ExecutorServiceExample(); } public Main() { ThreadExecutor executor = new ThreadExecutor(); Integer i = executor.submit(new Callable<Integer>() { @Override public Integer call() { return 10; } }).get(); System.err.println("Value: "+i); } } ThreadExecutor.java: public class ThreadExecutor { public ThreadExecutor() {} protected <V> RunnableFuture<V> newTaskFor(Callable c) { return new FutureTask<V>(c); } public <V> Future<V> submit(Callable<V> task) { if (task == null) throw new NullPointerException(); RunnableFuture<V> ftask = newTaskFor(task); execute(ftask); return ftask; } public void execute(Runnable r) { new Thread(r).start(); } } FutureTask.java: import java.util.concurrent.locks.Condition; import java.util.concurrent.locks.ReentrantLock; import java.util.logging.Level; import java.util.logging.Logger; public class FutureTask<V> implements RunnableFuture<V> { private Callable<V> callable; private volatile V result; private ReentrantLock lock = new ReentrantLock(); private Condition condition = lock.newCondition(); public FutureTask(Callable callable) { if (callable == null) throw new NullPointerException(); this.callable = callable; } @Override public void run() { acquireLock(); System.err.println("RUN"+Thread.currentThread().getName()); V v = this.callable.call(); set(v); condition.signal(); releaseLock(); } @Override public V get() { acquireLock(); System.err.println("GET "+Thread.currentThread().getName()); try { condition.await(); } catch (InterruptedException ex) { Logger.getLogger(FutureTask.class.getName()).log(Level.SEVERE, null, ex); } releaseLock(); return this.result; } public void set(V v) { this.result = v; } private void acquireLock() { lock.lock(); } private void releaseLock() { lock.unlock(); } } And the interfaces: public interface RunnableFuture<V> extends Runnable, Future<V> { @Override void run(); } public interface Future<V> { V get(); } public interface Callable<V> { V call(); }

    Read the article

  • is it right to call ejb bean from thread by ThreadPoolExecutor?

    - by kislo_metal
    I trying to call some ejb bean method from tread. and getting error : (as is glassfish v3) Log Level SEVERE Logger javax.enterprise.system.std.com.sun.enterprise.v3.services.impl Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=42} Record Number 928 Message ID java.lang.NullPointerException at ua.co.rufous.server.broker.TempLicService.run(TempLicService.java Complete Message 35) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:637) here is tread public class TempLicService implements Runnable { String hash; //it`s Stateful bean @EJB private LicActivatorLocal lActivator; public TempLicService(String hash) { this.hash= hash; } @Override public void run() { lActivator.proccessActivation(hash); } } my ThreadPoolExecutor public class RequestThreadPoolExecutor extends ThreadPoolExecutor { private boolean isPaused; private ReentrantLock pauseLock = new ReentrantLock(); private Condition unpaused = pauseLock.newCondition(); private static RequestThreadPoolExecutor threadPool; private RequestThreadPoolExecutor() { super(1, Integer.MAX_VALUE, 10, TimeUnit.SECONDS, new LinkedBlockingQueue<Runnable>()); System.out.println("RequestThreadPoolExecutor created"); } public static RequestThreadPoolExecutor getInstance() { if (threadPool == null) threadPool = new RequestThreadPoolExecutor(); return threadPool; } public void runService(Runnable task) { threadPool.execute(task); } protected void beforeExecute(Thread t, Runnable r) { super.beforeExecute(t, r); pauseLock.lock(); try { while (isPaused) unpaused.await(); } catch (InterruptedException ie) { t.interrupt(); } finally { pauseLock.unlock(); } } public void pause() { pauseLock.lock(); try { isPaused = true; } finally { pauseLock.unlock(); } } public void resume() { pauseLock.lock(); try { isPaused = false; unpaused.signalAll(); } finally { pauseLock.unlock(); } } public void shutDown() { threadPool.shutdown(); } //<<<<<< creating thread here public void runByHash(String hash) { Runnable service = new TempLicService(hash); threadPool.runService(service); } } and method where i call it (it is gwt servlet, but there is no proble to call thread that not contain ejb) : @Override public Boolean submitHash(String hash) { System.out.println("submiting hash"); try { if (tBoxService.getTempLicStatus(hash) == 1) { //<<< here is the call RequestThreadPoolExecutor.getInstance().runByHash(hash); return true; } } catch (NoResultException e) { e.printStackTrace(); } return false; } I need to organize some pool of submitting hash to server (calls of LicActivator bean), is ThreadPoolExecutor design good idea and why it is not working in my case? (as I know we can`t create thread inside bean, but could we call bean from different threads? ). If No, what is the bast practice for organize such request pool? Thanks. << Answer: I am using DI (EJB 3.1) soo i do not need any look up here. (application packed in ear and both modules in it (web module and ejb), it works perfect for me). But I can use it only in managed classes. So.. 2.Can I use manual look up in Tread ? Could I use Bean that extends ThreadPoolExecutor and calling another bean that implements Runnable ? Or it is not allowed ?

