Search Results

Search found 52807 results on 2113 pages for 'system tables'.

Page 528/2113 | < Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >

• getting data problem with MYSQL under linux

  - by aelshereay

  Hi all, Recently I started to use Linux (Ubuntu 9.10) instead of windows. I am working on a java web application with Spring, MYSQL with jpa. However, before to install linux I made a backup file from the database, then installed linux, installed the MYSQL Query Browser and Administrator tools, and using the Admin tool restored the backup file, then got all the tables and made a simple select statement from one of the tables and got result normally and everything seems to work just fine. There a USER table, and there's a namedQuery defined to get a user by userName, the problem is that when I pass a correct userName I still get nothing! I really don't know what is the problem! The application was working perfectly under windows! Please, can anyone help me to solve this problem? Thank you in advance.

  Read the article

• sql server script generater stored proc

  - by Kumar

  anyone know of such stored procs to generate scripts for tables/indexex/views/sp's etc.

  Read the article

• Help Auditing in Oracle

  - by enrique

  Hello everybody I need some help in auditing in Oracle. We have a database with many tables and we want to be able to audit every change made to any table in any field. So the things we want to have in this audit are: user who modified time of change occurred old value and new value so we started creating the trigger which was supposed to perform the audit for any table but then had issues... As I mentioned before we have so many tables and we cannot go creating a trigger per each table. So the idea is creating a master trigger that can behaves dynamically for any table that fires the trigger. I was trying to do it but no lucky at all....it seems that Oracle restricts the trigger environment just for a table which is declared by code and not dynamically like we want to do. Do you have any idea on how to do this or any other advice for solving this issue? thanks in advance.

  Read the article

• Need advice on which PCI SATA Controller Card to Purchase

  - by Matt1776

  I have a major issue with the build of a machine I am trying to get up and running. My goal is to create a file server that will service the needs of my software development, personal media storage and streaming/media server needs, as well as provide a strong platform for backing up all this data in a routine, cron-job oriented German efficiency sort of way. The issue is a simple one - all my drives are SATA drives and my motherboard controller only contains 4 ports. Solving the issue has proven to be an unmitigated nightmare. I would like advice on the purchase of the following: 4 Port internal SATA / 2 Port external eSATA PCI SATA Controller Card that has the following features and/or advantages: It must function. If I plug it in and attach drives, I expect my system to still make it to the Operating System login screen. It must function on CentOS, and I mean it must function WELL and with MINIMAL hassle. If hassle is unavoidable, there shall be CLEAR CUT and EASY TO FOLLOW instructions on how to install drivers and other supporting software. I do not need nor want fakeRAID - I will be setting up any RAID configurations from within the operating system. Now, if I am able to find such a mythical device, I would be eternally grateful to whomever would be able to point me in the right direction, a direction which I assume will be paved with yellow bricks. I am prepared to pay a considerable sum of money (as SATA controller cards go) and so paying anywhere between 60 to 120 dollars will not be an issue whatsoever. Does such a magical device exist? The following link shows an "example" of the type of thing I am looking for, however, I have no way of verifying that once I plug this baby in that my system will still continue to function once I've attached the drives, or that once I've made it to the OS, I will be able to install whatever drivers or software programs I need to make it work with relative ease. It doesn't have to be dog-shit simple, but it cannot involve kernels or brain surgery. http://www.amazon.com/gp/product/B00552PLN4/ref=pd_lpo_k2_dp_sr_1?pf_rd_p=486539851&pf_rd_s=lpo-top-stripe-1&pf_rd_t=201&pf_rd_i=B003GSGMPU&pf_rd_m=ATVPDKIKX0DER&pf_rd_r=1HJG60XTZFJ48Z173HKY So does anyone have a suggestion regarding the subject I am asking about? PCI SATA Controller Cards? It would help if you've had experience with the component before - that is after all why I am asking here - for those who have had experience that I do not have. Bear in mind that this is for a home setup and that I do not have a company credit card. I have a budget with a 'relative' upper limit of about $150.00.

  Read the article

• EBS with RAID0 (striping) and restoring snapshots

  - by grourk

  We have a MySQL database on EC2 and are looking at the disk IO performance there. Currently we have a single EBS volume with XFS and take snapshots for backup. It seems that a lot of people have seen significant performance gains by striping across multiple EBS volumes with software RAID. If this is done, how does one take snapshots and ensure the consistency of the file system? It seems to me that restoring the file system from multiple snapshots could be tricky.

  Read the article

• Using Delphi's ShellExecute() with the process inheriting the original console?

  - by Phil

  In C I've used the system() function before in a console application and if I start another process using system() it inherits the console window of the process that called it. In Delphi system() doesn't exist so I'm using ShellExecute() to create a new process, but the new process comes up in a new console window. Is there some way that I can make it inherit the handle of the window that's calling it? I've used function GetConsoleWindow(): HWND; stdcall; external 'kernel32.dll'; to get the console window and passed it in the HWND part of ShellExecute(), but that didn't work.

