Search Results

Search found 5260 results on 211 pages for 'fedora 17'.

Page 52/211 | < Previous Page | 48 49 50 51 52 53 54 55 56 57 58 59  | Next Page >

  • Can't access network share with name defined in hosts file

    - by Einar Egilsson
    I have a network share on a machine that I can only reach by IP address. I then defined an alias for the IP in my hosts file so I could use that instead of the IP but then I can't log on to the share, I just get the logon prompt again and again. So basically this: \\172.17.0.48\SomeShare works but this \\myalias\SomeShare doesn't. myalias is defined in c:\windows\system32\drivers\etc\hosts as 172.17.0.48 myalias And I can use the alias for remote desktop without problems. Can anyone tell me why this doesn't work for fileshares?

    Read the article

  • Error in eclipse on run android project

    - by Larz
    I am trying to get a simple hello world android project working in eclipse using an android emulator. I have been using the examples on developer.android.com. I actually did have a hello world app working. I then modified it's xml files to have a text input field and a button as in the second example shows on that site. This failed to run on the emulator. I then went back and tried to create another simple hello world project, but it fails to run. The console says "Waiting for HOME ('android.process.acore') to be launched, but nothing happens or sometimes a messenger in the emulator says "unfortunately Android Wear has stopped". Below is a sample error filter on the log file. I find trying to debug this is something new to me and I am not sure the best way to go about it. I am just trying to learn some basic android developer skills. 05-30 16:19:07.336: E/SELinux(469): SELinux: Loaded file_contexts from /file_contexts, 05-30 16:19:07.336: E/SELinux(469): digest= 05-30 16:19:07.376: E/SELinux(469): b0 05-30 16:19:07.376: E/SELinux(469): 4b 05-30 16:19:07.756: E/SELinux(469): 03 05-30 16:19:07.756: E/SELinux(469): 4a 05-30 16:19:07.826: E/SELinux(469): 73 05-30 16:19:07.886: E/SELinux(469): ab 05-30 16:19:07.886: E/SELinux(469): 6d 05-30 16:19:07.896: E/SELinux(469): 46 05-30 16:19:07.896: E/SELinux(469): b4 05-30 16:19:07.896: E/SELinux(469): a5 05-30 16:19:07.896: E/SELinux(469): 73 05-30 16:19:07.896: E/SELinux(469): 8a 05-30 16:19:07.896: E/SELinux(469): ee 05-30 16:19:07.896: E/SELinux(469): ac 05-30 16:19:07.906: E/SELinux(469): 68 05-30 16:19:07.906: E/SELinux(469): ff 05-30 16:19:07.906: E/SELinux(469): 04 05-30 16:19:07.906: E/SELinux(469): dc 05-30 16:19:07.906: E/SELinux(469): b8 05-30 16:19:07.906: E/SELinux(469): a2 05-30 16:19:11.806: E/SensorManager(511): sensor or listener is null 05-30 16:19:16.196: E/BluetoothAdapter(378): Bluetooth binder is null 05-30 16:19:16.206: E/BluetoothAdapter(378): Bluetooth binder is null 05-30 16:19:17.186: E/WVMExtractor(54): Failed to open libwvm.so: dlopen failed: library "libwvm.so" not found 05-30 16:19:17.776: E/AudioCache(54): Error 1, -2147483648 occurred 05-30 16:19:17.796: E/SoundPool(378): Unable to load sample: (null) 05-30 16:19:18.536: E/AudioCache(54): Error 1, -2147483648 occurred 05-30 16:19:18.546: E/SoundPool(378): Unable to load sample: (null)

    Read the article

  • Apache returns 403 Forbidden for alternative port vhost

    - by Wesley
    I'm having an issue getting vhosts to work on Apache 2.2, Debian 6. I have two VirtualHosts, one on port 80 and one on port 8888. The port 80 one has been created automatically by DirectAdmin, the 8888 is a custom one. It's configuration is as follows. <VirtualHost *:8888 > DocumentRoot /home/user/public_html/development ServerName www.myserver.nl ServerAlias myserver.nl <Directory "/home/user/public_html/development"> Options +Indexes +FollowSymLinks +MultiViews AllowOverride All Order Allow,deny Allow from all </Directory> </VirtualHost> Of course I also have a NameVirtualHost *:8888 The port 80 DocumentRoot is /home/user/public_html/production, which is perfectly accessible and works like a charm. The port 8888 docroot of /home/user/public_html/development is 403 forbidden though. I have compared the permissions for both folders. They seem fine to me. drwxr-xr-x 2 root root 4096 Aug 17 16:14 development drwxr-xr-x 4 root root 4096 Aug 18 04:29 production Also, the index.php file which is supposed to display when accessing through port 8888, located in /development/: -rwxr-xr-x 1 root root 41 Aug 17 16:14 index.html I have looked at my error_log and found many of the following entries, only being added to the log file when accessing through port 8888. [Sat Aug 18 04:35:09 2012] [error] [client 27.32.156.232] Symbolic link not allowed or link target not accessible: /home/user/public_html /home/user/public_html is a symbolic link that refers to /home/user/domains/mydomain/public_html. The symbolic link has the following permissions: lrwxrwxrwx 1 admin admin 29 Aug 17 15:56 public_html -> ./domains/mydomain/public_html I'm at a loss. It seems that everything is readable or executable. I've set the Directory to FollowSymLinks in the httpd.conf file, but that doesn't seem to make a difference. If I change that directory tag to <Directory "/home/admin/public_html"> (so it has FollowSymLinks on that as well) it still does not work. Any help is greatly appreciated. If I need to post more information, let me know. I'm pretty much a beginner at this stuff. .. .. UPDATE: I ended up changing the configuration to directly go to the actual path of the files, avoiding the public_html symlink altogether. That worked. Thanks for the suggestions folks. DocumentRoot /home/user/domains/mydomain/public_html/development instead of DocumentRoot /home/user/public_html/development

    Read the article

  • Updating ATI HD 5970 Graphics card - version errors?

    - by user55406
    I'm having an issue...My system specs is: Intel i7 960 6GM Corair XMS RAM ATI HD5970 graphics card Intel dx58so motherboard Cooler Master HAF 922 case 1.5TB Seagate hard drive Windows Vista x86 (32-bit). Here is my issue: when I go to AMD/ATI website to update my graphics card - it doesn't. when I type DxDiag and then click on display it tell me my version is 8.17.0 and its on 10.10.0 for the latest version. How can I get 8.17.0 too 10.10.0? I figure it would have done that after I updated the driver for my graphics card. Thanks.