    Read the article

  • Rails 3 server won't start in cucumber environment

    - by James
    Hi I'm trying to start my rails 3 app in the same environment that cucumber uses because this is necessary for a particular test. When I try to start the server via rails server -e cucumber I get this error: /home/james/rails-projs/fact/config/environments/cucumber.rb:7: undefined local variable or method `config' for main:Object (NameError) from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:195:in `load_dependency' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:523:in `new_constants_in' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:195:in `load_dependency' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/application/bootstrap.rb:10 from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/initializable.rb:25:in `instance_exec' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/initializable.rb:25:in `run' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/initializable.rb:55:in `run_initializers' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/initializable.rb:54:in `each' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/initializable.rb:54:in `run_initializers' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/application.rb:109:in `initialize!' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/application.rb:81:in `send' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/railties/lib/rails/application.rb:81:in `method_missing' from /home/james/rails-projs/beta/config/environment.rb:6 from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:195:in `load_dependency' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:523:in `new_constants_in' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:195:in `load_dependency' from /home/james/.bundle/ruby/1.8/bundler/gems/rails-16a5e918a06649ffac24fd5873b875daf66212ad-master/activesupport/lib/active_support/dependencies.rb:209:in `require' from config.ru:3 from /usr/lib/ruby/gems/1.8/gems/rack-1.1.0/lib/rack/builder.rb:46:in `instance_eval' from /usr/lib/ruby/gems/1.8/gems/rack-1.1.0/lib/rack/builder.rb:46:in `initialize' from config.ru:1:in `new' from config.ru:1 I'd appreciate any help.

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • JSF tags not being rendered as HTML

    - by Toto
    I'm following the Java EE firstcup tutorial using Netbeans and Glassfish. When I execute the JSF web tier I've been instructed to code, the browser gets the same JSF markup coded in the .xhtml file, and the tags are not rendered as HTML tags. I know this by using the view source code in my browser. For example, for this code: <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Page title here</title> </h:head> <h:body> <h2> <h:outputText value="#{bundle.WelcomeMessage}" /> </h2> </h:body> </html> The browser should get something like: <html ...> <head> <title>Page title here</title> </head> <body> <h2> the welcome message goes here </h2> </body> </html> Right? Well, my browser is getting jsf code (the first piece of code above) and not the html code (the second piece of code above). It seems to be a configuration problem in netbeans or glassfish but don't know what. Any ideas? This is my web.xml file: <?xml version="1.0" encoding="UTF-8"?> <web-app version="3.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"> <context-param> <param-name>javax.faces.PROJECT_STAGE</param-name> <param-value>Development</param-value> </context-param> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>Faces Servlet</servlet-name> <url-pattern>/firstcup/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>greetings.xhtml</welcome-file> </welcome-file-list> </web-app> This is my faces-config.xml file: <?xml version='1.0' encoding='UTF-8'?> <!-- =========== FULL CONFIGURATION FILE ================================== --> <faces-config version="2.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-facesconfig_2_0.xsd"> <application> <resource-bundle> <base-name>firstcup.web.WebMessages</base-name> <var>bundle</var> </resource-bundle> <locale-config> <default-locale>en</default-locale> <supported-locale>es</supported-locale> </locale-config> </application> <navigation-rule> <from-view-id>/greetings.xhtml</from-view-id> <navigation-case> <from-outcome>success</from-outcome> <to-view-id>/response.xhtml</to-view-id> </navigation-case> </navigation-rule> </faces-config> Moreover: The url I'm entering in the browser is http://localhost:8081/firstcup/ but I've also tried: http://localhost:8081/firstcup/greetings.xhtml I've checked Glassfish logs and there's no information about not being able to load FacesServlet

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • Non-blocking I/O using Servlet 3.1: Scalable applications using Java EE 7 (TOTD #188)

