Search Results

Search found 1331 results on 54 pages for 'till backhaus'.

Page 53/54 | < Previous Page | 49 50 51 52 53 54  | Next Page >

• "Randomly" occurring errors...

  - by ClarkeyBoy

  Hi, My website has a setup whereby when the application starts a module called SiteContent is "created". This runs a clearup function which basically deletes any irrelevant data from the database, in case any has been left in there from previously run functions. The module has instances of Manager classes - namely RangeManager, CollectionManager, DesignManager. There are others but I will just use these as an example. Each Manager class contains an array of items - items may be of type Range, Collection or Design, whichever one is relevant. Data for each range is then read into an instance of Range, Collection or Design. I know this is basically duplicating data - not very efficient but its my final year project at the moment so I can always change it to use Linq or something similar later, when I am not pressured by the one month deadline. I have a form which, on clicking the Save button, saves data by calling SiteContent.RangeManager.Create(vars) or SiteContent.RangeManager.Update(Range As Range, vars) (or the equivalent for other manager classes, whichever one happens to be relevant). These functions call a stored procedure to insert or update in the relevant table. Classes Range, Collection and Design all have attributes such as Name, Description, Display and several others. When the Create or Update function is called, the Manager loops through all the other items to check if an item with the same name already exists. The Update function ensures that it does not compare the item being updated to itself. A custom exception (ItemAlreadyExistsException) is thrown if another item with the same name is found. For some weird reason, if I go into a Range, Collection or Design in edit mode, change something and try to update it, it occasionally doesnt update the item. When I say occasionally I mean every 3 - 4 page loads, sometimes more. I see absolutely no pattern in when or why it occurs. I have a try-catch statement which catches ItemAlreadyExistsException, and outputs "An item with this name already exists" when caught. Occasionally it will output this; other times it will not. Does anyone have any idea why this could happen? Maybe a mistake which someone has made and solved before? I used to have regular expressions in place that the names were compared to - I believe it was [a-zA-Z]{1, 100} (between 1 and 100 lower- or upper-case characters). For some reason the customer who I am developing the site for used to get errors saying its not in the correct format. Yet he could try the same text 5 minutes later and it would work fine. I am thinking this could well be the same problem, since both problems occur at random. Many thanks in advance. Regards, Richard Clarke Edit: After much time spent narrowing down the code, I have decided to wait till my brother, who has been a programmer for at least 8 years more than I have, to come down over Easter and get him to have a look at it. If he cant solve it then I will zip the files up and put them somewhere for people to access and have a go at. I narrowed it down literally to the minimum number of files possible, and it still occurs. It seems to be about every 10th time. Having said that, I force the manager classes to refresh every 10 page loads or 5 minutes (whichever one is sooner). I may look into this - this could be causing a problem. Basically each Manager contains an array of an object. This array is populated using data from the database. The Update function takes an instance of the item and the new values to be set for the object. If it happens to be a page load where the array is reset (ie the data is loaded freshly from the database) then the object instance with the same ID wont be the same instance as the one being passed in. This explains the fact that it throws an ItemAlreadyExistsException now and then. It all makes sense now the more I think about it. If I were to pass in the ID of the object to be altered, rather than the object itself, then it should work perfectly. I will answer the question if I solve it..

  Read the article

• GWT Query fails second time -only.

  - by Koran

  HI, I have a visualization function in GWT which calls for two instances of the same panels - two queries. Now, suppose one url is A and the other url is B. Here, I am facing an issue in that if A is called first, then both A and B works. If B is called first, then only B works, A - times out. If I call both times A, only the first time A works, second time it times out. If I call B twice, it works both times without a hitch. Even though the error comes at timed out, it actually is not timing out - in FF status bar, it shows till - transferring data from A, and then it gets stuck. This doesnt even show up in the first time query. The only difference between A and B is that B returns very fast, while A returns comparitively slow. The sample code is given below: public Panel(){ Runnable onLoadCallback = new Runnable() { public void run() { Query query = Query.create(dataUrl); query.setTimeout(60); query.send(new Callback() { public void onResponse(QueryResponse response) { if (response.isError()){ Window.alert(response.getMessage()); } } } } VisualizationUtils.loadVisualizationApi(onLoadCallback, PieChart.PACKAGE); } What could be the reason for this? I cannot think of any reason why this should happen? Why is this happening only for A and not for B? EDIT: More research. The query which works all the time (i.e. B is the example URL given in GWT visualization site: see comment [1]). So, I tried in my app engine to reproduce it - the following way s = "google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});"; response = HttpResponse(s, content_type="text/plain; charset=utf-8") response['Expires'] = time.strftime('%a, %d %b %Y %H:%M:%S GMT', time.gmtime()) return response Where s is the data when we run the query for B. I tried to add Expires etc too, since that seems to be the only header which has the difference, but now, the query fails all the time. For more info - I am now sending the difference between my server response vs the working server response. They seems to be pretty similar. HTTP/1.0 200 OK Content-Type: text/plain Date: Wed, 16 Jun 2010 11:07:12 GMT Server: Google Frontend Cache-Control: private, x-gzip-ok="" google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});Connection closed by foreign host. Mac$ telnet spreadsheets.google.com 80 Trying 209.85.231.100... Connected to spreadsheets.l.google.com. Escape character is '^]'. GET http://spreadsheets.google.com/tq?key=pWiorx-0l9mwIuwX5CbEALA&range=A1:B12&gid=0&headers=-1 HTTP/1.0 200 OK Content-Type: text/plain; charset=UTF-8 Date: Wed, 16 Jun 2010 11:07:58 GMT Expires: Wed, 16 Jun 2010 11:07:58 GMT Cache-Control: private, max-age=0 X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block Server: GSE google.visualization.Query.setResponse({version:'0.6',status:'ok',sig:'106459472',table:{cols:[{id:'A',label:'Source',type:'string',pattern:''},{id:'B',label:'Percent',type:'number',pattern:'#0.01%'}],rows:[{c:[{v:'Oil'},{v:0.37,f:'37.00%'}]},{c:[{v:'Coal'},{v:0.25,f:'25.00%'}]},{c:[{v:'Natural Gas'},{v:0.23,f:'23.00%'}]},{c:[{v:'Nuclear'},{v:0.06,f:'6.00%'}]},{c:[{v:'Biomass'},{v:0.04,f:'4.00%'}]},{c:[{v:'Hydro'},{v:0.03,f:'3.00%'}]},{c:[{v:'Solar Heat'},{v:0.005,f:'0.50%'}]},{c:[{v:'Wind'},{v:0.003,f:'0.30%'}]},{c:[{v:'Geothermal'},{v:0.002,f:'0.20%'}]},{c:[{v:'Biofuels'},{v:0.002,f:'0.20%'}]},{c:[{v:'Solar photovoltaic'},{v:4.0E-4,f:'0.04%'}]}]}});Connection closed by foreign host. Also, please note that App engine did not allow the Expires header to go through - can that be the reason? But if that is the reason, then it should not fail if B is sent first and then A. Comment [1] : http://spreadsheets.google.com/tq?key=pWiorx-0l9mwIuwX5CbEALA&range=A1:B12&gid=0&headers=-1

  Read the article

• Problem using Hibernate-Search

  - by KCore

  Hi, I am using hibernate search for my application. It is well configured and running perfectly till some time back, when it stopped working suddenly. The reason according to me being the number of my model (bean) classes. I have some 90 classes, which I add to my configuration, while building my Hibernate Configuration. When, I disable hibernate search (remove the search annotations and use Configuration instead of AnnotationsConfiguration), I try to start my application, it Works fine. But,the same app when I enable search, it just hangs up. I tried debugging and found the exact place where it hangs. After adding all the class to my AnnotationsConfiguration object, when I say cfg.buildSessionfactory(), It never comes out of that statement. (I have waited for hours!!!) Also when I decrease the number of my model classes (like say to half i.e. 50) it comes out of that statement and the application works fine.. Can Someone tell why is this happening?? My versions of hibernate are: hibernate-core-3.3.1.GA.jar hibernate-annotations-3.4.0.GA.jar hibernate-commons-annotations-3.1.0.GA.jar hibernate-search-3.1.0.GA.jar Also if need to avoid using AnnotationsConfiguration, I read that I need to configure the search event listeners explicitly.. can anyone list all the neccessary listeners and their respective classes? (I tried the standard ones given in Hibernate Search books, but they give me ClassNotFound exception and I have all the neccesarty libs in classpath) Here are the last few lines of hibernate trace I managed to pull : 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:33,716 INFO SettingsFactory:181 - JDBC batch size: 15 16:09:33,719 INFO SettingsFactory:184 - JDBC batch updates for versioned data: disabled 16:09:33,721 INFO SettingsFactory:189 - Scrollable result sets: enabled 16:09:33,723 DEBUG SettingsFactory:193 - Wrap result sets: disabled 16:09:33,725 INFO SettingsFactory:197 - JDBC3 getGeneratedKeys(): enabled 16:09:33,727 INFO SettingsFactory:205 - Connection release mode: auto 16:09:33,730 INFO SettingsFactory:229 - Maximum outer join fetch depth: 2 16:09:33,732 INFO SettingsFactory:232 - Default batch fetch size: 1000 16:09:33,735 INFO SettingsFactory:236 - Generate SQL with comments: disabled 16:09:33,737 INFO SettingsFactory:240 - Order SQL updates by primary key: disabled 16:09:33,740 INFO SettingsFactory:244 - Order SQL inserts for batching: disabled 16:09:33,742 INFO SettingsFactory:420 - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 16:09:33,744 INFO ASTQueryTranslatorFactory:47 - Using ASTQueryTranslatorFactory 16:09:33,747 INFO SettingsFactory:252 - Query language substitutions: {} 16:09:33,750 INFO SettingsFactory:257 - JPA-QL strict compliance: disabled 16:09:33,752 INFO SettingsFactory:262 - Second-level cache: enabled 16:09:33,754 INFO SettingsFactory:266 - Query cache: disabled 16:09:33,757 INFO SettingsFactory:405 - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 16:09:33,759 INFO RegionFactoryCacheProviderBridge:61 - Cache provider: net.sf.ehcache.hibernate.EhCacheProvider 16:09:33,762 INFO SettingsFactory:276 - Optimize cache for minimal puts: disabled 16:09:33,764 INFO SettingsFactory:285 - Structured second-level cache entries: disabled 16:09:33,766 INFO SettingsFactory:314 - Statistics: disabled 16:09:33,769 INFO SettingsFactory:318 - Deleted entity synthetic identifier rollback: disabled 16:09:33,771 INFO SettingsFactory:333 - Default entity-mode: pojo 16:09:33,774 INFO SettingsFactory:337 - Named query checking : enabled 16:09:33,869 INFO Version:20 - Hibernate Search 3.1.0.GA 16:09:35,134 DEBUG DocumentBuilderIndexedEntity:157 - Field selection in projections is set to false for entity **com.xyz.abc**. recognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernateDocumentBuilderIndexedEntity Donno what the last line indicates ??? (hibernaterecognized....) After the last line it doesnt do anything (no trace too ) and just hangs....