    Read the article

  • e2fsck extremly slow, although enough memory exists

    - by kaefert
    I've got this external USB-Disk: kaefert@blechmobil:~$ lsusb -s 2:3 Bus 002 Device 003: ID 0bc2:3320 Seagate RSS LLC As can be seen in this dmesg output, there are some problems that prevents that disk from beeing mounted: kaefert@blechmobil:~$ dmesg | grep sdb [ 114.474342] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.475089] sd 5:0:0:0: [sdb] Write Protect is off [ 114.475092] sd 5:0:0:0: [sdb] Mode Sense: 43 00 00 00 [ 114.475959] sd 5:0:0:0: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA [ 114.477093] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.501649] sdb: sdb1 [ 114.502717] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.504354] sd 5:0:0:0: [sdb] Attached SCSI disk [ 116.804408] EXT4-fs (sdb1): ext4_check_descriptors: Checksum for group 3976 failed (47397!=61519) [ 116.804413] EXT4-fs (sdb1): group descriptors corrupted! So I went and fired up my favorite partition manager - gparted, and told it to verify and repair the partition sdb1. This made gparted call e2fsck (version 1.42.4 (12-Jun-2012)) e2fsck -f -y -v /dev/sdb1 Although gparted called e2fsck with the "-v" option, sadly it doesn't show me the output of my e2fsck process (bugreport https://bugzilla.gnome.org/show_bug.cgi?id=467925 ) I started this whole thing on Sunday (2012-11-04_2200) evening, so about 48 hours ago, this is what htop says about it now (2012-11-06-1900): PID USER PRI NI VIRT RES SHR S CPU% MEM% TIME+ Command 3704 root 39 19 1560M 1166M 768 R 98.0 19.5 42h56:43 e2fsck -f -y -v /dev/sdb1 Now I found a few posts on the internet that discuss e2fsck running slow, for example: http://gparted-forum.surf4.info/viewtopic.php?id=13613 where they write that its a good idea to see if the disk is just that slow because maybe its damaged, and I think these outputs tell me that this is not the case in my case: kaefert@blechmobil:~$ sudo hdparm -tT /dev/sdb /dev/sdb: Timing cached reads: 3562 MB in 2.00 seconds = 1783.29 MB/sec Timing buffered disk reads: 82 MB in 3.01 seconds = 27.26 MB/sec kaefert@blechmobil:~$ sudo hdparm /dev/sdb /dev/sdb: multcount = 0 (off) readonly = 0 (off) readahead = 256 (on) geometry = 364801/255/63, sectors = 5860533160, start = 0 However, although I can read quickly from that disk, this disk speed doesn't seem to be used by e2fsck, considering tools like gkrellm or iotop or this: kaefert@blechmobil:~$ iostat -x Linux 3.2.0-2-amd64 (blechmobil) 2012-11-06 _x86_64_ (2 CPU) avg-cpu: %user %nice %system %iowait %steal %idle 14,24 47,81 14,63 0,95 0,00 22,37 Device: rrqm/s wrqm/s r/s w/s rkB/s wkB/s avgrq-sz avgqu-sz await r_await w_await svctm %util sda 0,59 8,29 2,42 5,14 43,17 160,17 53,75 0,30 39,80 8,72 54,42 3,95 2,99 sdb 137,54 5,48 9,23 0,20 587,07 22,73 129,35 0,07 7,70 7,51 16,18 2,17 2,04 Now I researched a little bit on how to find out what e2fsck is doing with all that processor time, and I found the tool strace, which gives me this: kaefert@blechmobil:~$ sudo strace -p3704 lseek(4, 41026998272, SEEK_SET) = 41026998272 write(4, "\212\354K[_\361\3nl\212\245\352\255jR\303\354\312Yv\334p\253r\217\265\3567\325\257\3766"..., 4096) = 4096 lseek(4, 48404766720, SEEK_SET) = 48404766720 read(4, "\7t\260\366\346\337\304\210\33\267j\35\377'\31f\372\252\ffU\317.y\211\360\36\240c\30`\34"..., 4096) = 4096 lseek(4, 41027002368, SEEK_SET) = 41027002368 write(4, "\232]7Ws\321\352\t\1@[+5\263\334\276{\343zZx\352\21\316`1\271[\202\350R`"..., 4096) = 4096 lseek(4, 48404770816, SEEK_SET) = 48404770816 read(4, "\17\362r\230\327\25\346//\210H\v\311\3237\323K\304\306\361a\223\311\324\272?\213\tq \370\24"..., 4096) = 4096 lseek(4, 41027006464, SEEK_SET) = 41027006464 write(4, "\367yy>x\216?=\324Z\305\351\376&\25\244\210\271\22\306}\276\237\370(\214\205G\262\360\257#"..., 4096) = 4096 lseek(4, 48404774912, SEEK_SET) = 48404774912 read(4, "\365\25\0\21|T\0\21}3t_\272\373\222k\r\177\303\1\201\261\221$\261B\232\3142\21U\316"..., 4096) = 4096 ^CProcess 3704 detached around 16 of these lines every second, so 4 read and 4 write operations every second, which I don't consider to be a lot.. And finally, my question: Will this process ever finish? If those numbers from fseek (48404774912) represent bytes, that would be something like 45 gigabytes, with this beeing a 3 terrabyte disk, which would give me 134 days to go, if the speed stays constant, and he scans the disk like this completly and only once. Do you have some advice for me? I have most of the data on that disk elsewhere, but I've put a lot of hours into sorting and merging it to this disk, so I would prefer to getting this disk up and running again, without formatting it anew. I don't think that the hardware is damaged since the disk is only a few months and since I can't see any I/O errors in the dmesg output. UPDATE: I just looked at the strace output again (2012-11-06_2300), now it looks like this: lseek(4, 1419860611072, SEEK_SET) = 1419860611072 read(4, "3#\f\2447\335\0\22A\355\374\276j\204'\207|\217V|\23\245[\7VP\251\242\276\207\317:"..., 4096) = 4096 lseek(4, 43018145792, SEEK_SET) = 43018145792 write(4, "]\206\231\342Y\204-2I\362\242\344\6R\205\361\324\177\265\317C\334V\324\260\334\275t=\10F."..., 4096) = 4096 lseek(4, 1419860615168, SEEK_SET) = 1419860615168 read(4, "\262\305\314Y\367\37x\326\245\226\226\320N\333$s\34\204\311\222\7\315\236\336\300TK\337\264\236\211n"..., 4096) = 4096 lseek(4, 43018149888, SEEK_SET) = 43018149888 write(4, "\271\224m\311\224\25!I\376\16;\377\0\223H\25Yd\201Y\342\r\203\271\24eG<\202{\373V"..., 4096) = 4096 lseek(4, 1419860619264, SEEK_SET) = 1419860619264 read(4, ";d\360\177\n\346\253\210\222|\250\352T\335M\33\260\320\261\7g\222P\344H?t\240\20\2548\310"..., 4096) = 4096 lseek(4, 43018153984, SEEK_SET) = 43018153984 write(4, "\360\252j\317\310\251G\227\335{\214`\341\267\31Y\202\360\v\374\307oq\3063\217Z\223\313\36D\211"..., 4096) = 4096 So this number of the lseeks before the reads, like 1419860619264 are already a lot bigger, standing for 1.29 terabytes if the numbers are bytes, so it doesn't seem to be a linear progress on a big scale, maybe there are only some areas that need work, that have big gaps in between them. (times are in CET)

    Read the article

  • How to copy symbolic links?