    - by arungupta
    Servlet 3.0 allowed asynchronous request processing but only traditional I/O was permitted. This can restrict scalability of your applications. In a typical application, ServletInputStream is read in a while loop. public class TestServlet extends HttpServlet {    protected void doGet(HttpServletRequest request, HttpServletResponse response)         throws IOException, ServletException {     ServletInputStream input = request.getInputStream();       byte[] b = new byte[1024];       int len = -1;       while ((len = input.read(b)) != -1) {          . . .        }   }} If the incoming data is blocking or streamed slower than the server can read then the server thread is waiting for that data. The same can happen if the data is written to ServletOutputStream. This is resolved in Servet 3.1 (JSR 340, to be released as part Java EE 7) by adding event listeners - ReadListener and WriteListener interfaces. These are then registered using ServletInputStream.setReadListener and ServletOutputStream.setWriteListener. The listeners have callback methods that are invoked when the content is available to be read or can be written without blocking. The updated doGet in our case will look like: AsyncContext context = request.startAsync();ServletInputStream input = request.getInputStream();input.setReadListener(new MyReadListener(input, context)); Invoking setXXXListener methods indicate that non-blocking I/O is used instead of the traditional I/O. At most one ReadListener can be registered on ServletIntputStream and similarly at most one WriteListener can be registered on ServletOutputStream. ServletInputStream.isReady and ServletInputStream.isFinished are new methods to check the status of non-blocking I/O read. ServletOutputStream.canWrite is a new method to check if data can be written without blocking.  MyReadListener implementation looks like: @Overridepublic void onDataAvailable() { try { StringBuilder sb = new StringBuilder(); int len = -1; byte b[] = new byte[1024]; while (input.isReady() && (len = input.read(b)) != -1) { String data = new String(b, 0, len); System.out.println("--> " + data); } } catch (IOException ex) { Logger.getLogger(MyReadListener.class.getName()).log(Level.SEVERE, null, ex); }}@Overridepublic void onAllDataRead() { System.out.println("onAllDataRead"); context.complete();}@Overridepublic void onError(Throwable t) { t.printStackTrace(); context.complete();} This implementation has three callbacks: onDataAvailable callback method is called whenever data can be read without blocking onAllDataRead callback method is invoked data for the current request is completely read. onError callback is invoked if there is an error processing the request. Notice, context.complete() is called in onAllDataRead and onError to signal the completion of data read. For now, the first chunk of available data need to be read in the doGet or service method of the Servlet. Rest of the data can be read in a non-blocking way using ReadListener after that. This is going to get cleaned up where all data read can happen in ReadListener only. The sample explained above can be downloaded from here and works with GlassFish 4.0 build 64 and onwards. The slides and a complete re-run of What's new in Servlet 3.1: An Overview session at JavaOne is available here. Here are some more references for you: Java EE 7 Specification Status Servlet Specification Project JSR Expert Group Discussion Archive Servlet 3.1 Javadocs

    Read the article

  • SSH problems (ssh_exchange_identification: read: Connection reset by peer)

    - by kSiR
    I was running 11.10 and decided to do the full upgrade and come up to 12.04 after the update SSH (not SSHD) is now misbehaving when attempting to connect to other OpenSSH instances. I say OpenSSH as I am running a DropBear sshd on my router and I am able to connect to it. When attempting to connect to an OpenSSH server risk@skynet:~/.ssh$ ssh -vvv risk@someserver OpenSSH_5.9p1 Debian-5ubuntu1, OpenSSL 1.0.1 14 Mar 2012 debug1: Reading configuration data /home/risk/.ssh/config debug3: key names ok: [[email protected],[email protected],[email protected],[email protected],ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-rsa,ssh-dss] debug1: Reading configuration data /etc/ssh/ssh_config debug1: /etc/ssh/ssh_config line 19: Applying options for * debug2: ssh_connect: needpriv 0 debug1: Connecting to someserver [someserver] port 22. debug1: Connection established. debug1: identity file /home/risk/.ssh/id_rsa type -1 debug1: identity file /home/risk/.ssh/id_rsa-cert type -1 debug1: identity file /home/risk/.ssh/id_dsa type -1 debug1: identity file /home/risk/.ssh/id_dsa-cert type -1 debug3: Incorrect RSA1 identifier debug3: Could not load "/home/risk/.ssh/id_ecdsa" as a RSA1 public key debug1: identity file /home/risk/.ssh/id_ecdsa type 3 debug1: Checking blacklist file /usr/share/ssh/blacklist.ECDSA-521 debug1: Checking blacklist file /etc/ssh/blacklist.ECDSA-521 debug1: identity file /home/risk/.ssh/id_ecdsa-cert type -1 ssh_exchange_identification: read: Connection reset by peer risk@skynet:~/.ssh$ DropBear instance risk@skynet:~/.ssh$ ssh -vvv root@darkness OpenSSH_5.9p1 Debian-5ubuntu1, OpenSSL 1.0.1 14 Mar 2012 debug1: Reading configuration data /home/risk/.ssh/config debug3: key names ok: [[email protected],[email protected],[email protected],[email protected],ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-rsa,ssh-dss] debug1: Reading configuration data /etc/ssh/ssh_config debug1: /etc/ssh/ssh_config line 19: Applying options for * debug2: ssh_connect: needpriv 0 debug1: Connecting to darkness [192.168.1.1] port 22. debug1: Connection established. debug1: identity file /home/risk/.ssh/id_rsa type -1 debug1: identity file /home/risk/.ssh/id_rsa-cert type -1 debug1: identity file /home/risk/.ssh/id_dsa type -1 debug1: identity file /home/risk/.ssh/id_dsa-cert type -1 debug3: Incorrect RSA1 identifier debug3: Could not load "/home/risk/.ssh/id_ecdsa" as a RSA1 public key debug1: identity file /home/risk/.ssh/id_ecdsa type 3 debug1: Checking blacklist file /usr/share/ssh/blacklist.ECDSA-521 debug1: Checking blacklist file /etc/ssh/blacklist.ECDSA-521 debug1: identity file /home/risk/.ssh/id_ecdsa-cert type -1 debug1: Remote protocol version 2.0, remote software version dropbear_0.52 debug1: no match: dropbear_0.52 ... I have googled and ran most ALL fixes recommend both from the Debian and Arch sides and none of them seem to resolve my issue. Any ideas?