  Read the article

• WP: AesManaged encryption vs. mcrypt_encrypt

  - by invalidusername

  I'm trying to synchronize my encryption and decryption methods between C# and PHP but something seems to be going wrong. In the Windows Phone 7 SDK you can use AESManaged to encrypt your data I use the following method: public static string EncryptA(string dataToEncrypt, string password, string salt) { AesManaged aes = null; MemoryStream memoryStream = null; CryptoStream cryptoStream = null; try { //Generate a Key based on a Password, Salt and HMACSHA1 pseudo-random number generator Rfc2898DeriveBytes rfc2898 = new Rfc2898DeriveBytes(password, Encoding.UTF8.GetBytes(salt)); //Create AES algorithm with 256 bit key and 128-bit block size aes = new AesManaged(); aes.Key = rfc2898.GetBytes(aes.KeySize / 8); aes.IV = new byte[] { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }; // rfc2898.GetBytes(aes.BlockSize / 8); // to check my results against those of PHP var blaat1 = Convert.ToBase64String(aes.Key); var blaat2 = Convert.ToBase64String(aes.IV); //Create Memory and Crypto Streams memoryStream = new MemoryStream(); cryptoStream = new CryptoStream(memoryStream, aes.CreateEncryptor(), CryptoStreamMode.Write); //Encrypt Data byte[] data = Encoding.Unicode.GetBytes(dataToEncrypt); cryptoStream.Write(data, 0, data.Length); cryptoStream.FlushFinalBlock(); //Return Base 64 String string result = Convert.ToBase64String(memoryStream.ToArray()); return result; } finally { if (cryptoStream != null) cryptoStream.Close(); if (memoryStream != null) memoryStream.Close(); if (aes != null) aes.Clear(); } } I solved the problem of generating the Key. The Key and IV are similar as those on the PHP end. But then the final step in the encryption is going wrong. here is my PHP code <?php function pbkdf2($p, $s, $c, $dk_len, $algo = 'sha1') { // experimentally determine h_len for the algorithm in question static $lengths; if (!isset($lengths[$algo])) { $lengths[$algo] = strlen(hash($algo, null, true)); } $h_len = $lengths[$algo]; if ($dk_len > (pow(2, 32) - 1) * $h_len) { return false; // derived key is too long } else { $l = ceil($dk_len / $h_len); // number of derived key blocks to compute $t = null; for ($i = 1; $i <= $l; $i++) { $f = $u = hash_hmac($algo, $s . pack('N', $i), $p, true); // first iterate for ($j = 1; $j < $c; $j++) { $f ^= ($u = hash_hmac($algo, $u, $p, true)); // xor each iterate } $t .= $f; // concatenate blocks of the derived key } return substr($t, 0, $dk_len); // return the derived key of correct length } } $password = 'test'; $salt = 'saltsalt'; $text = "texttoencrypt"; #$iv_size = mcrypt_get_iv_size(MCRYPT_RIJNDAEL_128, MCRYPT_MODE_CBC); #echo $iv_size . '<br/>'; #$iv = mcrypt_create_iv($iv_size, MCRYPT_RAND); #print_r (mcrypt_list_algorithms()); $iv = "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00"; $key = pbkdf2($password, $salt, 1000, 32); echo 'key: ' . base64_encode($key) . '<br/>'; echo 'iv: ' . base64_encode($iv) . '<br/>'; echo '<br/><br/>'; function addpadding($string, $blocksize = 32){ $len = strlen($string); $pad = $blocksize - ($len % $blocksize); $string .= str_repeat(chr($pad), $pad); return $string; } echo 'text: ' . $text . '<br/>'; echo 'text: ' . addpadding($text) . '<br/>'; // -- works till here $crypttext = mcrypt_encrypt(MCRYPT_RIJNDAEL_256, $key, $text, MCRYPT_MODE_CBC, $iv); echo '1.' . $crypttext . '<br/>'; $crypttext = base64_encode($crypttext); echo '2.' . $crypttext . '<br/>'; $crypttext = mcrypt_encrypt(MCRYPT_RIJNDAEL_256, $key, addpadding($text), MCRYPT_MODE_CBC, $iv); echo '1.' . $crypttext . '<br/>'; $crypttext = base64_encode($crypttext); echo '2.' . $crypttext . '<br/>'; ?> So to point out, the Key and IV look similar on both .NET and PHP, but something seems to be going wrong in the final call when executing mcrypt_encrypt(). The end result, the encrypted string, differs from .NET. Can anybody tell me what i'm doing wrong. As far as i can see everything should be correct. Thank you! EDIT: Additional information on the AESManaged object in .NET Keysize = 256 Mode = CBC Padding = PKCS7

  Read the article

• [PHP] missing keys in $_POST

  - by KPL

  Hello there, I am trying to get some form data from POST method. Here's the code of form - <form action="" method="post" name="form1" id="form1"> <input type="hidden" value="15" name="ad_id"> <table width="100%" cellspacing="0" cellpadding="0" border="0" class="block"> <tbody><tr> <td valign="top">&nbsp;</td> <td align="right">all fields are required</td> </tr> <tr> <td valign="top">&nbsp;</td> <td align="center"></td> </tr> <tr> <td valign="top" width="150"><label for="name">Advertisement Name</label> *</td> <td><input type="text" size="45" value="Banner" id="name" name="name"> e.g Home Banner</td> </tr> <tr> <td valign="top"><label for="placement">Advertisement Placement</label></td> <td><select id="placement" name="placement"> Wide Skyscrapper 160 x 600 </tr> <tr> <td valign="top"><label for="code">Advertisement Code</label></td> <td><textarea rows="5" cols="45" id="code" name="code"></textarea></td> </tr> <tr> <td>Status</td> <td><label> <input type="radio" checked="checked" value="1" name="status"> Active</label> <label> <input type="radio" value="0" name="status"> Inactive</label></td> </tr> <input type="hidden" value="1" name="banner_uploaded" id="banner_uploaded"> <tr> <td>For Country - </td> <td> <select id="country" name="country"> <option>Not posting all the names of country</option> </select> </td> </tr> <tr> <td><label for="Scheduling">Valid From </label></td> <td><input type="text" value="" id="date-from" name="date-from"> Format : dd/mm/yyyy:hh/mm</td> </tr> <tr> <td><label for="Scheduling">Valid Till </label></td> <td><input type="text" value="" id="date-to" name="date-to"> Format : dd/mm/yyyy:hh/mm</td> </tr> <tr> <td>&nbsp;</td> <td align="right"><input type="submit" onclick="return validate_ad_form(add_adv)" value="Update Advertisement" class="button" name="update"></td> </tr> </tbody></table> </form> But I am getting $_POST['code'] empty when I am passing HTML code through it. When I pass plain text, it works fine. When I printed $_POST [i.e. used - print_r($_POST) ], I got the following output - Array ( [ad_id] = 15 [name] = Banner [placement] = ad_468x60 [code] = [status] = 1 [banner_uploaded] = 1 [country] = IN [date-from] = [date-to] = [update] = Update Advertisement ) Please be known, I haven't entered the 'date-from','date-to' fields. I have entered on purpose as StackOverflow don't allow me to post images! People,any help will be highly appreciated.

  Read the article

• What happens when you click a button using WebRat under cucumber

  - by Peter Tillemans

  I am trying to login to a Java web application. The login page has the following html : <html> <head><title>Login Page</title></head> <body onload='document.f.j_username.focus();'> <h3>Login with Username and Password</h3> <form name='f' action='/ui/j_spring_security_check' method='POST'> <table> <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> <tr> <td><input type='checkbox' name='_spring_security_remember_me'/> </td> <td>Remember me on this computer.</td> </tr> <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> </table> </form> </body> </html> I use the following script: Given /^I am logged in as (.*) with password (.*)$/ do | user, password | visit "http://localhost:8080/ui" click_link "Projects" puts "Response Body:" puts response.body assert_contain "User:" fill_in "j_username", :with => user fill_in "j_password", :with => password puts "Response Body:" puts response.body click_button puts "Response Body:" puts response.body end This gives the following in the log file : [INFO] Response Body: [INFO] <html><head><title>Login Page</title></head><body onload='document.f.j_username.focus();'> [INFO] <h3>Login with Username and Password</h3><form name='f' action='/ui/j_spring_security_check' method='POST'> [INFO] <table> [INFO] <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> [INFO] <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> [INFO] <tr><td><input type='checkbox' name='_spring_security_remember_me'/></td><td>Remember me on this computer.</td></tr> [INFO] <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> [INFO] <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> [INFO] </table> [INFO] </form></body></html> [INFO] Response Body: [INFO] <html><head><title>Login Page</title></head><body onload='document.f.j_username.focus();'> [INFO] <h3>Login with Username and Password</h3><form name='f' action='/ui/j_spring_security_check' method='POST'> [INFO] <table> [INFO] <tr><td>User:</td><td><input type='text' name='j_username' value=''></td></tr> [INFO] <tr><td>Password:</td><td><input type='password' name='j_password'/></td></tr> [INFO] <tr><td><input type='checkbox' name='_spring_security_remember_me'/></td><td>Remember me on this computer.</td></tr> [INFO] <tr><td colspan='2'><input name="submit" type="submit"/></td></tr> [INFO] <tr><td colspan='2'><input name="reset" type="reset"/></td></tr> [INFO] </table> [INFO] </form></body></html> [INFO] Response Body: [INFO] [INFO] Given I am logged in as pti with password ptipti # features/step_definitions/authentication_tests.rb:2 So apparently the response.body disappeared after clicking the submit button. I can see from the server log files that the script does not arrive on the Project page. I am new to webrat and quite new to ruby and I am now thoroughly confused. I have no idea why the response.body is gone. I have no idea where I am. I speculated that I had to wait for the page request, but all documentation says that webrat nicely waits till all redirects, pageloads, etc are finished. (At least I think I read that). Besides I find no method to wait for the page in the webrat API. Can someone give some tips on how to proceed with debugging this?