    - by Basilevs
    I have directory that contains some symbolic links: user@host:include$ find .. -type l -ls 4737414 0 lrwxrwxrwx 1 user group 13 Dec 9 13:47 ../k0607-lsi6/camac -> ../../include 4737415 0 lrwxrwxrwx 1 user group 14 Dec 9 13:49 ../k0607-lsi6/linux -> ../../../linux 4737417 0 lrwxrwxrwx 1 user group 12 Dec 9 13:57 ../k0607-lsi6/dfc -> ../../../dfc 4737419 0 lrwxrwxrwx 1 user group 17 Dec 9 13:57 ../k0607-lsi6/dfcommon -> ../../../dfcommon 4737420 0 lrwxrwxrwx 1 user group 19 Dec 9 13:57 ../k0607-lsi6/dfcommonxx -> ../../../dfcommonxx 4737421 0 lrwxrwxrwx 1 user group 17 Dec 9 13:57 ../k0607-lsi6/dfcompat -> ../../../dfcompat I need to copy them to the current directory. The resulting links should be independent from their prototypes and lead directly to their target objects. cp -s creates links to links that is not appropriate behavior. cp -s -L refuses to copy links to directories cp -s -L -r refuses to copy relative links to non-working directory What should I do?

    Read the article

  • Printing Booklet Page Size in Adobe Reader 4-in-1

    - by Justin Nathanael Waters
    So I have a 70 page pdf document that I'm trying to condense to a small booklet. I tried creating a formula to manually to perform it but it got ugly fast. 35,36,34,37,17,54,16,55,33,38,32,39,15,56,14,57,31,40,30,41,13,58,12,59 29,42,28,43,11,60,10,61,27,44,26,45,9,62,8,63,25,46,24,47,7,64,6,65 23,48,22,49,5,66,4,67,21,50,20,51,3,68,2,69,19,52,18,53,1,70 Once I print the booklet I should be able to cut the sheets in half and set the bottom half behind the top and staple it for a simple book. Which means Page 1 should have pages 35,36,17,54,34,37,16,55 Page 2 should have pages 33,38,15,56,32,39,14,57 And several pages later Page 9 should have pages 19,52,1,70,18,53 But manually doing this is a headache and it seems like the booklet function should contain functionality that can perform this. I'm using a commercial Konica Minolta C452

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • wireless printer - entering WPA - is there a quicker way?

    - by camcam
    I have a wireless printer (Brother DCP-585CW). The wireless setup instruction says I should enter the WPA key to the printer. The key is entered using up and down buttons on the printer. So, I am supposed to enter 64 characters using up and down buttons. To enter 1 character, it takes on average (24+10)/2 = 17 times pressing the button (digits start after 24 letters). So 17*64 = 1088 times. Is there a quicker way to setup a wireless printer? Maybe there is a Windows program that discovers printers connected to computer through USB or Ethernet (my printer has both sockets) and allows to pre-configure it for wireless usage (enter the long WPA key)? Update There is BRAdmin program and it allows to set up almost all wireless settings... almost - all except WPA :(

    Read the article

  • PDF files are opening in Firefox, undesiredly

    - by root
    PDF files have suddenly started to open within the browser windows of Firefox 17. The PDF files are being displayed with the Adobe Acrobat plugin, which is odd, since I have explicitly disabled the Adobe Acrobat plugin in Firefox. I would like for Firefox to show the download prompt when opening a PDF file, instead. I have disabled the Adobe Acrobat plugin and I have made sure that PDF files are set to "Always Ask" in the Options dialog. For good measure, I've also tried disabling all plugins and extensions, and associating all file types to "Always Ask", but to no avail. So why is Firefox 17 suddenly ignoring these settings?

    Read the article

  • Excel Single column into rows, VBA script insight

    - by Sanityvoid
    Okay, so much similiar to the below link but mine is a bit different. Paginate Rows into Columns in Excel I have a lot of data in column A, I want to take every 14 to 15 rows and make them a new row with multiple columns. I'm trying to get it into a format where SQL can intake the data. I figured the best way was to get them into rows then make a CSV with the data. So it would like like below: (wow, the format totally didn't stick when posting) column A column B C D etc 1 1 2 3 x 2 16 17 a b 3 x y z 15 16 17 a b c I can clarify if needed, but I'm stumped on how to get the data out of the single column with so many rows in the column. Thanks for the help!!!

    Read the article

  • Get the screen height in Android

    - by Dan Bray
    How can I get the available height of the screen in Android? I need to the height minus the status bar / menu bar or any other decorations that might be on screen and I need it to work for all devices. Also, I need to know this in the onCreate function. I know this question has been asked before but I have already tried their solutions and none of them work. Here are some of the things I have tried: I have tested this code on API 7 - 17. Unfortunately, on API 13 there is extra space at bottom both horizontally and vertically and on API 10, 8, and 7 there is not enough space at the bottom both horizontally and vertically. (I have not tested on obsolete API's): Display display = getWindowManager().getDefaultDisplay(); DisplayMetrics metrics = new DisplayMetrics(); display.getMetrics(metrics); screenWidth = metrics.widthPixels; screenHeight = metrics.heightPixels; TypedValue tv = new TypedValue(); if(Build.VERSION.SDK_INT >= Build.VERSION_CODES.HONEYCOMB) { if (getTheme().resolveAttribute(android.R.attr.actionBarSize, tv, true)) screenHeight -= TypedValue.complexToDimensionPixelSize(tv.data,getResources().getDisplayMetrics()); } int resourceId = getResources().getIdentifier("status_bar_height", "dimen", "android"); if (resourceId > 0) screenHeight -= getResources().getDimensionPixelSize(resourceId); This does not take into account the status bar / menu bar: Display display = getWindowManager().getDefaultDisplay(); screenWidth = display.getWidth(); screenHeight = display.getHeight(); Neither does this: Point size = new Point(); getWindowManager().getDefaultDisplay().getSize(size); screenWidth = size.x; screenHeight = size.y; Nor this: Point size = new Point(); getWindowManager().getDefaultDisplay().getRealSize(size); screenWidth = size.x; screenHeight = size.y; This does not work: Display display = getWindowManager().getDefaultDisplay(); DisplayMetrics metrics = new DisplayMetrics(); display.getMetrics(metrics); // since SDK_INT = 1; screenWidth = metrics.widthPixels; screenHeight = metrics.heightPixels; try { // used when 17 > SDK_INT >= 14; includes window decorations (statusbar bar/menu bar) screenWidth = (Integer) Display.class.getMethod("getRawWidth").invoke(display); screenHeight = (Integer) Display.class.getMethod("getRawHeight").invoke(display); } catch (Exception ignored) { // Do nothing } try { // used when SDK_INT >= 17; includes window decorations (statusbar bar/menu bar) Point realSize = new Point(); Display.class.getMethod("getRealSize", Point.class).invoke(display, realSize); screenWidth = realSize.x; screenHeight = realSize.y; } catch (Exception ignored) { // Do nothing } I then used the following code to subtract the height of the status bar and menu bar from the screen height: int result = 0; int resourceId = getResources().getIdentifier("status_bar_height", "dimen", "android"); if (resourceId > 0) result = getResources().getDimensionPixelSize(resourceId); screenHeight -= result; result = 0; if (screenHeight >= screenWidth) resourceId = getResources().getIdentifier("navigation_bar_height", "dimen", "android"); else resourceId = getResources().getIdentifier("navigation_bar_height_landscape", "dimen", "android"); if (resourceId > 0) result = getResources().getDimensionPixelSize(resourceId); screenHeight -= result; On API 17 it correctly calculates the height of the status bar and menu bar in portrait but not in landscape. On API 10, it returns 0. I need it to work ideally on all devices or minimum API 7. Any help would be greatly appreciated.