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • The Developer's Conference Florianópolis, Brazil

    - by Tori Wieldt
    by guest blogger Yara Senger With over 2900 developers in person and another 2000 online, The Developer's Conference (TDC) in Florianópolis, Brazil, reminds us that Java is BIG in Brazil. The conference included 20 different tracks, and Java was the most popular track. Java was also a big part of the talks in the IoT, Cloud and BigData tracks. Here's my overview (in Brazilian Portguese): Several JUGs were involved in TDC Florianópolis, serving as track leads, speakers and all-around heros, including SouJava SouJava Campinas GUJava Santa Catarina JUG Vale JUG Maringá Java Bahia GOJava (Goinia) JUG Rio do Sul RS Jug (Rio Grande do Sul) and I thank them for their support and commitment. It is a vibrant and fun community! We saw that the IoT space is maturing rapidly. There are already some related to embedded in the region.  Java Evangelist Bruno Borges and Marco Antonio Maciel gave a view popular talk "Java: Tweet for Beer!" They demonstrated how to make a beer tap controlled by Java and connected to the Internet, using a visual application JavaFX with Java SE 8, running on a Rasperry Pi. Of course, they had to test the application quite throughly.   We Brazilians are training the next generation of Java developers. TDC4Kids was as big success. We made a tour with the kids in all booths and almost everybody talked about Java. Java in government managment (Betha), Java on the 2048  (Oracle), Java on the popcorn machine and Java training (Globalcode & V.Office) and of course: Java & Minecraft! OTN's Pablo Ciccarello was there to support the community.  He did several video interviews with JUG leaders and speakers (mine included). You can watch more videos on his TDC Florianópolis playlist.  Thank you, Oracle and OTN for all your support. We interacted with thousands of Java developers at The Developer's Conference Florianópolis. If you want to join us, we are planning two more conferences this year: The Developer's Conference São Paulo, July  The Developer's Conference Porto Alegre, October 

    Read the article

  • android View not attached to window manager...

    - by Daniel Benedykt
    Hi I am having some of the following exceptions: java.lang.IllegalArgumentException: View not attached to window manager at android.view.WindowManagerImpl.findViewLocked(WindowManagerImpl.java:355) at android.view.WindowManagerImpl.updateViewLayout(WindowManagerImpl.java:191) at android.view.Window$LocalWindowManager.updateViewLayout(Window.java:428) at android.app.Dialog.onWindowAttributesChanged(Dialog.java:596) at android.view.Window.setDefaultWindowFormat(Window.java:1013) at com.android.internal.policy.impl.PhoneWindow.access$700(PhoneWindow.java:86) at com.android.internal.policy.impl.PhoneWindow$DecorView.drawableChanged(PhoneWindow.java:1951) at com.android.internal.policy.impl.PhoneWindow$DecorView.fitSystemWindows(PhoneWindow.java:1889) at android.view.ViewRoot.performTraversals(ViewRoot.java:727) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4338) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have google it and see that it has something to do with popups and turning the screen, but there is no reference to my code. The questions are: 1) is there a way to find out exactly when this issue is happening? 2) other than turning the screen, is there another event or action that triggers this error? 3) how do I prevent this to happen? Thanks