  Read the article

• Windows Impersonation failed

  - by skprocks

  I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

  Read the article

• Page.ClientScript Register a pair of javascript code

  - by blgnklc

  How can I register a javascript code a page? I want to put th javascript function to the aspx.page; I thing it might be like that; string strJS= "<script language = javascript> (function(images, elements) { var fetchImages = function() { if(images.length > 0) { var numImages = 10; while(images.length > 0 && numImages-- > 0) { // assuming your elements are <img> document.getElementById(elements.shift()).src = images.shift(); // if not you could also set the background (or backgroundImage) css property // document.getElementById(elements.shift()).style.background = "url(" + images.shift() + ")"; } setTimeout(fetchImages, 5000); } } // bind to window onload window.onload = fetchImages; // if you're going to use something like jquery then do something like this instead //$(fetchImages); }(['url1', 'url2', 'url3'], ['img1', 'img2', 'img3'])) </script>"; Page.ClientScript.RegisterClientScriptBlock(typeof(ui_SUBMVGInfo), "SmartPenCheck", strJS); The second Questin is; ... ... g(ctrlIDBirthPlaceCode).onchange(); }} </script> <script language = javascript> var url1 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url2 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url3 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url4 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url5 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url6 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url7 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url8 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url9 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url10 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url11 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url12 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; function(images, elements) {var fetchImages = function() {if(images.length > 0) {var numImages = 5; while(images.length > 0 && numImages-- > 0) { document.getElementById(elements.shift()).src = images.shift(); }setTimeout(fetchImages, 5000); }}window.onload = fetchImages; }(['+url1+', '+url2+', '+url3+','+url4+', '+url5+', '+url6+','+url7+', '+url8+', '+url9+','+url10+', '+url11+', '+url12+'], ['ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerSurNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_MaritalStatusImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_SexImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthDateImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceCodeImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_IdNationalityImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_MotherOldSurNameImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_TaxNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_CitizenshipNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_HomePhoneImage'])); </script> <script> var ui_BirthPlaceCode_a='Intertech.Utility'; var ui_BirthPlaceCode_c='Intertech.Utility.Common'; var ui_BirthPlaceCode_sbn=''; ... .. What do you think is it allright or how can I do that? And according to second question above; the use of the code is correct? ref:** PS: To see my purpose please continue reading below; There is a web site page which is coded on asp.net with using c# and ajax is enabled too. I want a very fast loading web page; which is going to happen with the following architecture; 1- First all data is shown by the text boxes (There are 50 text boxes, it is an application form.) 2- When the web Page is requested and loaded, then I want all the photos are shown near the each text boxes 10 by 10 from top of the page till the end of it. (Each photo is between 5 kb - 20 kb; ) I know ImageHandler's the question is how can I put all these idea into real life? some examples and ideas will be great ! thanks This issue has been answered and you may have a look - here Regards Bk

  Read the article

• Help required in adding new methods, properties into existing classes dynamically

  - by Bepenfriends

  Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• PHP: How to automate building a 100 <UL>/<LI> menuitems, while keeping the Menu Structure File Flat / Simply Managable?

  - by Sam

  Above: current "stupid" menu. (entire ul/li menu for javascript menu system) + (some li lines as page-specific submenu) Hi folks! With passion for automation and elegancy, but limited knowledge/knowhow, im stuck with "my hands in my hair" as we Dutch say, for my current menu system works perfectly, but is a pain in the a*s to update! So, i would appreciate it greatly, if you can suggest how to automate this in php: how to let the php generate the html menu code basing on a flat menu input file with TABS indented. OLD SITUATION <ul> <!-- about 100 of these <li>....</li> lines --> <li><a href="carrot.php"><p class="mnu" style="background-position:0 -820px"><? echo __("carrot juice") ?></p></a></li> <!-- lots of data, with only little bit thats really the menu itself--> </ul a javascript file reads a ul/li structure as input to build menu of format in that ul/li, the items with a hyperlink and sprite-bg position represent webpages, (inside LI) while items without hyperlink and sprite-bg are just headers of that menusection, (inside H6) to highlight the current page in the menu, the javascript menumaker uses an id number. this number corresponds to the consequtive li that is a webpage, skips h6 headers correctly. these h6 headers are only there for when importing sections of the same menu as submenu. non-li headers are not shown in menu, nore counted by the javascript menu for their ID. to know which page should be shown, i have to count from ID 0, the li items till finding the current webpage in the li structure and then manually put it in each webpage! BUT: changing an item in li order, means stupidly re-counting their entire li again! each webpage has an icon (= sprite bg-position numer), which is also used in the webpage. INTENDED RESULT I dream of, once setting what the current webpage is (e.g carrot.php) the menu system automatically "finds" and "counts" the li's and returns the id nr (for proper highlight of main menu); generates the entire menu html, and depending on which headings are set for submenu, (e.g. meals, drinks) generates those submenu (entire section below each given header); ginally adds h5 highlight inside the li of that submenu item. For the menu, i wish an easily readable, simple plain txt menu that is indented with tabs, (each tab is one depth for example) and further tabs follow for url and sprite position of icon. MY DREAM MENU-MANAGEMENT FILE |>TAB SEPARATED/INDENTED FLATMENU FILE |MUST BE CALCULATED BY PHP: |>MENUTEXT============URL=============SPRITE=====|ID===TAG================== |>about "#" -520 |00 li |> INFORMATION |—— h6 |> physical state "physical.php" -920 |01 li |> mental health "mental.php" -10 |02 li |> |>apetite "#" -1290 |03 li |> meals "#" -600 |04 li |> COLD MEAL |—— h6 |> egg salade "salad.php" -1040 |05 li |> salmon fish "salmon.php" -540 |06 li |> HOT MEAL |—— h6 |> spare ribs "spareribs.php" -120 |07 li |> di macaroni "macaroni.php" -870 |08 li |> |> drinks "#" -230 |09 li |> JUCY DRINK |—— h6 |> carrot juice "carrot.php" -820 |10 li |> mango hive "mango.php" -270 |11 li DESIRED CHRONOLOGY php outputs the entire ul/li html so the javascript can show the menu: webpage items go inside li tags, and header items go inside h6 tags, e.g. <h6>JUCY DRINK</h6> Each website page has a url filename [eg: salad.php]. Based on this given fact, the php menu generator detects the pagename, gives the IDnr of the position of that page according to the li-item nr and sets variable for javascript to highlight current menu item. the menu items below the specified headers are loaded as submenu in which the current page.php is wrapped inside h5 to highlight current page in submenu: e.g. (<li><h5><a href="carrot.php"><p>..etc..</p></h5></li> Question Which methods / steps / (chronological)ways are there for doing this? I am no good in php programming, but am learning it so please dont write any code without a line of comment why I should use that method etc. Where do I start? If I am unclear in my question, please ask. Thanks. Much appreciated!! Concrete Task List from the provided Comments/Answers, sofar: (RobertB) First, get some PHP code working that can read through a tab-delimited file and put the data into an appropriate data structure. NOW WORKING AT THIS

  Read the article

• How to move the mouse

  - by GroundZero

  I'm making a little bot in C#. At the moment it works pretty well, it can load text from a file and type it for you. But for now, I need to manualy click the textfield to put the focus on it, remaximize my form and then click the Type-button. After the typing, I need to manualy slide the scorebar and press submit. I'd like to know how I can move my mouse with C# and if possible, if possible I'd like to load the mouse positions from a xml-file. I need to move to the textfield, click in it to focus on it, start the type script, move to the slider, hold the mouse down on it while dragging, releasing it on the correct position & clicking on the submitbutton This is what I have for now: To load in the variables, I'm using this script: private void Initialize() { XmlTextReader reader = new XmlTextReader(Application.StartupPath + @"..\..\..\CursorPositions.xml"); while (reader.Read()) { switch (reader.NodeType) { case XmlNodeType.Element: // The node is an element. element = reader.Value; break; case XmlNodeType.Text: //Display the text in each element. switch (element) { case "Textbox-X": textX = int.Parse(reader.Value); break; case "Textbox-Y": textY = int.Parse(reader.Value); break; case "SliderBegin-X": sliderX = int.Parse(reader.Value); break; case "SliderBegin-Y": sliderY = int.Parse(reader.Value); break; case "SubmitButton-X": submitX = int.Parse(reader.Value); break; case "SubmitButton-Y": submitY = int.Parse(reader.Value); break; } break; } } This is the xml-file: <?xml version="1.0" encoding="utf-8" ?> <CursorPositions> <Textbox-X>430</Textbox-X> <Textbox-Y>270</Textbox-Y> <SliderBegin-X>430</SliderBegin-X> <SliderBegin-Y>470</SliderBegin-Y> <SubmitButton-X>860</SubmitButton-X> <SubmitButton-Y>365</SubmitButton-Y> </CursorPositions> To move the mouse I'm using this piece of code: public partial class FrmMain : Form { [System.Runtime.InteropServices.DllImport("user32.dll")] public static extern void mouse_event(int dwFlags, int dx, int dy, int cButtons, int dwExtraInfo); public const int MOUSEEVENTF_LEFTDOWN = 0x0002; public const int MOUSEEVENTF_LEFTUP = 0x0004; public const int MOUSEEVENTF_RIGHTDOWN = 0x0008; public const int MOUSEEVENTF_RIGHTUP = 0x0010; ... private void btnStart_Click(object sender, EventArgs e) { // start button (de)activates loop if (!running) { btnStart.Text = "Stop"; btnStart.Cursor = Cursors.No; running = true; } else { btnStart.Text = "Start"; btnStart.Cursor = Cursors.AppStarting; running = false; } while (running) { // move to textbox & type Cursor.Position = new Point(textX, textY); mouse_event(MOUSEEVENTF_LEFTDOWN, textX, textY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, textX, textY, 0, 0); Type(); // wait 90 seconds till slider available Thread.Sleep(90 * 1000); // move to slider & slide according to score Cursor.Position = new Point(sliderX, sliderY); mouse_event(MOUSEEVENTF_LEFTDOWN, sliderX, sliderY, 0, 0); Cursor.Position = new Point(sliderX + 345 / 10 * score, sliderY); mouse_event(MOUSEEVENTF_LEFTUP, sliderX + 345 / 10 * score, sliderY, 0, 0); // submit Cursor.Position = new Point(submitX, submitY); mouse_event(MOUSEEVENTF_LEFTDOWN, submitX, submitY, 0, 0); mouse_event(MOUSEEVENTF_LEFTUP, submitX, submitY, 0, 0); // wait 10 sec to be sure it's submitted Thread.Sleep(10 * 1000); // refresh page SendKeys.SendWait("{F5}"); // get new text NewText(); // wait 10 sec to refresh and load song Thread.Sleep(10 * 1000); } } } PS: I get the coordinates via my form. I've got 2 labels that show my X & Y coordinates. To capture them outside the form, I press and hold my Left Mouse Button and 'drag' it outside the form to the correct place. This way I get the coordinates of my mouse outside the form