  Read the article

• Changing a limited user account in XP fails

  - by javamonkey79

  I have the following: using System; using System.DirectoryServices.AccountManagement; public class ChangePassword { public static void Main() { PrincipalContext context = new PrincipalContext(ContextType.Machine); UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); user.ChangePassword( "xxx", "zzz" ); } } This works just fine with administrator accounts, but seems to crash like so when I try to change limited accounts in XP: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at ChangePassword.Main() Is what I am trying to do possible? If so, how? EDIT #1: I added the following: Console.WriteLine( "user: " + user ); Below this line: UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); And I get this: user: It doesn't look like user is null when I print it, but then again I'm not really a .Net guy - I seem to remember this being expected behavior.

  Read the article

• http://localhost/ always gives 502 unknown host

  - by Nitesh Panchal

  My service for World Wide Web Publishing Service started successfully but whenever I browse to http://localhost/ I always get 502 Unknown host. Also, wampapache is installed side by side but when I stop IIS service and start wampapache from services.msc I get error and when I view it in System event log I get this error: - <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> - <System> <Provider Name="Service Control Manager" Guid="{555908d1-a6d7-4695-8e1e-26931d2012f4}" EventSourceName="Service Control Manager" /> <EventID Qualifiers="49152">7024</EventID> <Version>0</Version> <Level>2</Level> <Task>0</Task> <Opcode>0</Opcode> <Keywords>0x8080000000000000</Keywords> <TimeCreated SystemTime="2011-06-12T17:43:28.223498400Z" /> <EventRecordID>346799</EventRecordID> <Correlation /> <Execution ProcessID="456" ThreadID="3936" /> <Channel>System</Channel> <Computer>MACHINENAME</Computer> <Security /> </System> - <EventData> <Data Name="param1">wampapache</Data> <Data Name="param2">%%1</Data> </EventData> </Event> I am fed up of this error and it is driving me nuts. I feel like banging my head against the laptop. I am really serious. Without concentrating on my real application I am trying to solve this issue since 3 hours. I google various threads and few of them said that there could be issue of Reporting Services or Skype. But I have uninstalled Skype and Reporting Services are disabled. What more should I do? I have hosts file present in etc directory and it does have mapping for localhost to 127.0.0.1. What more could I do?

  Read the article

• How to resolve this error in subversion installation?

  - by Karthik

  C:net start svnserver System error 2 has occurred. The system cannot find the file specified. I tried following this tutorial http://www.codinghorror.com/blog/2008/04/setting-up-subversion-on-windows.html

  Read the article

• Using java.util.logging, is it possible to restart logs after a certain period of time?

  - by Fry

  I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

  Read the article

• Agile Approach for WCM

  - by cameron.f.logan

  Can anyone provide me with advice, opinions, or experience with using an agile methodology to delivery an enterprise-scale Web Content Management system (e.g., Interwoven TeamSite, Tridion)? My current opinion is that to implement a CM system there is a certain--relatively high--amount of upfront work that needs to happen to make sure the system is going to be scalable and efficient for future projects for the multi-year lifespan an WCM is expected to have. This suggests a hybrid approach at best, if not a more waterfall-like approach. I'm really interested to learn what approaches others have taken. Thanks.

  Read the article

• SWT Filedialog Open into home folder

  - by Ivan

  I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

  Read the article

• MS Access (2010) Enable Design View

  - by Tim GONELLA

  I downloaded the Access template below for doing a home inventory: http://office.microsoft.com/en-us/templates/results.aspx?qu=home%20inventory&ex=1&queryid=0d245f2a%2Dacdc%2D4161%2D92c8%2D8ba16a52ab32&AxInstalled=1&c=0#ai:TC101918100| The design view is not visible, which is a bit of a nuisance. Things I've tried: 1) In options/options/current database/ the check boxes (enable layout view & enable design changes for tables in Datasheet view) are both greyed out. 2) I've unblocked the file using Right-Click-Properties. 3) I've tried copying/exporting the objects to another database. But can only copy/export the tables. 4) I've tried holding shift when opening the DB. 5) Enabling all trust permissions etc. None of these work Does anybody have any suggestions. (I'm using Office 2010) Thanks

  Read the article

• Asp.Net MVC best way to update cached table

  - by Eddy Mishiyev

  There are certain tables that get called often but updated rarely. One of these tables is Departments. So to save DB trips, I think it is ok to cache this table taking into consideration that the table has very small size. However, once you cached it an issue of keeping the table data fresh occurs. So what is the best way to determine that the table is dirty and therefore requires a reload and how that code should be invoked. I look for solution that will be scalable. So updating the cache right after inserting will not work. So if one machine inserted the record all other on network should get notified to reload the cache. I was thinking for calling corresponding web service from T-SQL but don't really like the idea of consuming recourses on sql server. So what are the best practices to resolve this type of problems. Thanks in advance Eddy

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Sending the files (At least 11 files) from folder through web service to android app.