    Read the article

  • Cannot SSH after resetting firewall on VPS

    - by Thomas Buckley
    I'm having trouble trying to SSH to my Debian 5 VPS with blacknight. It was working fine until I did the following: Logged into 'Parallels Infrastructure Manager' - Container - Firewall - Set to 'Normal Firewall settings'. It told me there was an error with the IPTables and offered the option again with a checkbox to 'reset' firewall settings, I selected this. I can see that that the default rules are been applied ( anything from anyone on any port and allowing anything to happen). Whenever I attempt to SSH I get the following debug info: thomas@localmachine:~/.ssh$ ssh -v thomas@hostname OpenSSH_5.8p1 Debian-7ubuntu1, OpenSSL 1.0.0e 6 Sep 2011 debug1: Reading configuration data /etc/ssh/ssh_config debug1: Applying options for * debug1: Connecting to hostname [***********] port 22. debug1: Connection established. debug1: identity file /home/thomas/.ssh/id_rsa type 1 debug1: Checking blacklist file /usr/share/ssh/blacklist.RSA-4096 debug1: Checking blacklist file /etc/ssh/blacklist.RSA-4096 debug1: identity file /home/thomas/.ssh/id_rsa-cert type -1 debug1: identity file /home/thomas/.ssh/id_dsa type -1 debug1: identity file /home/thomas/.ssh/id_dsa-cert type -1 debug1: identity file /home/thomas/.ssh/id_ecdsa type -1 debug1: identity file /home/thomas/.ssh/id_ecdsa-cert type -1 debug1: Remote protocol version 2.0, remote software version OpenSSH_5.1p1 Debian-5 debug1: match: OpenSSH_5.1p1 Debian-5 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.8p1 Debian-7ubuntu1 debug1: SSH2_MSG_KEXINIT sent debug1: SSH2_MSG_KEXINIT received debug1: kex: server->client aes128-ctr hmac-md5 none debug1: kex: client->server aes128-ctr hmac-md5 none debug1: SSH2_MSG_KEX_DH_GEX_REQUEST(1024<1024<8192) sent debug1: expecting SSH2_MSG_KEX_DH_GEX_GROUP debug1: SSH2_MSG_KEX_DH_GEX_INIT sent debug1: expecting SSH2_MSG_KEX_DH_GEX_REPLY debug1: Server host key: RSA ************************************* debug1: Host 'hostname' is known and matches the RSA host key. debug1: Found key in /home/thomas/.ssh/known_hosts:2 debug1: ssh_rsa_verify: signature correct debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug1: SSH2_MSG_NEWKEYS received debug1: Roaming not allowed by server debug1: SSH2_MSG_SERVICE_REQUEST sent debug1: SSH2_MSG_SERVICE_ACCEPT received debug1: Authentications that can continue: publickey debug1: Next authentication method: publickey debug1: Offering RSA public key: /home/thomas/.ssh/id_rsa debug1: Authentications that can continue: publickey debug1: Trying private key: /home/thomas/.ssh/id_dsa debug1: Trying private key: /home/thomas/.ssh/id_ecdsa debug1: No more authentication methods to try. Permission denied (publickey). I had my public/private RSA keys set up and working fine before I reset the firewall settings. I had also made the following changes to my /etc/ssh/sshd_config file on the VPS: PermitRootLogin no PasswordAuthentication no X11Forwarding no UsePAM no UseDNS no AllowUsers thomas Could it be something to do with the SSH server & client having different versions between my local machine and VPS? Any help appreciated. Output with ssh -vvv thomas@localcomputer:~/.ssh$ ssh -vvv thomas@**************** OpenSSH_5.8p1 Debian-7ubuntu1, OpenSSL 1.0.0e 6 Sep 2011 debug1: Reading configuration data /etc/ssh/ssh_config debug1: Applying options for * debug2: ssh_connect: needpriv 0 debug1: Connecting to ************ [*************] port 22. debug1: Connection established. debug3: Incorrect RSA1 identifier debug3: Could not load "/home/thomas/.ssh/id_rsa" as a RSA1 public key debug2: key_type_from_name: unknown key type '-----BEGIN' debug3: key_read: missing keytype debug2: key_type_from_name: unknown key type 'Proc-Type:' debug3: key_read: missing keytype debug2: key_type_from_name: unknown key type 'DEK-Info:' debug3: key_read: missing keytype debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug2: key_type_from_name: unknown key type '-----END' debug3: key_read: missing keytype debug1: identity file /home/thomas/.ssh/id_rsa type 1 debug1: Checking blacklist file /usr/share/ssh/blacklist.RSA-4096 debug1: Checking blacklist file /etc/ssh/blacklist.RSA-4096 debug1: identity file /home/thomas/.ssh/id_rsa-cert type -1 debug1: identity file /home/thomas/.ssh/id_dsa type -1 debug1: identity file /home/thomas/.ssh/id_dsa-cert type -1 debug1: identity file /home/thomas/.ssh/id_ecdsa type -1 debug1: identity file /home/thomas/.ssh/id_ecdsa-cert type -1 debug1: Remote protocol version 2.0, remote software version OpenSSH_5.1p1 Debian-5 debug1: match: OpenSSH_5.1p1 Debian-5 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.8p1 Debian-7ubuntu1 debug2: fd 3 setting O_NONBLOCK debug3: load_hostkeys: loading entries for host "*****************" from file "/home/thomas/.ssh/known_hosts" debug3: load_hostkeys: found key type RSA in file /home/thomas/.ssh/known_hosts:1 debug3: load_hostkeys: loaded 1 keys debug3: order_hostkeyalgs: prefer hostkeyalgs: [email protected],[email protected],ssh-rsa debug1: SSH2_MSG_KEXINIT sent debug1: SSH2_MSG_KEXINIT received debug2: kex_parse_kexinit: ecdh-sha2-nistp256,ecdh-sha2-nistp384,ecdh-sha2-nistp521,diffie-hellman-group-exchange-sha256,diffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1 debug2: kex_parse_kexinit: [email protected],[email protected],ssh-rsa,[email