  Read the article

• Hi i am creating a php calendar i have a Problem in that

  - by udaya

  Hi i am creating a calendar i which i filled the year and date like this <<<<< Year <<<<< month by clicking on the arrow marks the year and month can be increased and decreased now i have to fill the dates for the year and month selected I calculated the first day of month and last date of the month The dates must be start filling from the first day Say if the first day is thursday the date 1 must be on thursday and the next days must follow that till the last date These are my functions in my controller " function phpcal() { $month=04; $day=01; $year=2010; echo date("D", mktime(0,0,0,$month,$day,$year)); //here i am calculating the first day of the month echo '<br>lastdate'.date("t", strtotime($year . "-" . $month . "-01"));'' here i am calculating the lasdt date of the month //echo '<br>'.$date_end = $this->lastOfMonth(); $this->load->view('phpcal'); } function firstOfMonth($m1,$y1) { return date("m/d/Y", strtotime($m1.'/01/'.$y1.' 00:00:00')); } function lastOfMonth() { return date("m/d/Y", strtotime('-1 second',strtotime('+1 month',strtotime(date('m').'/01/'.date('Y').' 00:00:00')))); } function phpcalview() { $year = $this->input->post('yearvv'); $data['year'] = $this->adminmodel->selectyear(); $data['date'] = $this->adminmodel->selectmonth(); //print_r($data['date'] ); $this->load->view('phpcal',$data); } This is my view page <table cellpadding="2" cellspacing="0" border="1" bgcolor="#CCFFCC" align="center" class="table_Style_Border"> <? if(isset($date)) { foreach($date as $row) {?> <tr> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate2'];?></td> <td><?= $row['dbDate3'];?></td> <td><?= $row['dbDate4'];?></td> <td><?= $row['dbDate5'];?></td> <td><?= $row['dbDate6'];?></td> <td><?= $row['dbDate7'];?></td> </tr> <tr bgcolor="#FFFFFF"> <td><?= $row['dbDate8'];?></td> <td><?= $row['dbDate9'];?></td> <td><?= $row['dbDate10'];?></td> <td><?= $row['dbDate11'];?></td> <td><?= $row['dbDate12'];?></td> <td><?= $row['dbDate13'];?></td> <td><?= $row['dbDate14'];?></td> </tr> <tr> <td><?= $row['dbDate15'];?></td> <td><?= $row['dbDate16'];?></td> <td><?= $row['dbDate17'];?></td> <td><?= $row['dbDate18'];?></td> <td><?= $row['dbDate19'];?></td> <td><?= $row['dbDate20'];?></td> <td><?= $row['dbDate21'];?></td> </tr> <tr bgcolor="#FFFFFF"> <td><?= $row['dbDate22'];?></td> <td><?= $row['dbDate23'];?></td> <td><?= $row['dbDate24'];?></td> <td><?= $row['dbDate25'];?></td> <td><?= $row['dbDate26'];?></td> <td><?= $row['dbDate27'];?></td> <td><?= $row['dbDate28'];?></td> </tr> <tr> <td><?= $row['dbDate29'];?></td> <td><?= $row['dbDate30'];?></td> <td><?= $row['dbDate31'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> <td><?= $row['dbDate1'];?></td> </tr> </tr> <? }} ?> </table> How can i insert the dates starting from the day i have calculated in the function phpcal

  Read the article

• weird problem..the exact xml work in one host and not working in another...

  - by Ofear

  hi all! i search alot for this but can't find an aswer... I have made a working xml parser using php. till today i host my files on a free web host, and everything works just fine. today i got access to my college server and i host my files there. now for some reason.. i can't make the parser work as i was in the free host... look on those files please: working site: xml file: [http://ofear.onlinewebshop.net/asce/calendar.xml] working parser is this: [http://ofear.onlinewebshop.net/asce/calendar.php] (the lower table is the xml,it's hebrew) not working site: xml file: [http://apps.sce.ac.il/agoda/calendar.xml] not working parser is this: [http://apps.sce.ac.il/agoda/calendar.php] anyone have idea why it's not working.. those are the same files and they should work. maybe it a server problem? calendar.xml: <?xml version="1.0" encoding="UTF-8" ?> <events> <record> <event>??? ???? ????? ???? ???</event> <eventDate>30/12/2010</eventDate> <desc>?????? ?? ????</desc> </record> <record> <event>??? ???? ??????? - 2 : ???? ??? ???? ??????</event> <eventDate>22/12/2010</eventDate> <desc>????? ???? ??????? ?????? ??? ???? ??????? ?????? ????? ?????? ?? ??? ???? ??????? 2 ??????? ????? ???????? 22-23 ?????? 2010. ???? ????? ???? ????? "?????? ????"</desc> </record> <record> <event>????? ???? ?????? ?????? - ?? ????</event> <eventDate>5/12/2010</eventDate> <desc>??? ????? 17:30-20:45</desc> </record> </events> parser: <?php $doc = new DOMDocument(); $doc->load( 'calendar.xml' ); $events = $doc->getElementsByTagName( "record" ); foreach( $events as $record ) { $events = $record->getElementsByTagName( "event" ); $event = $events->item(0)->nodeValue; $eventDates= $record->getElementsByTagName( "eventDate" ); $eventDate= $eventDates->item(0)->nodeValue; $descs = $record->getElementsByTagName( "desc" ); $desc = $descs->item(0)->nodeValue; echo "<tr><td>$event</td><td>$eventDate</td><td>$desc</td></tr>"; } ?> after a little debugging i saw that it's stop here: $doc = new DOMDocument(); and it's not doing anything after that. i think that the line above is the cos

  Read the article

• What is hogging my connection?

  - by SF.