    Read the article

  • Best monitor for reading

    - by wajed
    Will response rate make a difference? What is good brightness? What is a good contrast ratio? Definitely there are other things to look for, so please give me your opinion. Also, what screen size is good for reading? What size would you choose from 17-22? I'm thinking of getting one 17-19 for reading, and one 22 for movies. Or maybe 2 22" one vertical and one horizontal is better? I think I should look for lower native res., right?

    Read the article

  • Is there any script to do accounting for the proftpd's xferlog?

    - by Aseques
    I would like to convert from the xferlog format that proftpd uses into per user in/out bytes, to have a summary on how much traffic does each user use per month. The exact format is this: Thu Oct 17 12:47:05 2013 1 123.123.123.123 74852 /home/vftp/doc1.txt b _ i r user ftp 0 * c Thu Oct 17 12:47:06 2013 2 123.123.123.123 86321 /home/vftp/doc2.txt b _ i r user ftp 0 * c So far I only found a script that makes a nice report but not exactly what I needed, that one can be found here I might create a fork of this one and place it somewhere but it probably has been done a lot of times already. Just found a well hidden page in proftpd site with some more examples here

    Read the article

  • WiX 3 Tutorial: Custom EULA License and MSI localization

    - by Mladen Prajdic
    In this part of the ongoing Wix tutorial series we’ll take a look at how to localize your MSI into different languages. We’re still the mighty SuperForm: Program that takes care of all your label color needs. :) Localizing the MSI With WiX 3.0 localizing an MSI is pretty much a simple and straightforward process. First let look at the WiX project Properties->Build. There you can see "Cultures to build" textbox. Put specific cultures to build into the testbox or leave it empty to build all of them. Cultures have to be in correct culture format like en-US, en-GB or de-DE. Next we have to tell WiX which cultures we actually have in our project. Take a look at the first post in the series about Solution/Project structure and look at the Lang directory in the project structure picture. There we have de-de and en-us subfolders each with its own localized stuff. In the subfolders pay attention to the WXL files Loc_de-de.wxl and Loc_en-us.wxl. Each one has a <String Id="LANG"> under the WixLocalization root node. By including the string with id LANG we tell WiX we want that culture built. For English we have <String Id="LANG">1033</String>, for German <String Id="LANG">1031</String> in Loc_de-de.wxl and for French we’d have to create another file Loc_fr-FR.wxl and put <String Id="LANG">1036</String>. WXL files are localization files. Any string we want to localize we have to put in there. To reference it we use loc keyword like this: !(loc.IdOfTheVariable) => !(loc.MustCloseSuperForm) This is our Loc_en-us.wxl. Note that German wxl has an identical structure but values are in German. <?xml version="1.0" encoding="utf-8"?><WixLocalization Culture="en-us" xmlns="http://schemas.microsoft.com/wix/2006/localization" Codepage="1252"> <String Id="LANG">1033</String> <String Id="ProductName">SuperForm</String> <String Id="LicenseRtf" Overridable="yes">\Lang\en-us\EULA_en-us.rtf</String> <String Id="ManufacturerName">My Company Name</String> <String Id="AppNotSupported">This application is is not supported on your current OS. Minimal OS supported is Windows XP SP2</String> <String Id="DotNetFrameworkNeeded">.NET Framework 3.5 is required. Please install the .NET Framework then run this installer again.</String> <String Id="MustCloseSuperForm">Must close SuperForm!</String> <String Id="SuperFormNewerVersionInstalled">A newer version of !(loc.ProductName) is already installed.</String> <String Id="ProductKeyCheckDialog_Title">!(loc.ProductName) setup</String> <String Id="ProductKeyCheckDialogControls_Title">!(loc.ProductName) Product check</String> <String Id="ProductKeyCheckDialogControls_Description">Plese Enter following information to perform the licence check.</String> <String Id="ProductKeyCheckDialogControls_FullName">Full Name:</String> <String Id="ProductKeyCheckDialogControls_Organization">Organization:</String> <String Id="ProductKeyCheckDialogControls_ProductKey">Product Key:</String> <String Id="ProductKeyCheckDialogControls_InvalidProductKey">The product key you entered is invalid. Please call user support.</String> </WixLocalization>   As you can see from the file we can use localization variables in other variables like we do for SuperFormNewerVersionInstalled string. ProductKeyCheckDialog* strings are to localize a custom dialog for Product key check which we’ll look at in the next post. Built in dialog text localization Under the de-de folder there’s also the WixUI_de-de.wxl file. This files contains German translations of all texts that are in WiX built in dialogs. It can be downloaded from WiX 3.0.5419.0 Source Forge site. Download the wix3-sources.zip and go to \src\ext\UIExtension\wixlib. There you’ll find already translated all WiX texts in 12 Languages. Localizing the custom EULA license Here it gets ugly. We can override the default EULA license easily by overriding WixUILicenseRtf WiX variable like this: <WixVariable Id="WixUILicenseRtf" Value="License.rtf" /> where License.rtf is the name of your custom EULA license file. The downside of this method is that you can only have one license file which means no localization for it. That’s why we need to make a workaround. License is checked on a dialog name LicenseAgreementDialog. What we have to do is overwrite that dialog and insert the functionality for localization. This is a code for LicenseAgreementDialogOverwritten.wxs, an overwritten LicenseAgreementDialog that supports localization. LicenseAcceptedOverwritten replaces the LicenseAccepted built in variable. <?xml version="1.0" encoding="UTF-8" ?><Wix xmlns="http://schemas.microsoft.com/wix/2006/wi"> <Fragment> <UI> <Dialog Id="LicenseAgreementDialogOverwritten" Width="370" Height="270" Title="!(loc.LicenseAgreementDlg_Title)"> <Control Id="LicenseAcceptedOverwrittenCheckBox" Type="CheckBox" X="20" Y="207" Width="330" Height="18" CheckBoxValue="1" Property="LicenseAcceptedOverwritten" Text="!(loc.LicenseAgreementDlgLicenseAcceptedCheckBox)" /> <Control Id="Back" Type="PushButton" X="180" Y="243" Width="56" Height="17" Text="!(loc.WixUIBack)" /> <Control Id="Next" Type="PushButton" X="236" Y="243" Width="56" Height="17" Default="yes" Text="!(loc.WixUINext)"> <Publish Event="SpawnWaitDialog" Value="WaitForCostingDlg">CostingComplete = 1</Publish> <Condition Action="disable"> <![CDATA[ LicenseAcceptedOverwritten <> "1" ]]> </Condition> <Condition Action="enable">LicenseAcceptedOverwritten = "1"</Condition> </Control> <Control Id="Cancel" Type="PushButton" X="304" Y="243" Width="56" Height="17" Cancel="yes" Text="!(loc.WixUICancel)"> <Publish Event="SpawnDialog" Value="CancelDlg">1</Publish> </Control> <Control Id="BannerBitmap" Type="Bitmap" X="0" Y="0" Width="370" Height="44" TabSkip="no" Text="!(loc.LicenseAgreementDlgBannerBitmap)" /> <Control Id="LicenseText" Type="ScrollableText" X="20" Y="60" Width="330" Height="140" Sunken="yes" TabSkip="no"> <!-- This is original line --> <!--<Text SourceFile="!(wix.WixUILicenseRtf=$(var.LicenseRtf))" />--> <!-- To enable EULA localization we change it to this --> <Text SourceFile="$(var.ProjectDir)\!(loc.LicenseRtf)" /> <!-- In each of localization files (wxl) put line like this: <String Id="LicenseRtf" Overridable="yes">\Lang\en-us\EULA_en-us.rtf</String>--> </Control> <Control Id="Print" Type="PushButton" X="112" Y="243" Width="56" Height="17" Text="!(loc.WixUIPrint)"> <Publish Event="DoAction" Value="WixUIPrintEula">1</Publish> </Control> <Control Id="BannerLine" Type="Line" X="0" Y="44" Width="370" Height="0" /> <Control Id="BottomLine" Type="Line" X="0" Y="234" Width="370" Height="0" /> <Control Id="Description" Type="Text" X="25" Y="23" Width="340" Height="15" Transparent="yes" NoPrefix="yes" Text="!(loc.LicenseAgreementDlgDescription)" /> <Control Id="Title" Type="Text" X="15" Y="6" Width="200" Height="15" Transparent="yes" NoPrefix="yes" Text="!(loc.LicenseAgreementDlgTitle)" /> </Dialog> </UI> </Fragment></Wix>   Look at the Control with Id "LicenseText” and read the comments. We’ve changed the original license text source to "$(var.ProjectDir)\!(loc.LicenseRtf)". var.ProjectDir is the directory of the project file. The !(loc.LicenseRtf) is where the magic happens. Scroll up and take a look at the wxl localization file example. We have the LicenseRtf declared there and it’s been made overridable so developers can change it if they want. The value of the LicenseRtf is the path to our localized EULA relative to the WiX project directory. With little hacking we’ve achieved a fully localizable installer package.   The final step is to insert the extended LicenseAgreementDialogOverwritten license dialog into the installer GUI chain. This is how it’s done under the <UI> node of course.   <UI> <!-- code to be discussed in later posts –> <!-- BEGIN UI LOGIC FOR CLEAN INSTALLER --> <Publish Dialog="WelcomeDlg" Control="Next" Event="NewDialog" Value="LicenseAgreementDialogOverwritten">1</Publish> <Publish Dialog="LicenseAgreementDialogOverwritten" Control="Back" Event="NewDialog" Value="WelcomeDlg">1</Publish> <Publish Dialog="LicenseAgreementDialogOverwritten" Control="Next" Event="NewDialog" Value="ProductKeyCheckDialog">LicenseAcceptedOverwritten = "1" AND NOT OLDER_VERSION_FOUND</Publish> <Publish Dialog="InstallDirDlg" Control="Back" Event="NewDialog" Value="ProductKeyCheckDialog">1</Publish> <!-- END UI LOGIC FOR CLEAN INSTALLER –> <!-- code to be discussed in later posts --></UI> For a thing that should be simple for the end developer to do, localization can be a bit advanced for the novice WiXer. Hope this post makes the journey easier and that next versions of WiX improve this process. WiX 3 tutorial by Mladen Prajdic navigation WiX 3 Tutorial: Solution/Project structure and Dev resources WiX 3 Tutorial: Understanding main wxs and wxi file WiX 3 Tutorial: Generating file/directory fragments with Heat.exe  WiX 3 Tutorial: Custom EULA License and MSI localization WiX 3 Tutorial: Product Key Check custom action WiX 3 Tutorial: Building an updater WiX 3 Tutorial: Icons and installer pictures WiX 3 Tutorial: Creating a Bootstrapper