protected],[email protected],[email protected],[email protected],[email protected],ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-dss debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: none,[email protected],zlib debug2: kex_parse_kexinit: none,[email protected],zlib debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: first_kex_follows 0 debug2: kex_parse_kexinit: reserved 0 debug2: kex_parse_kexinit: diffie-hellman-group-exchange-sha256,diffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1 debug2: kex_parse_kexinit: ssh-rsa,ssh-dss debug2: kex_parse_kexinit: aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,arcfour128,arcfour256,arcfour,aes192-cbc,aes256-cbc,[email protected],aes128-ctr,aes192-ctr,aes256-ctr debug2: kex_parse_kexinit: aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,arcfour128,arcfour256,arcfour,aes192-cbc,aes256-cbc,[email protected],aes128-ctr,aes192-ctr,aes256-ctr debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: none,[email protected] debug2: kex_parse_kexinit: none,[email protected] debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: first_kex_follows 0 debug2: kex_parse_kexinit: reserved 0 debug2: mac_setup: found hmac-md5 debug1: kex: server->client aes128-ctr hmac-md5 none debug2: mac_setup: found hmac-md5 debug1: kex: client->server aes128-ctr hmac-md5 none debug1: SSH2_MSG_KEX_DH_GEX_REQUEST(1024<1024<8192) sent debug1: expecting SSH2_MSG_KEX_DH_GEX_GROUP debug2: dh_gen_key: priv key bits set: 127/256 debug2: bits set: 498/1024 debug1: SSH2_MSG_KEX_DH_GEX_INIT sent debug1: expecting SSH2_MSG_KEX_DH_GEX_REPLY debug1: Server host key: RSA *********************************************************** debug3: load_hostkeys: loading entries for host "*********************" from file "/home/thomas/.ssh/known_hosts" debug3: load_hostkeys: found key type RSA in file /home/thomas/.ssh/known_hosts:1 debug3: load_hostkeys: loaded 1 keys debug1: Host '****************' is known and matches the RSA host key. debug1: Found key in /home/thomas/.ssh/known_hosts:1 debug2: bits set: 516/1024 debug1: ssh_rsa_verify: signature correct debug2: kex_derive_keys debug2: set_newkeys: mode 1 debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug2: set_newkeys: mode 0 debug1: SSH2_MSG_NEWKEYS received debug1: Roaming not allowed by server debug1: SSH2_MSG_SERVICE_REQUEST sent debug2: service_accept: ssh-userauth debug1: SSH2_MSG_SERVICE_ACCEPT received debug2: key: /home/thomas/.ssh/id_rsa (0x7fa7028b6010) debug2: key: /home/thomas/.ssh/id_dsa ((nil)) debug2: key: /home/thomas/.ssh/id_ecdsa ((nil)) debug1: Authentications that can continue: publickey debug3: start over, passed a different list publickey debug3: preferred gssapi-keyex,gssapi-with-mic,publickey,keyboard-interactive,password debug3: authmethod_lookup publickey debug3: remaining preferred: keyboard-interactive,password debug3: authmethod_is_enabled publickey debug1: Next authentication method: publickey debug1: Offering RSA public key: /home/thomas/.ssh/id_rsa debug3: send_pubkey_test debug2: we sent a publickey packet, wait for reply debug1: Authentications that can continue: publickey debug1: Trying private key: /home/thomas/.ssh/id_dsa debug3: no such identity: /home/thomas/.ssh/id_dsa debug1: Trying private key: /home/thomas/.ssh/id_ecdsa debug3: no such identity: /home/thomas/.ssh/id_ecdsa debug2: we did not send a packet, disable method debug1: No more authentication methods to try. Permission denied (publickey). sshd_config # Package generated configuration file # See the sshd(8) manpage for details # What ports, IPs and protocols we listen for Port 22 # Use these options to restrict which interfaces/protocols sshd will bind to #ListenAddress :: #ListenAddress 0.0.0.0 Protocol 2 # HostKeys for protocol version 2 HostKey /etc/ssh/ssh_host_rsa_key HostKey /etc/ssh/ssh_host_dsa_key #Privilege Separation is turned on for security UsePrivilegeSeparation yes # Lifetime and size of ephemeral version 1 server key KeyRegenerationInterval 3600 ServerKeyBits 768 # Logging SyslogFacility AUTH LogLevel INFO # Authentication: LoginGraceTime 120 PermitRootLogin no StrictModes yes RSAAuthentication yes PubkeyAuthentication yes #AuthorizedKeysFile %h/.ssh/authorized_keys # Don't read the user's ~/.rhosts and ~/.shosts files IgnoreRhosts yes # For this to work you will also need host keys in /etc/ssh_known_hosts RhostsRSAAuthentication no # similar for protocol version 2 HostbasedAuthentication no # Uncomment if you don't trust ~/.ssh/known_hosts for RhostsRSAAuthentication #IgnoreUserKnownHosts yes # To enable empty passwords, change to yes (NOT RECOMMENDED) PermitEmptyPasswords no # Change to yes to enable challenge-response passwords (beware issues with # some PAM modules and threads) C hallengeResponseAuthentication no # Change to no to disable tunnelled clear text passwords PasswordAuthentication no # Kerberos options #KerberosAuthentication no #KerberosGetAFSToken no #KerberosOrLocalPasswd yes #KerberosTicketCleanup yes # GSSAPI options #GSSAPIAuthentication no #GSSAPICleanupCredentials yes X11Forwarding no X11DisplayOffset 10 PrintMotd no PrintLastLog yes TCPKeepAlive yes #UseLogin no #MaxStartups 10:30:60 #Banner /etc/issue.net # Allow client to pass locale environment variables AcceptEnv LANG LC_* Subsystem sftp /usr/lib/openssh/sftp-server UsePAM no UseDNS no AllowUsers thomas Thanks