  At times it seems like dozens, if not hundreds of root-owned HTTP connections spring up. This is not much of a problem on LAN or WLAN as each of them seems to transfer very little, but if I use GPRS link, my ping times go into minutes (seriously, 80000ms is not infrequent!) and all connections grind to a halt waiting till these end. This usually lasts some 15 minutes and ends about when I start troubleshooting it for real. I've managed to capture a fragment of Nethogs output NetHogs version 0.8.0 PID USER PROGRAM DEV SENT RECEIVED ? root 37.209.147.180:59854-141.101.114.59:80 0.013 0.000 KB/sec ? root 37.209.147.180:59853-141.101.114.59:80 0.000 0.000 KB/sec ? root 37.209.147.180:52804-173.194.70.95:80 0.000 0.000 KB/sec 1954 bw /home/bw/.dropbox-dist/dropbox ppp0 0.000 0.000 KB/sec ? root 37.209.147.180:59851-141.101.114.59:80 0.000 0.000 KB/sec ? root 37.209.147.180:59850-141.101.114.59:80 0.000 0.000 KB/sec ? root 37.209.147.180:52801-173.194.70.95:80 0.000 0.000 KB/sec 13301 bw /usr/lib/firefox/firefox ppp0 0.000 0.000 KB/sec ? root unknown TCP 0.000 0.000 KB/sec Unfortunately, it doesn't display the owning process of these. Does anyone recognize these addresses or is able to suggest how to troubleshoot it further or disable it? Is it some automatic update or something like that? EDIT: per request; netstat -n, for obvious reason that normal netstat won't ever launch as all DNS requests are hogged just the same. netstat -n Active Internet connections (w/o servers) Proto Recv-Q Send-Q Local Address Foreign Address State tcp 0 1 93.154.166.62:51314 198.252.206.16:80 FIN_WAIT1 tcp 0 1 37.209.147.180:44098 198.252.206.16:80 FIN_WAIT1 tcp 0 1 37.209.147.180:59855 141.101.114.59:80 FIN_WAIT1 tcp 1 0 192.168.43.224:38237 213.189.45.39:443 CLOSE_WAIT tcp 1 0 93.154.146.186:35167 75.101.152.29:80 CLOSE_WAIT tcp 1 0 192.168.43.224:32939 199.15.160.100:80 CLOSE_WAIT tcp 1 0 192.168.43.224:55619 63.245.217.207:443 CLOSE_WAIT tcp 1 0 93.154.146.186:60210 75.101.152.29:443 CLOSE_WAIT tcp 1 0 192.168.43.224:32944 199.15.160.100:80 CLOSE_WAIT tcp 0 1 37.209.147.180:52804 173.194.70.95:80 FIN_WAIT1 tcp 1 0 93.154.146.186:46606 23.21.151.181:80 CLOSE_WAIT tcp 1 0 93.154.146.186:52619 107.22.246.76:80 CLOSE_WAIT tcp 415 0 93.154.146.186:36156 82.112.106.104:80 CLOSE_WAIT tcp 1 0 93.154.146.186:50352 107.22.246.76:443 CLOSE_WAIT tcp 1 0 192.168.43.224:55000 213.189.45.44:443 CLOSE_WAIT tcp 0 1 37.209.147.180:59853 141.101.114.59:80 FIN_WAIT1 tcp 1 0 192.168.43.224:32937 199.15.160.100:80 CLOSE_WAIT tcp 1 0 192.168.43.224:56055 93.184.221.40:80 CLOSE_WAIT tcp 415 0 93.154.146.186:36155 82.112.106.104:80 CLOSE_WAIT tcp 0 1 37.209.147.180:44097 198.252.206.16:80 FIN_WAIT1 tcp 1 0 93.154.146.186:35166 75.101.152.29:80 CLOSE_WAIT tcp 1 0 192.168.43.224:32943 199.15.160.100:80 CLOSE_WAIT tcp 1 0 93.154.146.186:46607 23.21.151.181:80 CLOSE_WAIT tcp 1 0 93.154.146.186:36422 23.21.151.181:443 CLOSE_WAIT tcp 1 0 192.168.43.224:36081 93.184.220.148:80 CLOSE_WAIT tcp 1 0 192.168.43.224:44462 213.189.45.29:443 CLOSE_WAIT tcp 1 0 192.168.43.224:32938 199.15.160.100:80 CLOSE_WAIT tcp 1 0 93.154.146.186:36419 23.21.151.181:443 CLOSE_WAIT tcp 0 497 93.154.166.62:51313 198.252.206.16:80 FIN_WAIT1 tcp 0 1 37.209.147.180:59851 141.101.114.59:80 FIN_WAIT1 tcp 0 1 37.209.147.180:44095 198.252.206.16:80 FIN_WAIT1 tcp 1 0 93.154.146.186:46611 23.21.151.181:80 CLOSE_WAIT tcp 1 0 192.168.43.224:38236 213.189.45.39:443 CLOSE_WAIT tcp 0 171 37.209.147.180:45341 173.194.113.146:443 ESTABLISHED tcp 0 1 37.209.147.180:52801 173.194.70.95:80 FIN_WAIT1 tcp 1 0 192.168.43.224:36080 93.184.220.148:80 CLOSE_WAIT tcp 0 1 37.209.147.180:59856 141.101.114.59:80 FIN_WAIT1 tcp 0 1 37.209.147.180:44096 198.252.206.16:80 FIN_WAIT1 tcp 0 1 93.154.166.62:57471 108.160.162.49:80 FIN_WAIT1 tcp 0 1 37.209.147.180:59854 141.101.114.59:80 FIN_WAIT1 tcp 0 171 37.209.147.180:45340 173.194.113.146:443 ESTABLISHED tcp 0 168 37.209.147.180:45334 173.194.113.146:443 FIN_WAIT1 tcp 1 0 93.154.146.186:46609 23.21.151.181:80 CLOSE_WAIT tcp 0 1248 93.154.166.62:58270 64.251.23.59:443 FIN_WAIT1 tcp 0 1 37.209.147.180:59850 141.101.114.59:80 FIN_WAIT1 tcp 1 0 93.154.146.186:35181 75.101.152.29:80 CLOSE_WAIT tcp 232 0 93.154.172.168:46384 198.252.206.25:80 ESTABLISHED tcp 1 0 93.154.146.186:52618 107.22.246.76:80 CLOSE_WAIT tcp 1 0 93.154.172.168:36298 173.194.69.95:443 CLOSE_WAIT tcp 1 0 93.154.146.186:60209 75.101.152.29:443 CLOSE_WAIT tcp 0 168 37.209.147.180:45335 173.194.113.146:443 FIN_WAIT1 tcp 415 0 93.154.146.186:36157 82.112.106.104:80 CLOSE_WAIT tcp 1 0 192.168.43.224:36082 93.184.220.148:80 CLOSE_WAIT tcp 1 0 192.168.43.224:32942 199.15.160.100:80 CLOSE_WAIT tcp 1 0 93.154.146.186:50350 107.22.246.76:443 CLOSE_WAIT tcp 1 0 192.168.43.224:32941 199.15.160.100:80 CLOSE_WAIT tcp 0 534 37.209.147.180:44089 198.252.206.16:80 FIN_WAIT1 tcp 1 0 93.154.146.186:46608 23.21.151.181:80 CLOSE_WAIT tcp 1 0 93.154.146.186:46612 23.21.151.181:80 CLOSE_WAIT udp 0 0 37.209.147.180:49057 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:51631 193.41.112.18:53 ESTABLISHED udp 0 0 37.209.147.180:34827 193.41.112.18:53 ESTABLISHED udp 0 0 37.209.147.180:35908 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:44106 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:42184 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:54485 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:42216 193.41.112.18:53 ESTABLISHED udp 0 0 37.209.147.180:51961 193.41.112.14:53 ESTABLISHED udp 0 0 37.209.147.180:48412 193.41.112.14:53 ESTABLISHED The interesting lines from ping got lost, but the summary over past few hours is: --- 8.8.8.8 ping statistics --- 107459 packets transmitted, 104376 received, +22 duplicates, 2% packet loss, time 195427362ms rtt min/avg/max/mdev = 24.822/528.132/90538.257/2519.263 ms, pipe 90 EDIT: Per request: Happened again, reboot didn't help but cleaned up all "hanging" processes. Currently netstat shows: bw@pony:/var/log$ netstat -n -t Active Internet connections (w/o servers) Proto Recv-Q Send-Q Local Address Foreign Address State tcp 0 0 93.154.188.68:42767 74.125.239.143:443 TIME_WAIT tcp 0 0 93.154.188.68:50270 173.194.69.189:443 ESTABLISHED tcp 0 0 93.154.188.68:45250 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:53488 173.194.32.198:80 ESTABLISHED tcp 0 0 93.154.188.68:53490 173.194.32.198:80 ESTABLISHED tcp 0 159 93.154.188.68:42741 74.125.239.143:443 LAST_ACK tcp 0 0 93.154.188.68:45808 198.252.206.25:80 ESTABLISHED tcp 0 0 93.154.188.68:52449 173.194.32.199:443 ESTABLISHED tcp 0 0 93.154.188.68:52600 173.194.32.199:443 TIME_WAIT tcp 0 0 93.154.188.68:50300 173.194.69.189:443 TIME_WAIT tcp 0 0 93.154.188.68:45253 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:46252 173.194.32.204:443 ESTABLISHED tcp 0 0 93.154.188.68:45246 190.93.244.58:80 ESTABLISHED tcp 0 0 93.154.188.68:47064 173.194.113.143:443 ESTABLISHED tcp 0 0 93.154.188.68:34484 173.194.69.95:443 ESTABLISHED tcp 0 0 93.154.188.68:45252 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:54290 173.194.32.202:443 ESTABLISHED tcp 0 0 93.154.188.68:47063 173.194.113.143:443 ESTABLISHED tcp 0 0 93.154.188.68:53469 173.194.32.198:80 TIME_WAIT tcp 0 0 93.154.188.68:45242 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:53468 173.194.32.198:80 ESTABLISHED tcp 0 0 93.154.188.68:50299 173.194.69.189:443 TIME_WAIT tcp 0 0 93.154.188.68:42764 74.125.239.143:443 TIME_WAIT tcp 0 0 93.154.188.68:45256 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:58047 108.160.162.105:80 ESTABLISHED tcp 0 0 93.154.188.68:45249 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:50297 173.194.69.189:443 TIME_WAIT tcp 0 0 93.154.188.68:53470 173.194.32.198:80 ESTABLISHED tcp 0 0 93.154.188.68:34100 68.232.35.121:443 ESTABLISHED tcp 0 0 93.154.188.68:42758 74.125.239.143:443 ESTABLISHED tcp 0 0 93.154.188.68:42765 74.125.239.143:443 TIME_WAIT tcp 0 0 93.154.188.68:39000 173.194.69.95:80 TIME_WAIT tcp 0 0 93.154.188.68:50296 173.194.69.189:443 TIME_WAIT tcp 0 0 93.154.188.68:53467 173.194.32.198:80 ESTABLISHED tcp 0 0 93.154.188.68:42766 74.125.239.143:443 TIME_WAIT tcp 0 0 93.154.188.68:45251 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:45248 190.93.244.58:80 TIME_WAIT tcp 0 0 93.154.188.68:45247 190.93.244.58:80 ESTABLISHED tcp 0 159 93.154.188.68:50254 173.194.69.189:443 LAST_ACK tcp 0 0 93.154.188.68:34483 173.194.69.95:443 ESTABLISHED Output of ps: USER PID %CPU %MEM VSZ RSS TTY STAT START TIME COMMAND root 1 0.8 0.0 3628 2092 ? Ss 16:52 0:03 /sbin/init root 2 0.0 0.0 0 0 ? S 16:52 0:00 [kthreadd] root 3 0.1 0.0 0 0 ? S 16:52 0:00 [ksoftirqd/0] root 4 0.1 0.0 0 0 ? S 16:52 0:00 [kworker/0:0] root 6 0.0 0.0 0 0 ? S 16:52 0:00 [migration/0] root 7 0.0 0.0 0 0 ? S 16:52 0:00 [watchdog/0] root 8 0.0 0.0 0 0 ? S 16:52 0:00 [migration/1] root 10 0.1 0.0 0 0 ? S 16:52 0:00 [ksoftirqd/1] root 11 0.0 0.0 0 0 ? S 16:52 0:00 [watchdog/1] root 12 0.0 0.0 0 0 ? S 16:52 0:00 [migration/2] root 14 0.1 0.0 0 0 ? S 16:52 0:00 [ksoftirqd/2] root 15 0.0 0.0 0 0 ? S 16:52 0:00 [watchdog/2] root 16 0.0 0.0 0 0 ? S 16:52 0:00 [migration/3] root 17 0.0 0.0 0 0 ? S 16:52 0:00 [kworker/3:0] root 18 0.1 0.0 0 0 ? S 16:52 0:00 [ksoftirqd/3] root 19 0.0 0.0 0 0 ? S 16:52 0:00 [watchdog/3] root 20 0.0 0.0 0 0 ? S< 16:52 0:00 [cpuset] root 21 0.0 0.0 0 0 ? S< 16:52 0:00 [khelper] root 22 0.0 0.0 0 0 ? S 16:52 0:00 [kdevtmpfs] root 23 0.0 0.0 0 0 ? S< 16:52 0:00 [netns] root 24 0.0 0.0 0 0 ? S 16:52 0:00 [sync_supers] root 25 0.0 0.0 0 0 ? S 16:52 0:00 [bdi-default] root 26 0.0 0.0 0 0 ? S< 16:52 0:00 [kintegrityd] root 27 0.0 0.0 0 0 ? S< 16:52 0:00 [kblockd] root 28 0.0 0.0 0 0 ? S< 16:52 0:00 [ata_sff] root 29 0.0 0.0 0 0 ? S 16:52 0:00 [khubd] root 30 0.0 0.0 0 0 ? S< 16:52 0:00 [md] root 42 0.0 0.0 0 0 ? S 16:52 0:00 [khungtaskd] root 43 0.0 0.0 0 0 ? S 16:52 0:00 [kswapd0] root 44 0.0 0.0 0 0 ? SN 16:52 0:00 [ksmd] root 45 0.0 0.0 0 0 ? SN 16:52 0:00 [khugepaged] root 46 0.0 0.0 0 0 ? S 16:52 0:00 [fsnotify_mark] root 47 0.0 0.0 0 0 ? S 16:52 0:00 [ecryptfs-kthrea] root 