    Read the article

  • Java Spotlight Episode 97: Shaun Smith on JPA and EclipseLink

    - by Roger Brinkley
    Interview with Java Champion Shaun Smith on JPA and EclipseLink. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Project Jigsaw: Late for the train: The Q&A JDK 8 Milestone schedule The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development JSR 355 passed the JCP EC Final Approval Ballot on 13 August 2012 Vote for GlassFish t-shirt design GlassFish on Openshift JFokus 2012 Call for Papers is open Who do you want to hear in the 100 JavaSpotlight feature interview Events Sep 3-6, Herbstcampus, Nuremberg, Germany Sep 10-15, IMTS 2012 Conference,  Chicago Sep 12,  The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development,  Webinar Sep 30-Oct 4, JavaONE, San Francisco Oct 3-4, Java Embedded @ JavaONE, San Francisco Oct 15-17, JAX London Oct 30-Nov 1, Arm TechCon, Santa Clara Oct 22-23, Freescale Technology Forum - Japan, Tokyo Nov 2-3, JMagreb, Morocco Nov 13-17, Devoxx, Belgium Feature InterviewShaun Smith is a Principal Product Manager for Oracle TopLink and an active member of the Eclipse community. He's Ecosystem Development Lead for the Eclipse Persistence Services Project (EclipseLink) and a committer on the Eclipse EMF Teneo and Dali Java Persistence Tools projects. He’s currently involved with the development of JPA persistence for OSGi and Oracle TopLink Grid, which integrates Oracle Coherence with Oracle TopLink to provide JPA on the grid. Mail Bag What’s Cool James Gosling and GlassFish (youtube video) Every time I see a piece of C code I need to port, my heart dies a little. Then I port it to 1/4 as much Java, and feel better. Tweet by Charles Nutter #JavaFX 2.2 is really looking like a great alternative to Flex. SceneBuilder + NetBeans 7.2 = Flash Builder replacement. Tweet by Danny Kopping

    Read the article

  • Java Spotlight Episode 99: Daniel Blaukopf on JavaFX for Embedded Systems

    - by Roger Brinkley
    Interview with  Daniel Blaukopf on JavaFX for Embedded Systems Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Top 5 Reasons to go to JavaOne 5. Chance to see the future of Java Technical Keynotes and sessions The pavillion The new Embedded@JavaOne conference 4. The meetings outside the scope of the conference Top 10 Reasons to Attend the Oracle Appreciation Event GlassFish Community Event at JavaOne 2012 Sundays User Group Forum 3. It’s like drinking from firehose Less keynotes more sessions - 20% more 60% of the talks are external to HOLs Tutorials OracleJava University classes on Sunday - Top Five Reasons You Should Attend Java University at JavaOne 2. Students are free 1. It’s not what you see it’s who you will meet Events Sep 10-15, IMTS 2012 Conference,  Chicago Sep 12,  The Coming M2M Revolution: Critical Issues for End-to-End Software and Systems Development,  Webinar Sep 30-Oct 4, JavaONE, San Francisco Oct 3-4, Java Embedded @ JavaONE, San Francisco Oct 15-17, JAX London Oct 30-Nov 1, Arm TechCon, Santa Clara Oct 22-23, Freescale Technology Forum - Japan, Tokyo Oct 31, JFall, Netherlands Nov 2-3, JMagreb, Morocco Nov 13-17, Devoxx, Belgium Feature InterviewDaniel Blaukopf is the Embedded Java Client Architect at Oracle, working on JavaFX. Daniel's focus in his 14 years in the Java organization has been mobile and embedded devices, including working with device manufacturers to port and tune all levels of the Java stack to their hardware and software environments. Daniel's particular interests are: graphics, performance optimization and functional programming.