  - by Shashank_Itmaster

  Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

  Read the article

• SQL 2005: Select top N, group by ID with joins

  - by Suzy Fresh

  I'm having real difficulty with a query involving 3 tables. I need to get the 3 newest users per department grouped by department names. The groups should be sorted by the users.dateadded so the department with the newest activity is first. The users can exist in multiple departments so Im using a lookup table that just contains the userID and deptID. My tables are as follows. Department - depID|name Users - userID|name|dateadded DepUsers - depID|userID The output I need would be Receiving John Doe - 4/23/2010 Bill Smith - 4/22/2010 Accounting Steve Jones - 4/22/2010 John Doe - 4/21/2010 Auditing Steve Jones - 4/21/2010 Bill Smith - 4/21/2010

  Read the article

• Lookahead regex produces unexpected group

  - by Ivan Yatskevich

  I'm trying to extract a page name and query string from a URL which should not contain .html Here is an example code in Java: public class TestRegex { public static void main(String[] args) { Pattern pattern = Pattern.compile("/test/(((?!\\.html).)+)\\?(.+)"); Matcher matcher = pattern.matcher("/test/page?param=value"); System.out.println(matcher.matches()); System.out.println(matcher.group(1)); System.out.println(matcher.group(2)); } } By running this code one can get the following output: true page e What's wrong with my regex so the second group contains the letter e instead of param=value?

  Read the article

• ASP.net error message when using REST starter kit

  - by jonhobbs

  Hi all, I've written some code using the REST starter kit and it works fine on my development machine. However, when I upload it to our server the page gives me the following error message... CS1684: Warning as Error: Reference to type 'System.Runtime.Serialization.Json.DataContractJsonSerializer' claims it is defined in 'c:\WINNT\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', but it could not be found I've removed code line by line and it appears that the following line of code is triggering the error... HttpContent newOrganizationContent = HttpContentExtensions.CreateXmlSerializable(newOrganizationXml); Really haven't got a clue how to fix it. I assumed it might be because it needs a newer version of the framework to run, but looking in IIS it says it's running version 2.0.50727 which I think is the lates version because it says that even when we're using framework 3.5 Very confused, any ideas? Jon

  Read the article

• Is there a way to only backup a SQL 2005 database structure fully, but only the data in a certain se

  - by TheSoftwareJedi

  I have several schemas in my database, and the largest one ("large" meaning disk space consumed) is my "web" schema which is a denormalized copy of data in the operational schemas. This denormalized data is able to be reconstructed at anytime, and is merely there for extremely fast read purposes. Since the data is redundant, and VERY large - I'd like to exclude it from being backed up. I already have stored procedures that can regenerate all of the data in that schema in a couple of hours - for use in the event of a failure. I assume I can split the tables in this schema out to another data file or such (ideally even on another drive for faster reads), but is there a way to never have that data file backup, yet still in the event of a failure its structure could be restored (and other DDL stuff like procs, views, etc)? Somewhat related, can I also have these tables not do transaction logging, if I go to "Full" backup mode for the rest of the database?

  Read the article

• castle monorails httpHandlers

  - by bogdanbrudiu

  I have a question and I hope you can help me solve it... I have a castle monorails application. In web.config file in httphandlers I have *.aspx maped to monorails (my hosting does not suport other extensions...) <add verb="*" path="*.aspx" type="Castle.MonoRail.Framework.MonoRailHttpHandlerFactory,Castle.MonoRail.Framework"/> The problem is that I have some Webforms pages that I want to work with aspx... So I am adding something like this to the web.config file... <add verb="*" path="connector.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="ChatPage.aspx*" type="System.Web.UI.PageHandlerFactory"/> <add verb="*" path="Logon.aspx*" type="System.Web.UI.PageHandlerFactory"/> Still it does not work.. What am I doing wrong?

  Read the article

• mysql - how do I load data from a different configuration...

  - by Ronedog

  I'm not sure if this will make sense, but I'll give it a shot. My hard drive went down and I had to reinstall the os along with all my webserver configuration,etc. I kept a backup of the mysql database, but it doesn't contain all the tables...I added a couple tables after my last backup. I have access to the hard drive and the directory where the mysql data files are stored from the failed hard drive, but I don't know how to retrieve the data into my new mysql database. Is it even possible to get the raw data files from mysql and load them into a different instance? I'd even be happy if there was some way for phpmyadmin to show the data files, then I could dump out to a backup txt file, and reload them into my new configuration. Any help will be appreciated. thanks.

  Read the article

• Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

  - by Synetech inc.

  Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

  Read the article

• BlackBerry - Exception with null message when sending sms using Connector

  - by vikram deshpande

  I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

  Read the article

• SQL: ATER COLUMN to shorter CHAR(n) type

  - by Rising Star

  I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

  Read the article

< Previous Page | 524 525 526 527 528 529 530 531 532 533 534 535  | Next Page >