48 0.0 0.0 0 0 ? S< 16:52 0:00 [crypto] root 59 0.0 0.0 0 0 ? S< 16:52 0:00 [kthrotld] root 70 0.1 0.0 0 0 ? S 16:52 0:00 [kworker/2:1] root 71 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_0] root 72 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_1] root 73 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_2] root 74 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_3] root 75 0.0 0.0 0 0 ? S 16:52 0:00 [kworker/u:2] root 76 0.0 0.0 0 0 ? S 16:52 0:00 [kworker/u:3] root 79 0.0 0.0 0 0 ? S 16:52 0:00 [kworker/1:1] root 99 0.0 0.0 0 0 ? S< 16:52 0:00 [deferwq] root 100 0.0 0.0 0 0 ? S< 16:52 0:00 [charger_manager] root 101 0.0 0.0 0 0 ? S< 16:52 0:00 [devfreq_wq] root 102 0.1 0.0 0 0 ? S 16:52 0:00 [kworker/2:2] root 106 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_4] root 107 0.0 0.0 0 0 ? S 16:52 0:00 [usb-storage] root 108 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_5] root 109 0.0 0.0 0 0 ? S 16:52 0:00 [usb-storage] root 271 0.1 0.0 0 0 ? S 16:52 0:00 [kworker/1:2] root 316 0.0 0.0 0 0 ? S 16:52 0:00 [jbd2/sda1-8] root 317 0.0 0.0 0 0 ? S< 16:52 0:00 [ext4-dio-unwrit] root 440 0.1 0.0 2820 608 ? S 16:52 0:00 upstart-udev-bridge --daemon root 478 0.0 0.0 3460 1648 ? Ss 16:52 0:00 /sbin/udevd --daemon root 632 0.0 0.0 3348 1336 ? S 16:52 0:00 /sbin/udevd --daemon root 633 0.0 0.0 3348 1204 ? S 16:52 0:00 /sbin/udevd --daemon root 782 0.0 0.0 2816 596 ? S 16:52 0:00 upstart-socket-bridge --daemon root 822 0.0 0.0 6684 2400 ? Ss 16:52 0:00 /usr/sbin/sshd -D 102 834 0.2 0.0 4064 1864 ? Ss 16:52 0:01 dbus-daemon --system --fork root 857 0.0 0.1 7420 3380 ? Ss 16:52 0:00 /usr/sbin/modem-manager root 858 0.0 0.0 4784 1636 ? Ss 16:52 0:00 /usr/sbin/bluetoothd syslog 860 0.0 0.0 31068 1496 ? Sl 16:52 0:00 rsyslogd -c5 root 869 0.1 0.1 24280 5564 ? Ssl 16:52 0:00 NetworkManager avahi 883 0.0 0.0 3448 1488 ? S 16:52 0:00 avahi-daemon: running [pony.local] avahi 884 0.0 0.0 3448 436 ? S 16:52 0:00 avahi-daemon: chroot helper root 885 0.0 0.0 0 0 ? S< 16:52 0:00 [kpsmoused] root 892 0.0 0.1 25696 4140 ? Sl 16:52 0:00 /usr/lib/policykit-1/polkitd --no-debug root 923 0.0 0.0 0 0 ? S 16:52 0:00 [scsi_eh_6] root 959 0.0 0.0 0 0 ? S< 16:52 0:00 [krfcommd] root 970 0.0 0.1 7536 3120 ? Ss 16:52 0:00 /usr/sbin/cupsd -F colord 976 0.1 0.3 55080 10396 ? Sl 16:52 0:00 /usr/lib/i386-linux-gnu/colord/colord root 979 0.0 0.0 4632 872 tty4 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty4 root 987 0.0 0.0 4632 884 tty5 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty5 root 994 0.0 0.0 4632 884 tty2 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty2 root 995 0.0 0.0 4632 868 tty3 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty3 root 998 0.0 0.0 4632 876 tty6 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty6 root 1022 0.0 0.0 2176 680 ? Ss 16:52 0:00 acpid -c /etc/acpi/events -s /var/run/acpid.socket root 1029 0.0 0.0 3632 664 ? Ss 16:52 0:00 /usr/sbin/irqbalance daemon 1030 0.0 0.0 2476 120 ? Ss 16:52 0:00 atd root 1031 0.0 0.0 2620 880 ? Ss 16:52 0:00 cron root 1061 0.1 0.0 0 0 ? S 16:52 0:00 [kworker/3:2] root 1064 0.0 1.0 34116 31072 ? SLsl 16:52 0:00 lightdm root 1076 13.4 1.2 118688 37920 tty7 Ssl+ 16:52 0:55 /usr/bin/X :0 -core -auth /var/run/lightdm/root/:0 -nolisten tcp vt7 -novtswit root 1085 0.0 0.0 0 0 ? S 16:52 0:00 [rts_pstor] root 1087 0.0 0.0 0 0 ? S 16:52 0:00 [rtsx-polling] root 1095 0.0 0.0 0 0 ? S< 16:52 0:00 [cfg80211] root 1127 0.0 0.0 0 0 ? S 16:52 0:00 [flush-8:0] root 1130 0.0 0.0 6136 1824 ? Ss 16:52 0:00 /sbin/wpa_supplicant -B -P /run/sendsigs.omit.d/wpasupplicant.pid -u -s -O /va root 1137 0.0 0.1 24604 3164 ? Sl 16:52 0:00 /usr/lib/accountsservice/accounts-daemon root 1140 0.0 0.0 0 0 ? S< 16:52 0:00 [hd-audio0] root 1188 0.0 0.1 34308 3420 ? Sl 16:52 0:00 /usr/sbin/console-kit-daemon --no-daemon root 1425 0.0 0.0 4632 872 tty1 Ss+ 16:52 0:00 /sbin/getty -8 38400 tty1 root 1443 0.1 0.1 29460 4664 ? Sl 16:52 0:00 /usr/lib/upower/upowerd root 1579 0.0 0.1 16540 3272 ? Sl 16:53 0:00 lightdm --session-child 12 19 bw 1623 0.0 0.0 2232 644 ? Ss 16:53 0:00 /bin/sh /usr/bin/startkde bw 1672 0.0 0.0 4092 204 ? Ss 16:53 0:00 /usr/bin/ssh-agent /usr/bin/gpg-agent --daemon --sh --write-env-file=/home/bw/ bw 1673 0.0 0.0 5492 384 ? Ss 16:53 0:00 /usr/bin/gpg-agent --daemon --sh --write-env-file=/home/bw/.gnupg/gpg-agent-in bw 1676 0.0 0.0 3848 792 ? S 16:53 0:00 /usr/bin/dbus-launch --exit-with-session /usr/bin/startkde bw 1677 0.5 0.0 5384 2180 ? Ss 16:53 0:02 //bin/dbus-daemon --fork --print-pid 5 --print-address 7 --session root 1704 0.3 0.1 25348 3600 ? Sl 16:53 0:01 /usr/lib/udisks/udisks-daemon root 1705 0.0 0.0 6620 728 ? S 16:53 0:00 udisks-daemon: not polling any devices bw 1736 0.0 0.0 2008 64 ? S 16:53 0:00 /usr/lib/kde4/libexec/start_kdeinit +kcminit_startup bw 1737 0.0 0.5 115200 15588 ? Ss 16:53 0:00 kdeinit4: kdeinit4 Running... bw 1738 0.1 0.2 116756 8728 ? S 16:53 0:00 kdeinit4: klauncher [kdeinit] --fd=9 bw 1740 0.6 1.0 340524 31264 ? Sl 16:53 0:02 kdeinit4: kded4 [kdeinit] bw 1742 0.0 0.0 8944 2144 ? S 16:53 0:00 /usr/lib/i386-linux-gnu/gconf/gconfd-2 bw 1746 0.2 0.4 92028 14688 ? S 16:53 0:00 /usr/bin/kglobalaccel bw 1748 0.0 0.4 90804 13500 ? S 16:53 0:00 /usr/bin/kwalletd bw 1752 0.1 0.5 103764 15152 ? S 16:53 0:00 /usr/bin/kactivitymanagerd bw 1758 0.0 0.0 2144 280 ? S 16:53 0:00 kwrapper4 ksmserver bw 1759 0.1 0.5 150016 16088 ? Sl 16:53 0:00 kdeinit4: ksmserver [kdeinit] bw 1763 2.2 1.0 178492 32100 ? Sl 16:53 0:08 kwin bw 1772 0.2 0.5 106292 16340 ? Sl 16:53 0:00 /usr/bin/knotify4 bw 1777 0.9 1.1 246120 32912 ? Sl 16:53 0:03 /usr/bin/krunner bw 1778 6.3 2.7 389884 80216 ? Sl 16:53 0:23 /usr/bin/plasma-desktop bw 1785 0.0 0.0 2844 1208 ? S 16:53 0:00 ksysguardd bw 1789 0.1 0.4 82036 14176 ? S 16:53 0:00 /usr/bin/kuiserver bw 1805 0.3 0.1 61560 5612 ? Sl 16:53 0:01 /usr/bin/akonadi_control root 1806 0.0 0.0 0 0 ? S 16:53 0:00 [kworker/0:2] bw 1808 0.1 0.2 211852 8460 ? Sl 16:53 0:00 akonadiserver bw 1810 0.4 0.8 244116 25360 ? Sl 16:53 0:01 /usr/sbin/mysqld --defaults-file=/home/bw/.local/share/akonadi/mysql.conf --da bw 1874 0.0 0.0 35284 2956 ? Sl 16:53 0:00 /usr/bin/xsettings-kde bw 1876 0.0 0.3 68776 9488 ? Sl 16:53 0:00 /usr/bin/nepomukserver bw 1884 0.4 0.9 173876 29240 ? SNl 16:53 0:01 /usr/bin/nepomukservicestub nepomukstorage bw 1902 6.1 2.1 451512 63924 ? Sl 16:53 0:21 /home/bw/.dropbox-dist/dropbox bw 1906 3.8 1.0 142368 32376 ? Rl 16:53 0:13 /usr/bin/yakuake bw 1933 0.0 0.1 54636 4680 ? Sl 16:53 0:00 /usr/bin/zeitgeist-datahub bw 1943 0.5 1.5 164836 46836 ? Sl 16:53 0:01 python /usr/bin/printer-applet bw 1945 0.1 0.1 99636 5048 ? S<l 16:53 0:00 /usr/bin/pulseaudio --start --log-target=syslog rtkit 1947 0.0 0.0 21336 1248 ? SNl 16:53 0:00 /usr/lib/rtkit/rtkit-daemon bw 1958 0.0 0.1 44204 3792 ? Sl 16:53 0:00 /usr/bin/zeitgeist-daemon bw 1972 0.0 0.0 27008 2684 ? Sl 16:53 0:00 /usr/lib/gvfs/gvfsd bw 1974 0.1 0.5 90480 16660 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_akonotes_resource akonadi_akonotes_res bw 1984 0.1 0.5 90472 16636 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_akonotes_resource akonadi_akonotes_res bw 1985 0.3 0.9 148800 28304 ? S 16:53 0:01 /usr/bin/akonadi_archivemail_agent --identifier akonadi_archivemail_agent bw 1992 0.1 0.5 90020 16148 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_contacts_resource akonadi_contacts_res bw 1993 0.1 0.5 90132 16452 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_contacts_resource akonadi_contacts_res bw 1994 0.1 0.5 90564 16332 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_ical_resource akonadi_ical_resource_0 bw 1995 0.1 0.5 90676 16732 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_ical_resource akonadi_ical_resource_1 bw 1996 0.1 0.5 90468 16800 ? Sl 16:53 0:00 /usr/bin/akonadi_agent_launcher akonadi_maildir_resource akonadi_maildir_resou bw 1999 0.2 0.6 99324 19276 ? S 16:53 0:00 /usr/bin/akonadi_maildispatcher_agent --identifier akonadi_maildispatcher_agen bw 2006 0.3 0.9 148808 28332 ? S 16:53 0:01 /usr/bin/akonadi_mailfilter_agent --identifier akonadi_mailfilter_agent bw 2017 0.0 0.1 50256 4716 ? Sl 16:53 0:00 /usr/lib/zeitgeist/zeitgeist-fts bw 2024 0.2 0.6 103632 18376 ? Sl 16:53 0:00 /usr/bin/akonadi_nepomuk_feeder --identifier akonadi_nepomuk_feeder bw 2043 0.0 0.0 4484 280 ? S 16:53 0:00 /bin/cat bw 2101 0.2 0.7 113600 22396 ? Sl 16:53 0:00 /usr/lib/kde4/libexec/polkit-kde-authentication-agent-1 bw 2105 0.2 0.7 114196 22072 ? Sl 16:53 0:00 /usr/bin/nepomukcontroller bw 2156 0.3 1.0 333188 31244 ? Sl 16:54 0:01 /usr/bin/kmix bw 2167 0.0 0.0 6548 2724 pts/2 Ss 16:54 0:00 /bin/bash bw 2177 0.2 0.7 113496 22960 ? Sl 16:54 0:00 /usr/bin/klipper bw 2394 3.5 1.2 52932 35596 ? SNl 16:54 0:11 /usr/bin/virtuoso-t +foreground +configfile /tmp/virtuoso_hX1884.ini +wait root 2460 0.0 0.0 6184 1876 pts/2 S 16:54 0:00 sudo -s root 2500 0.0 0.0 6528 2700 pts/2 S 16:54 0:00 /bin/bash root 2599 0.0 0.0 5444 1280 pts/2 S+ 16:54 0:00 /bin/bash bin/aero root 2606 0.1 0.0 9836 2500 pts/2 S+ 16:54 0:00 wvdial aero2 root 2619 0.0 0.0 3504 1280 pts/2 S 16:54 0:00 /usr/sbin/pppd 57600 modem crtscts defaultroute usehostname -detach user aero bw 2653 0.0 0.0 6600 2880 pts/3 Ss 16:54 0:00 /bin/bash bw 2676 0.4 0.8 130296 24016 ? SNl 16:54 0:01 /usr/bin/nepomukservicestub nepomukfilewatch bw 2679 0.1 0.7 101636 22252 ? SNl 16:54 0:00 /usr/bin/nepomukservicestub nepomukqueryservice bw 2681 0.2 0.8 109836 24280 ? SNl 16:54 0:00 /usr/bin/nepomukservicestub nepomukbackupsync bw 3833 46.0 9.7 829272 288012 ? Rl 16:55 1:46 /usr/lib/firefox/firefox bw 3903 0.0 0.0 35128 2804 ? Sl 16:55 0:00 /usr/lib/at-spi2-core/at-spi-bus-launcher bw 4708 0.1 0.0 6564 2736 pts/4 Ss 16:56 0:00 /bin/bash root 5210 0.0 0.0 0 0 ? S 16:57 0:00 [kworker/u:0] root 6140 0.2 0.0 0 0 ? S 16:58 0:00 [kworker/0:1] root 6371 0.5 0.0 6184 1868 pts/4 S+ 16:59 0:00 sudo nethogs ppp0 root 6411 17.7 0.2 8616 6144 pts/4 S+ 16:59 0:05 nethogs ppp0 bw 6787 0.0 0.0 5464 1220 pts/3 R+ 16:59 0:00 ps auxw