    Read the article

  • Java Spotlight Episode 77: Donald Smith on the OpenJDK and Java

    - by Roger Brinkley
    Tweet An interview with Donald Smith about Java and OpenJDK. Joining us this week on the Java All Star Developer Panel are Dalibor Topic, Java Free and Open Source Software Ambassador and Arun Gupta, Java EE Guy. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in iTunes. Show Notes News Jersey 2.0 Milestone 2 available Oracle distribution of Eclipse (OEPE) now supports GlassFish 3.1.2 Oracle Linux 6 is now part of the certification matrix for 3.1.2 3rd part of Spring -> Java EE 6 article series published Joe Darcy - Repeating annotations in the works JEP 152: Crypto Operations with Network HSMs JEP 153: Launch JavaFX Applications OpenJDK bug database: Status update OpenJDK Governing Board 2012 Election: Results jtreg update March 2012 Take Two: Comparing JVMs on ARM/Linux The OpenJDK group at Oracle is growing App bundler project now open Events April 4-5, JavaOne Japan, Tokyo, Japan April 11, Cleveland JUG, Cleveland, OH April 12, GreenJUG, Greenville, SC April 17-18, JavaOne Russia, Moscow Russia April 18–20, Devoxx France, Paris, France April 17-20, GIDS, Bangalore April 21, Java Summit, Chennai April 26, Mix-IT, Lyon, France, May 3-4, JavaOne India, Hyderabad, India May 5, Bangalore, Pune, ?? - JUG outreach May 7, OTN Developer Day, Mumbai May 8, OTN Developer Day, Delhi Feature InterviewDonald Smith, MBA, MSc, is Director of Product Management for Oracle. He brings worldwide enterprise software experience, ranging from small "dot-com" through Fortune 500 companies. Donald speaks regularly about Java, open source, community development, business models, business integration and software development politics at conferences and events worldwide including Java One, Oracle World, Sun Tech Days, Evans Developer Relations Conference, OOPSLA, JAOO, Server Side Symposium, Colorado Software Summit and others. Prior to returning to Oracle, Donald was Director of Ecosystem Development for the Eclipse Foundation, an independent not-for-profit foundation supporting the Eclipse open source community. Mail Bag What’s Cool OpenJDK 7 port to Haiku JEP 154: Remove Serialization Goto for the Java Programming Language

    Read the article

  • Install and upgrade strategies for Oracle Enterprise Manager 12c - Upcoming Webcasts with live demos

    - by Anand Akela
    At Oracle Open World 2011, we launched the Oracle Enterprise Manager 12c , the only complete cloud management solution for your enterprise cloud. With the new release of Oracle Enterprise Manager Cloud Control 12c, the installation and upgrade process has been enhanced to provide a fast and smooth install experience. In the upcoming webcasts, Oracle Enterprise Manager experts will discuss the installation and upgrade strategies for Oracle Enterprise Manager Cloud Control 12c . These webcasts will include live demonstrations of the install and upgrade processes. In the Webcast on November 17th, we will cover the installation steps and provide recommendations to setup a new Oracle Enterprise Manager Cloud Control 12c environment. We'll also provide a live demonstration of the complete installation process.   Upgrading your Oracle Enterprise Manager environment can be a challenging and complex task especially with large environments consisting of hundreds or thousands of targets. In the webcast on November 18th, we'll describe key facts that administrators must know before upgrading their Enterprise Manager system as well as introduce the different approaches for an upgrade. We'll also walk you through the key steps for upgrading an existing Enterprise Manager 11g (or 10g) Grid Control to Oracle Enterprise Manager Cloud Control 12c. In addition to the live webcasts on Oracle Enterprise Manager Cloud Control 12c install and upgrade processes, please consider attending the replay of  Oracle Enterprise Manager Ops Center webcast with live Q&A . Schedule and registration links of upcoming webcasts  :- Topics Schedule Oracle Enterprise Manager Ops Center: Global Systems Management Made Easy (Replay) November 17 10 a.m PT December 1 10 a.m PT Oracle Enterprise Manager Cloud Control 12c Installation Overview November 17 8 a.m PT Upgrade Smoothly to Oracle Enterprise Manager Cloud Control 12c November 18 8 a.m PT For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter   Facebook YouTube Linkedin

    Read the article

  • very long boot up with Ubuntu 10.04.4

    - by wt70707
    I installed Ubuntu 10.04.3 on Atom. Then I do the update and upgrade with: #apt-get update #apt-get upgrade #apt-get dist-upgrade The system can boot up now but in almost 2 minutes. After power on and system test, it will stop at "Verifying DMI pool data" for 10 seconds before the GRUB menu comes up. Then after the choosing of one item, to the start up of OS there is 100 seconds of black screen. The start up after that is normal and the operations in the system is also normal. I am concerned with if it is of hardware problem, or just some problem with the kernel. Also I want to know after "Verifying DMI pool data" what is done? And after we choose an item in GRUB menu, what does the system do? And where can I see the procedure of the whole boot up? The /var/log/boot.log is too simple, and this is it: fsck from util-linux-ng 2.17.2 fsck from util-linux-ng 2.17.2 /dev/mmcblk0p5: clean, ...... /dev/mmcblk0p1: clean, ...... * Starting AppArmor profiles Skipping profile in /etc/apparmor.d/disable: usr.bin.firefox OK] * Setting sensors limits OK]