    Read the article

  • Home automation using Arduino / XMPP client for Arduino

    - by Ashish
    I am trying to setup a system for automating certain tasks in my home. I am thinking of a solution wherein a server side application would be able to send/receive commands/data to Arduino (attached with Arduino Ethernet Shield) via the web. Here the Arduino may both act as a sensor interface to the server application or command executor interface for the server app. E.g. (user story): The overhead water tank in my house has a water level sensor attached with Arduino (attached with Arduino Ethernet Shield). Another Arduino (attached with Arduino Ethernet Shield) is attached with a relay/latch. This relay/latch is then connected to a water pump. Now the server side application on the web is able to get/receive water level information from the Arduino on the water tank. Depending on the water level information received, the web application should send suitable signals/commands to Arduino on water pump to switch 'ON' or switch 'OFF' the water pump. Now for such a system to work across the web, I am thinking of using one of the type of solutions in order of my priority: Using XMPP for communication between server application and Arduino. Using HTTP polling. Using HTTP hanging GET. For solution number 1, I need to implement a XMPP client that would reside on Arduino. Is it possible to write a XMPP client small enough to reside on an Arduino? If yes what are the minimum possible XMPP client functionality that I need to write for Arduino, so that it would be able to contact XMPP servers solutions like GTalk, etc.? For solution number 2 and 3 I need guidance in implementation. Also which solution would be cost effective and easily extendable?