  Read the article

• Problem in creation MDB Queue connection at Jboss StartUp

  - by Amit Ruwali

  I am not able to create a Queue connection in JBOSS4.2.3GA Version & Java1.5, as I am using MDB as per the below details. I am putting this MDB in a jar file(named utsJar.jar) and copied it in deploy folder of JBOSS, In the test env. this MDB works well but in another env. [ env settings and jboss/java ver is same ] it is throwing error at jboss start up [attached below ]. I have searched for this error but couldn't find any solution till now; was there any issue of port confict or something related with configurations ? UTSMessageListner.java @MessageDriven(activationConfig = { @ActivationConfigProperty(propertyName="destinationType", propertyValue="javax.jms.Queue"), @ActivationConfigProperty(propertyName="destination", propertyValue="queue/UTSQueue") }) @TransactionAttribute(TransactionAttributeType.NOT_SUPPORTED) public class UTSMessageListner implements MessageListener { public void onMessage(Message msg) { ObjectMessage objmsg = (ObjectMessage) msg; try { UTSListVO utsMessageListVO = (UTSListVO) objmsg.getObject(); if(utsMessageListVO.getUtsMessageList()!=null) { UtsWebServiceLogger.logMessage("UTSMessageListner:onMessage: SIZE Of UTSMessage List =[" +utsMessageListVO.getUtsMessageList().size() + "]"); UTSDataLayerImpl.getInstance().insertUTSMessage(utsMessageListVO); } else { UtsWebServiceLogger.logMessage("UTSMessageListner:onMessage: Message List is NULL"); } } catch (Exception ex) { UtsWebServiceLogger.logMessage("UTSMessageListner:onMessage: Error Receiving Message"+ExceptionUtility.getStackTrace(ex)); } } } [ I have also attached whole server.log as an attach] /// ///////////////////////////////// Error Trace is Below while starting the server /////////////////////////// 2010-03-12 07:05:40,061 WARN [org.jboss.ejb3.mdb.MessagingContainer] Could not find the queue destination-jndi-name=queue/UTSQueue 2010-03-12 07:05:40,061 WARN [org.jboss.ejb3.mdb.MessagingContainer] destination not found: queue/UTSQueue reason: javax.naming.NameNotFoundException: queue not bound 2010-03-12 07:05:40,061 WARN [org.jboss.ejb3.mdb.MessagingContainer] creating a new temporary destination: queue/UTSQueue 2010-03-12 07:05:40,071 WARN [org.jboss.system.ServiceController] Problem starting service jboss.j2ee:ear=uts.ear,jar=utsJar.jar,name=UTSMessageListner,service=EJB3 java.lang.NullPointerException at org.jboss.mq.server.jmx.DestinationManager.createDestination(DestinationManager.java:336) at org.jboss.mq.server.jmx.DestinationManager.createQueue(DestinationManager.java:293) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.ejb3.JmxClientKernelAbstraction.invoke(JmxClientKernelAbstraction.java:44) at org.jboss.ejb3.jms.DestinationManagerJMSDestinationFactory.createDestination(DestinationManagerJMSDestinationFactory.java:75) at org.jboss.ejb3.mdb.MessagingContainer.createTemporaryDestination(MessagingContainer.java:573) at org.jboss.ejb3.mdb.MessagingContainer.createDestination(MessagingContainer.java:512) at org.jboss.ejb3.mdb.MessagingContainer.innerCreateQueue(MessagingContainer.java:438) at org.jboss.ejb3.mdb.MessagingContainer.jmsCreate(MessagingContainer.java:400) at org.jboss.ejb3.mdb.MessagingContainer.innerStart(MessagingContainer.java:166) at org.jboss.ejb3.mdb.MessagingContainer.start(MessagingContainer.java:152) at org.jboss.ejb3.mdb.MDB.start(MDB.java:126) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.ejb3.ServiceDelegateWrapper.startService(ServiceDelegateWrapper.java:103) at org.jboss.system.ServiceMBeanSupport.jbossInternalStart(ServiceMBeanSupport.java:289) at org.jboss.system.ServiceMBeanSupport.jbossInternalLifecycle(ServiceMBeanSupport.java:245) at sun.reflect.GeneratedMethodAccessor4.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.system.ServiceController$ServiceProxy.invoke(ServiceController.java:978) at $Proxy0.start(Unknown Source) at org.jboss.system.ServiceController.start(ServiceController.java:417) at sun.reflect.GeneratedMethodAccessor10.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy53.start(Unknown Source) at org.jboss.ejb3.JmxKernelAbstraction.install(JmxKernelAbstraction.java:120) at org.jboss.ejb3.Ejb3Deployment.registerEJBContainer(Ejb3Deployment.java:301) at org.jboss.ejb3.Ejb3Deployment.start(Ejb3Deployment.java:362) at org.jboss.ejb3.Ejb3Module.startService(Ejb3Module.java:91) at org.jboss.system.ServiceMBeanSupport.jbossInternalStart(ServiceMBeanSupport.java:289) at org.jboss.system.ServiceMBeanSupport.jbossInternalLifecycle(ServiceMBeanSupport.java:245) at sun.reflect.GeneratedMethodAccessor4.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.system.ServiceController$ServiceProxy.invoke(ServiceController.java:978) at $Proxy0.start(Unknown Source) at org.jboss.system.ServiceController.start(ServiceController.java:417) at sun.reflect.GeneratedMethodAccessor10.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy33.start(Unknown Source) at org.jboss.ejb3.EJB3Deployer.start(EJB3Deployer.java:512) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.interceptor.AbstractInterceptor.invoke(AbstractInterceptor.java:133) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.interceptor.ModelMBeanOperationInterceptor.invoke(ModelMBeanOperationInterceptor.java:142) at org.jboss.mx.interceptor.DynamicInterceptor.invoke(DynamicInterceptor.java:97) at org.jboss.system.InterceptorServiceMBeanSupport.invokeNext(InterceptorServiceMBeanSupport.java:238) at org.jboss.wsf.container.jboss42.DeployerInterceptor.start(DeployerInterceptor.java:87) at org.jboss.deployment.SubDeployerInterceptorSupport$XMBeanInterceptor.start(SubDeployerInterceptorSupport.java:188) at org.jboss.deployment.SubDeployerInterceptor.invoke(SubDeployerInterceptor.java:95) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy34.start(Unknown Source) at org.jboss.deployment.MainDeployer.start(MainDeployer.java:1025) at org.jboss.deployment.MainDeployer.start(MainDeployer.java:1015) at org.jboss.deployment.MainDeployer.deploy(MainDeployer.java:819) at org.jboss.deployment.MainDeployer.deploy(MainDeployer.java:782) at sun.reflect.GeneratedMethodAccessor20.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.interceptor.AbstractInterceptor.invoke(AbstractInterceptor.java:133) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.interceptor.ModelMBeanOperationInterceptor.invoke(ModelMBeanOperationInterceptor.java:142) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy9.deploy(Unknown Source) at org.jboss.deployment.scanner.URLDeploymentScanner.deploy(URLDeploymentScanner.java:421) at org.jboss.deployment.scanner.URLDeploymentScanner.scan(URLDeploymentScanner.java:634) at org.jboss.deployment.scanner.AbstractDeploymentScanner$ScannerThread.doScan(AbstractDeploymentScanner.java:263) at org.jboss.deployment.scanner.AbstractDeploymentScanner.startService(AbstractDeploymentScanner.java:336) at org.jboss.system.ServiceMBeanSupport.jbossInternalStart(ServiceMBeanSupport.java:289) at org.jboss.system.ServiceMBeanSupport.jbossInternalLifecycle(ServiceMBeanSupport.java:245) at sun.reflect.GeneratedMethodAccessor4.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.system.ServiceController$ServiceProxy.invoke(ServiceController.java:978) at $Proxy0.start(Unknown Source) at org.jboss.system.ServiceController.start(ServiceController.java:417) at sun.reflect.GeneratedMethodAccessor10.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.server.Invocation.invoke(Invocation.java:86) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy4.start(Unknown Source) at org.jboss.deployment.SARDeployer.start(SARDeployer.java:304) at org.jboss.deployment.MainDeployer.start(MainDeployer.java:1025) at org.jboss.deployment.MainDeployer.deploy(MainDeployer.java:819) at org.jboss.deployment.MainDeployer.deploy(MainDeployer.java:782) at org.jboss.deployment.MainDeployer.deploy(MainDeployer.java:766) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:155) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:94) at org.jboss.mx.interceptor.AbstractInterceptor.invoke(AbstractInterceptor.java:133) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.interceptor.ModelMBeanOperationInterceptor.invoke(ModelMBeanOperationInterceptor.java:142) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:659) at org.jboss.mx.util.MBeanProxyExt.invoke(MBeanProxyExt.java:210) at $Proxy5.deploy(Unknown Source) at org.jboss.system.server.ServerImpl.doStart(ServerImpl.java:482) at org.jboss.system.server.ServerImpl.start(ServerImpl.java:362) at org.jboss.Main.boot(Main.java:200) at org.jboss.Main$1.run(Main.java:508) at java.lang.Thread.run(Thread.java:595)