    Read the article

  • DocumentDB - Another Azure NoSQL Storage Service

    - by Shaun
    Originally posted on: http://geekswithblogs.net/shaunxu/archive/2014/08/25/documentdb---another-azure-nosql-storage-service.aspxMicrosoft just released a bunch of new features for Azure on 22nd and one of them I was interested in most is DocumentDB, a document NoSQL database service on the cloud.   Quick Look at DocumentDB We can try DocumentDB from the new azure preview portal. Just click the NEW button and select the item named DocumentDB to create a new account. Specify the name of the DocumentDB, which will be the endpoint we are going to use to connect later. Select the capacity unit, resource group and subscription. In resource group section we can select which region our DocumentDB will be located. Same as other azure services select the same location with your consumers of the DocumentDB, for example the website, web services, etc.. After several minutes the DocumentDB will be ready. Click the KEYS button we can find the URI and primary key, which will be used when connecting. Now let's open Visual Studio and try to use the DocumentDB we had just created. Create a new console application and install the DocumentDB .NET client library from NuGet with the keyword "DocumentDB". You need to select "Include Prerelase" in NuGet Package Manager window since this library was not yet released. Next we will create a new database and document collection under our DocumentDB account. The code below created an instance of DocumentClient with the URI and primary key we just copied from azure portal, and create a database and collection. And it also prints the document and collection link string which will be used later to insert and query documents. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7: Run(client).Wait(); 8:  9: Console.WriteLine("done"); 10: Console.ReadKey(); 11: } 12:  13: static async Task Run(DocumentClient client) 14: { 15:  16: var database = new Database() { Id = "testdb" }; 17: database = await client.CreateDatabaseAsync(database); 18: Console.WriteLine("database link = {0}", database.SelfLink); 19:  20: var collection = new DocumentCollection() { Id = "testcol" }; 21: collection = await client.CreateDocumentCollectionAsync(database.SelfLink, collection); 22: Console.WriteLine("collection link = {0}", collection.SelfLink); 23: } Below is the result from the console window. We need to copy the collection link string for future usage. Now if we back to the portal we will find a database was listed with the name we specified in the code. Next we will insert a document into the database and collection we had just created. In the code below we pasted the collection link which copied in previous step, create a dynamic object with several properties defined. As you can see we can add some normal properties contains string, integer, we can also add complex property for example an array, a dictionary and an object reference, unless they can be serialized to JSON. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7:  8: // collection link pasted from the result in previous demo 9: var collectionLink = "dbs/AAk3AA==/colls/AAk3AP6oFgA=/"; 10:  11: // document we are going to insert to database 12: dynamic doc = new ExpandoObject(); 13: doc.firstName = "Shaun"; 14: doc.lastName = "Xu"; 15: doc.roles = new string[] { "developer", "trainer", "presenter", "father" }; 16:  17: // insert the docuemnt 18: InsertADoc(client, collectionLink, doc).Wait(); 19:  20: Console.WriteLine("done"); 21: Console.ReadKey(); 22: } the insert code will be very simple as below, just provide the collection link and the object we are going to insert. 1: static async Task InsertADoc(DocumentClient client, string collectionLink, dynamic doc) 2: { 3: var document = await client.CreateDocumentAsync(collectionLink, doc); 4: Console.WriteLine(await JsonConvert.SerializeObjectAsync(document, Formatting.Indented)); 5: } Below is the result after the object had been inserted. Finally we will query the document from the database and collection. Similar to the insert code, we just need to specify the collection link so that the .NET SDK will help us to retrieve all documents in it. 1: static void Main(string[] args) 2: { 3: var endpoint = new Uri("https://shx.documents.azure.com:443/"); 4: var key = "LU2NoyS2fH0131TGxtBE4DW/CjHQBzAaUx/mbuJ1X77C4FWUG129wWk2oyS2odgkFO2Xdif9/ZddintQicF+lA=="; 5:  6: var client = new DocumentClient(endpoint, key); 7:  8: var collectionLink = "dbs/AAk3AA==/colls/AAk3AP6oFgA=/"; 9:  10: SelectDocs(client, collectionLink); 11:  12: Console.WriteLine("done"); 13: Console.ReadKey(); 14: } 15:  16: static void SelectDocs(DocumentClient client, string collectionLink) 17: { 18: var docs = client.CreateDocumentQuery(collectionLink + "docs/").ToList(); 19: foreach(var doc in docs) 20: { 21: Console.WriteLine(doc); 22: } 23: } Since there's only one document in my collection below is the result when I executed the code. As you can see all properties, includes the array was retrieve at the same time. DocumentDB also attached some properties we didn't specified such as "_rid", "_ts", "_self" etc., which is controlled by the service.   DocumentDB Benefit DocumentDB is a document NoSQL database service. Different from the traditional database, document database is truly schema-free. In a short nut, you can save anything in the same database and collection if it could be serialized to JSON. We you query the document database, all sub documents will be retrieved at the same time. This means you don't need to join other tables when using a traditional database. Document database is very useful when we build some high performance system with hierarchical data structure. For example, assuming we need to build a blog system, there will be many blog posts and each of them contains the content and comments. The comment can be commented as well. If we were using traditional database, let's say SQL Server, the database schema might be defined as below. When we need to display a post we need to load the post content from the Posts table, as well as the comments from the Comments table. We also need to build the comment tree based on the CommentID field. But if were using DocumentDB, what we need to do is to save the post as a document with a list contains all comments. Under a comment all sub comments will be a list in it. When we display this post we just need to to query the post document, the content and all comments will be loaded in proper structure. 1: { 2: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 3: "title": "xxxxx", 4: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 5: "postedOn": "08/25/2014 13:55", 6: "comments": 7: [ 8: { 9: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 10: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 11: "commentedOn": "08/25/2014 14:00", 12: "commentedBy": "xxx" 13: }, 14: { 15: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 16: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 17: "commentedOn": "08/25/2014 14:10", 18: "commentedBy": "xxx", 19: "comments": 20: [ 21: { 22: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 23: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 24: "commentedOn": "08/25/2014 14:18", 25: "commentedBy": "xxx", 26: "comments": 27: [ 28: { 29: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 30: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 31: "commentedOn": "08/25/2014 18:22", 32: "commentedBy": "xxx", 33: } 34: ] 35: }, 36: { 37: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 38: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 39: "commentedOn": "08/25/2014 15:02", 40: "commentedBy": "xxx", 41: } 42: ] 43: }, 44: { 45: "id": "xxxxx-xxxxx-xxxxx-xxxxx", 46: "content": "xxxxx, xxxxxxxxx. xxxxxx, xx, xxxx.", 47: "commentedOn": "08/25/2014 14:30", 48: "commentedBy": "xxx" 49: } 50: ] 51: }   DocumentDB vs. Table Storage DocumentDB and Table Storage are all NoSQL service in Microsoft Azure. One common question is "when we should use DocumentDB rather than Table Storage". Here are some ideas from me and some MVPs. First of all, they are different kind of NoSQL database. DocumentDB is a document database while table storage is a key-value database. Second, table storage is cheaper. DocumentDB supports scale out from one capacity unit to 5 in preview period and each capacity unit provides 10GB local SSD storage. The price is $0.73/day includes 50% discount. For storage service the highest price is $0.061/GB, which is almost 10% of DocumentDB. Third, table storage provides local-replication, geo-replication, read access geo-replication while DocumentDB doesn't support. Fourth, there is local emulator for table storage but none for DocumentDB. We have to connect to the DocumentDB on cloud when developing locally. But, DocumentDB supports some cool features that table storage doesn't have. It supports store procedure, trigger and user-defined-function. It supports rich indexing while table storage only supports indexing against partition key and row key. It supports transaction, table storage supports as well but restricted with Entity Group Transaction scope. And the last, table storage is GA but DocumentDB is still in preview.   Summary In this post I have a quick demonstration and introduction about the new DocumentDB service in Azure. It's very easy to interact through .NET and it also support REST API, Node.js SDK and Python SDK. Then I explained the concept and benefit of  using document database, then compared with table storage.   Hope this helps, Shaun All documents and related graphics, codes are provided "AS IS" without warranty of any kind. Copyright © Shaun Ziyan Xu. This work is licensed under the Creative Commons License.