    Read the article

  • OpenLDAP and SSL

    - by Stormshadow
    I am having trouble trying to connect to a secure OpenLDAP server which I have set up. On running my LDAP client code java -Djavax.net.debug=ssl LDAPConnector I get the following exception trace (java version 1.6.0_17) trigger seeding of SecureRandom done seeding SecureRandom %% No cached client session *** ClientHello, TLSv1 RandomCookie: GMT: 1256110124 bytes = { 224, 19, 193, 148, 45, 205, 108, 37, 101, 247, 112, 24, 157, 39, 111, 177, 43, 53, 206, 224, 68, 165, 55, 185, 54, 203, 43, 91 } Session ID: {} Cipher Suites: [SSL_RSA_WITH_RC4_128_MD5, SSL_RSA_WITH_RC4_128_SHA, TLS_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_DSS_WITH_AES_128_CBC_SHA, SSL_RSA_W ITH_3DES_EDE_CBC_SHA, SSL_DHE_RSA_WITH_3DES_EDE_CBC_SHA, SSL_DHE_DSS_WITH_3DES_EDE_CBC_SHA, SSL_RSA_WITH_DES_CBC_SHA, SSL_DHE_RSA_WITH_DES_CBC_SHA, SSL_DHE_DSS_WITH_DES_CBC_SH A, SSL_RSA_EXPORT_WITH_RC4_40_MD5, SSL_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA] Compression Methods: { 0 } *** Thread-0, WRITE: TLSv1 Handshake, length = 73 Thread-0, WRITE: SSLv2 client hello message, length = 98 Thread-0, received EOFException: error Thread-0, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake Thread-0, SEND TLSv1 ALERT: fatal, description = handshake_failure Thread-0, WRITE: TLSv1 Alert, length = 2 Thread-0, called closeSocket() main, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake javax.naming.CommunicationException: simple bind failed: ldap.natraj.com:636 [Root exception is javax.net.ssl.SSLHandshakeException: Remote host closed connection during hands hake] at com.sun.jndi.ldap.LdapClient.authenticate(Unknown Source) at com.sun.jndi.ldap.LdapCtx.connect(Unknown Source) at com.sun.jndi.ldap.LdapCtx.<init>(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURL(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURLs(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getLdapCtxInstance(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getInitialContext(Unknown Source) at javax.naming.spi.NamingManager.getInitialContext(Unknown Source) at javax.naming.InitialContext.getDefaultInitCtx(Unknown Source) at javax.naming.InitialContext.init(Unknown Source) at javax.naming.InitialContext.<init>(Unknown Source) at javax.naming.directory.InitialDirContext.<init>(Unknown Source) at LDAPConnector.CallSecureLDAPServer(LDAPConnector.java:43) at LDAPConnector.main(LDAPConnector.java:237) Caused by: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.performInitialHandshake(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readDataRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.AppInputStream.read(Unknown Source) at java.io.BufferedInputStream.fill(Unknown Source) at java.io.BufferedInputStream.read1(Unknown Source) at java.io.BufferedInputStream.read(Unknown Source) at com.sun.jndi.ldap.Connection.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Caused by: java.io.EOFException: SSL peer shut down incorrectly at com.sun.net.ssl.internal.ssl.InputRecord.read(Unknown Source) ... 9 more I am able to connect to the same secure LDAP server however if I use another version of java (1.6.0_14) I have created and installed the server certificates in the cacerts of both the JRE's as mentioned in this guide -- OpenLDAP with SSL When I run ldapsearch -x on the server I get # extended LDIF # # LDAPv3 # base <dc=localdomain> (default) with scope subtree # filter: (objectclass=*) # requesting: ALL # # localdomain dn: dc=localdomain objectClass: top objectClass: dcObject objectClass: organization o: localdomain dc: localdomain # admin, localdomain dn: cn=admin,dc=localdomain objectClass: simpleSecurityObject objectClass: organizationalRole cn: admin description: LDAP administrator # search result search: 2 result: 0 Success # numResponses: 3 # numEntries: 2 On running openssl s_client -connect ldap.natraj.com:636 -showcerts , I obtain the self signed certificate. My slapd.conf file is as follows ####################################################################### # Global Directives: # Features to permit #allow bind_v2 # Schema and objectClass definitions include /etc/ldap/schema/core.schema include /etc/ldap/schema/cosine.schema include /etc/ldap/schema/nis.schema include /etc/ldap/schema/inetorgperson.schema # Where the pid file is put. The init.d script # will not stop the server if you change this. pidfile /var/run/slapd/slapd.pid # List of arguments that were passed to the server argsfile /var/run/slapd/slapd.args # Read slapd.conf(5) for possible values loglevel none # Where the dynamically loaded modules are stored modulepath /usr/lib/ldap moduleload back_hdb # The maximum number of entries that is returned for a search operation sizelimit 500 # The tool-threads parameter sets the actual amount of cpu's that is used # for indexing. tool-threads 1 ####################################################################### # Specific Backend Directives for hdb: # Backend specific directives apply to this backend until another # 'backend' directive occurs backend hdb ####################################################################### # Specific Backend Directives for 'other': # Backend specific directives apply to this backend until another # 'backend' directive occurs #backend <other> ####################################################################### # Specific Directives for database #1, of type hdb: # Database specific directives apply to this databasse until another # 'database' directive occurs database hdb # The base of your directory in database #1 suffix "dc=localdomain" # rootdn directive for specifying a superuser on the database. This is needed # for syncrepl. rootdn "cn=admin,dc=localdomain" # Where the database file are physically stored for database #1 directory "/var/lib/ldap" # The dbconfig settings are used to generate a DB_CONFIG file the first # time slapd starts. They do NOT override existing an existing DB_CONFIG # file. You should therefore change these settings in DB_CONFIG directly # or remove DB_CONFIG and restart slapd for changes to take effect. # For the Debian package we use 2MB as default but be sure to update this # value if you have plenty of RAM dbconfig set_cachesize 0 2097152 0 # Sven Hartge reported that he had to set this value incredibly high # to get slapd running at all. See http://bugs.debian.org/303057 for more # information. # Number of objects that can be locked at the same time. dbconfig set_lk_max_objects 1500 # Number of locks (both requested and granted) dbconfig set_lk_max_locks 1500 # Number of lockers dbconfig set_lk_max_lockers 1500 # Indexing options for database #1 index objectClass eq # Save the time that the entry gets modified, for database #1 lastmod on # Checkpoint the BerkeleyDB database periodically in case of system # failure and to speed slapd shutdown. checkpoint 512 30 # Where to store the replica logs for database #1 # replogfile /var/lib/ldap/replog # The userPassword by default can be changed # by the entry owning it if they are authenticated. # Others should not be able to see it, except the # admin entry below # These access lines apply to database #1 only access to attrs=userPassword,shadowLastChange by dn="cn=admin,dc=localdomain" write by anonymous auth by self write by * none # Ensure read access to the base for things like # supportedSASLMechanisms. Without this you may # have problems with SASL not knowing what # mechanisms are available and the like. # Note that this is covered by the 'access to *' # ACL below too but if you change that as people # are wont to do you'll still need this if you # want SASL (and possible other things) to work # happily. access to dn.base="" by * read # The admin dn has full write access, everyone else # can read everything. access to * by dn="cn=admin,dc=localdomain" write by * read # For Netscape Roaming support, each user gets a roaming # profile for which they have write access to #access to dn=".*,ou=Roaming,o=morsnet" # by dn="cn=admin,dc=localdomain" write # by dnattr=owner write ####################################################################### # Specific Directives for database #2, of type 'other' (can be hdb too): # Database specific directives apply to this databasse until another # 'database' directive occurs #database <other> # The base of your directory for database #2 #suffix "dc=debian,dc=org" ####################################################################### # SSL: # Uncomment the following lines to enable SSL and use the default # snakeoil certificates. #TLSCertificateFile /etc/ssl/certs/ssl-cert-snakeoil.pem #TLSCertificateKeyFile /etc/ssl/private/ssl-cert-snakeoil.key TLSCipherSuite TLS_RSA_AES_256_CBC_SHA TLSCACertificateFile /etc/ldap/ssl/server.pem TLSCertificateFile /etc/ldap/ssl/server.pem TLSCertificateKeyFile /etc/ldap/ssl/server.pem My ldap.conf file is # # LDAP Defaults # # See ldap.conf(5) for details # This file should be world readable but not world writable. HOST ldap.natraj.com PORT 636 BASE dc=localdomain URI ldaps://ldap.natraj.com TLS_CACERT /etc/ldap/ssl/server.pem TLS_REQCERT allow #SIZELIMIT 12 #TIMELIMIT 15 #DEREF never

    Read the article

< Previous Page | 512 513 514 515 516 517 518 519 520 521 522 523  | Next Page >