    Read the article

  • First Step Towards Rapid Enterprise Application Deployment

    - by Antoinette O'Sullivan
    Take Oracle VM Server for x86 training as a first step towards deploying enterprise applications rapidly. You have a choice between the following instructor-led training: Oracle VM with Oracle VM Server for x86 1-day Seminar. Take this course from your own desk on one of the 300 events on the schedule. This seminar tells you how to build a virtualization platform using the Oracle VM Manager and Oracle VM Server for x86 and to sustain the deployment of highly configurable, inter-connected virtual machines. Oracle VM Administration: Oracle VM Server for x86 3-day hands on course. This course teaches you how to build a virtualization platform using the Oracle VM Manager and Oracle VM Server for x86. You learn how deploy and manage highly configurable, inter-connected virtual machines. The course teaches you how to install and configure Oracle VM Server for x86 as well as details of network and storage configuration, pool and repository creation, and virtual machine management.Take this course from your own desk on one of the 450 events on the schedule. You can also take this course in an Oracle classroom on one of the following events:  Location  Date  Delivery Language  Istanbul, Turkey  12 November 2012  Turkish  Wellington, New Zealand  10 Dec 2012  English  Roseveille, United States  19 November 2012  English  Warsaw, Poland  17 October 2012  Polish  Paris, France  17 October 2012  French  Paris, France  21 November 2012  French  Dusseldorfm Germany  5 November 2012  German For more information on Oracle's Virtualization courses see http://oracle.com/education/vm

    Read the article

  • Global Indian Developer Summit (GIDS), JavaOne Moscow, Java Summit Chennai

    - by arungupta
    My whirlwind tour of Java EE and GlassFish starts next weekend and covers the following cities in the next 6 weeks: JavaOne and Oracle Develop, Moscow Global Indian Developer Summit, Bangalore Java Summit, Chennai JavaOne, Hyderabad OTN Developer Day, Pune OTN Developer Day, Istanbul Geecon, Poznan JEEConf, Kiev OTN Developer Day, Johannesburg Several other members of the team will be speaking at some of these events as well. Please feel free to reach out to any of us, ask a question, and share your passion. Here is the first set of conferences coming up: Date: Apr 17-18 Schedule My Schedule       Deploying your Java EE 6 Applications in Producion hands-on lab       Technical Keynote       Some other technical sessions Venue: Russian Academy of Sciences Register Connect: @OracleRU Date: April 17-20 Schedule (date decided, time slots TBD) My Schedule: NetBeans/Java EE 6 workshop on April 19th, Other sessions (as listed above) on April 20 Venue: J. N. Tata Auditorium, National Science Symposium Complex, Sir C. V. Raman Avenue, Bangalore, India Register Connect: @GreatIndianDev Date: April 21, 2011 Schedule My Schedule: Java EE 7 at 9:30am, JAX-RS 2.0 at 11am Venue: VELS University Register (FREE) Connect: @jug_c Where will I meet or run with you ? Do ask me to record a video session if you are using GlassFish and would like to share your story at blogs.oracle.com/stories.

    Read the article

  • Top Reasons to Take the MySQL Cluster Training

    - by Antoinette O'Sullivan
    Here are the top reasons to take the authorized MySQL Cluster training course: Take training which was developed by MySQL Cluster product team and delivered by the MySQL Cluster experts at Oracle Learn how to develop, deploy, manage and scale your MySQL Cluster applications more efficiently Keep your mission-critical applications and essential services up and running 24x7 Deliver the highest performance and scalability using MySQL Cluster best practices In this 3 day course, experienced database users learn the important details of clustering necessary to get started with MySQL Cluster, to properly configure and manage the cluster nodes to ensure high availability, to install the different nodes and provide a better understanding of the internals of the cluster. To see the schedule for this course, go to the Oracle University Portal (click on MySQL). Should you not see an event for a location/date that suits you, register your interest in additional events. Here is a small sample of the events already on the schedule for the MySQL Cluster course:  Location  Date  Delivery Language  Prague, Czech Republic  17 September 2012  Czech  Warsaw, Poland  1 August 2012  Polish  London, United Kingdom  18 July 2012  English  Lisbon, Portugal  3 December 2012  European Portugese  Nice, France  8 October 2012  French  Barcelona, Spain  25 September 2012  Spanish  Madrid, Spain  20 August 2012  Spanish  Denver, United States  17 October 2012  English  Chicago, United States  22 August 2012  English  Petaling Jaya, Malaysia  10 October 2012  English  Singapore  21 August 2012  English  Mexico City, Mexico  23 July 2012  Spanish

    Read the article

  • Silverlight Cream for November 25, 2011 -- #1174

    - by Dave Campbell
    In this Issue: Michael Collier, Samidip Basu, Jesse Liberty, Dhananjay Kumar, and Michael Crump. Above the Fold: WP7: "31 Days of Mango | Day #16: Isolated Storage Explorer" Samidip Basu Metro/WinRT/W8: "1360x768x32 Resolution in Windows 8 in VirtualBox" Michael Crump Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up Alex Golesh releases a Silverlight 5-friendly version of his external map manifest file tool: Utility: Extmap Maker v1.1From SilverlightCream.com:31 Days of Mango | Day #17: Using Windows AzureMichael Collier has Jeff Blankenburg's Day 17 and is talking about Azure services for your Phone apps... great discussion on this... good diagrams, code, and entire project to download31 Days of Mango | Day #16: Isolated Storage ExplorerSamidip Basu has Jeff Blankenburg's 31 Days for Day 16, and is discussing ISO, and the Isolated Storage Explorer which helps peruse ISO either in the emulator or on your deviceTest Driven Development–Testing Private ValuesJesse Liberty's got a post up discussing TDD in his latest Full Stack excerpt wherein he and Jon Galloway are building a Pomodoro timer app. He has a solution for dealing with private member variables and is looking for feedbackVideo on How to work with System Tray Progress Indicator in Windows Phone 7Dhananjay Kumar's latest video tutorial is up... covering working with the System Tray Progress Indicator in WP7, as the title says :)1360x768x32 Resolution in Windows 8 in VirtualBoxMichael Crump is using a non-standard resolution with Win8 preview and demosntrates how to make that all work with VirtualBoxMichaelStay in the 'Light!Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCreamJoin me @ SilverlightCream | Phoenix Silverlight User GroupTechnorati Tags:Silverlight    Silverlight 3    Silverlight 4    Windows PhoneMIX10

    Read the article

< Previous Page | 48 49 50 51 52 53 54 55 56 57 58 59  | Next Page >