  Read the article

• Scroll Viewer not visible in wpf DataGrid

  - by cre-johnny07

  I have a datagrid in a grid but the scrollviewer is not visibile even though I made it auto. Below in my code. I can't figure out where's the problem. <Grid Grid.Row="0" Grid.Column="0"> <Grid.RowDefinitions> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto" ></RowDefinition> <RowDefinition Height="Auto"></RowDefinition> <RowDefinition Height="Auto"></RowDefinition> </Grid.RowDefinitions> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto"></ColumnDefinition> <ColumnDefinition Width="Auto"></ColumnDefinition> </Grid.ColumnDefinitions> <TextBlock Text="Doctor Name" Grid.Row="0" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Doctor Address" Grid.Row="1" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Entry Note" Grid.Row="2" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Join Date" Grid.Row="3" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Default Discount" Grid.Row="4" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Discount Valid Till" Grid.Row="5" Grid.Column="0" Margin="5,5,0,0"/> <TextBlock Text="Employee Name" Grid.Row="6" Grid.Column="0" Margin="5,5,0,0"/> <Grid Grid.Row="7" Grid.Column="0" Grid.ColumnSpan="2"> <Grid.ColumnDefinitions> <ColumnDefinition></ColumnDefinition> <ColumnDefinition></ColumnDefinition> <ColumnDefinition></ColumnDefinition> </Grid.ColumnDefinitions> <TextBlock Text="Report Type" Grid.Row="0" Grid.Column="0" Margin="5,5,0,0"/> <ComboBox Grid.Row="0" Grid.Column="1" Name="cmbReportType" Text="{Binding CurrentEntity.ReportType}"/> <Button Grid.Row="0" Grid.Column="2" Name="btnAddDetail" Content="Add Details" Command="{Binding AddDetailsCommand}"/> </Grid> <TextBox Grid.Row="0" Grid.Column="1" Margin="5,5,0,0" Width="190" Name="txtDocName" Text="{Binding CurrentEntity.RefName}"/> <TextBox Grid.Row="1" Grid.Column="1" Margin="5,5,0,0" Width="190" Height="75" Name="txtDocAddress" Text="{Binding CurrentEntity.RefAddress}"/> <TextBox Grid.Row="2" Grid.Column="1" Margin="5,5,0,0" Width="190" Height="100" Name="txtEntryNote" Text="{Binding CurrentEntity.EntryNotes}"/> <Custom:DatePicker Grid.Row="3" Grid.Column="1" Margin="5,3,0,0" Width="125" Name="dtpJoinDate" Height="24" HorizontalAlignment="Left" VerticalAlignment="Top" SelectedDate="{Binding CurrentEntity.DateStarted}" SelectedDateFormat="Short"/> <TextBox Grid.Row="4" Grid.Column="1" Height="25" Width="75" Name="txtDefaultDiscount" HorizontalAlignment="Left" Margin="5,0,0,0" VerticalAlignment="Top" Text="{Binding CurrentEntity.DefaultDiscount}"/> <Custom:DatePicker Grid.Row="5" Grid.Column="1" Margin="5,3,0,0" Width="125" Name="dtpValidTill" Height="24" HorizontalAlignment="Left" VerticalAlignment="Top" SelectedDate="{Binding CurrentEntity.DefaultDiscountValidTill}" SelectedDateFormat="Short"/> <ComboBox Grid.Row="6" Grid.Column="1" Margin="5,3,0,0" Width="190" Height="30" Name="cmbEmployeeName" ItemsSource="{Binding Employees}" DisplayMemberPath="FullName" SelectedIndex="{Binding SelecteIndex}"> </ComboBox> <Custom:DataGrid Grid.Row="8" Grid.Column="0" Grid.ColumnSpan="2" ItemsSource="{Binding XYZ}" AutoGenerateColumns="False" Name="grdTestDept"> <Custom:DataGrid.Columns> <Custom:DataGridTextColumn Binding="{Binding dep_id}" Width="40" Header="ID"/> <Custom:DataGridTextColumn Binding="{Binding dep_name}" Width="125" Header="Name"/> <Custom:DataGridTextColumn Binding="{Binding default_data}" Width="100" Header="Default Data"/> </Custom:DataGrid.Columns> </Custom:DataGrid> </Grid> <Grid Grid.Row="0" Grid.Column="1" Grid.RowSpan="9"> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto" MinWidth="43"></ColumnDefinition> <ColumnDefinition Width="Auto" MinWidth="150"></ColumnDefinition> <ColumnDefinition Width="Auto" MinWidth="50"></ColumnDefinition> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition Height="34*" ></RowDefinition> <RowDefinition Height="337.88*"></RowDefinition> </Grid.RowDefinitions> <TextBlock Text="Name: " Grid.Row="0" Grid.Column="0" Margin="5,4,0,0" /> <cc:ValueEnabledCombo Grid.Column="1" x:Name="cmbfilEmployeeName" Width="150" Height="30" Margin="5,4,0,0" VerticalAlignment="Top" SelectedIndex="0" ItemsSource="{Binding Employees}" DisplayMemberPath="FullName" SelectedValuePath="EmployeeId" cc:ValueEnabledCombo.SelectionChanged="{Binding SelectionChangedCommand}"> </cc:ValueEnabledCombo> <Button Grid.Column="2" Name="btnReport" Width="50" Content="Report" Height="28" Margin="5,4,0,0" Command="{Binding ReportCommand}" VerticalAlignment="Top" /> <Grid Grid.Row="1" Grid.Column="0" Grid.ColumnSpan="3"> <Custom:DataGrid ItemsSource="{Binding DoctorList}" AutoGenerateColumns="False" Name="grdDoctor" ScrollViewer.HorizontalScrollBarVisibility="Auto" ScrollViewer.VerticalScrollBarVisibility="Auto"> <Custom:DataGrid.Columns> <Custom:DataGridTextColumn Binding="{Binding RefName}" Width="Auto" Header="Doctor Name"/> <Custom:DataGridTextColumn Binding="{Binding EmployeeFullName}" Width="Auto" Header="Employee Name"/> </Custom:DataGrid.Columns> </Custom:DataGrid> </Grid> </Grid> </Grid>

  Read the article

• apache eats up too much ram per child

  - by mrc4r7m4n

  Hello to everyone. I've got fallowing problem: Apache eat to many ram per child. The fallowing comments shows: cat /etc/redhat-release -- Fedora release 8 (Werewolf) free -m: total used free shared buffers cached Mem: 3566 3136 429 0 339 1907 -/+ buffers/cache: 889 2676 Swap: 4322 0 4322 I know that you will say that there is nothing to worry about because swap is not use, but i think it's not use for now. 3.httpd -v: Server version: Apache/2.2.14 (Unix) 4.httpd -l: Compiled in modules: core.c mod_authn_file.c mod_authn_default.c mod_authz_host.c mod_authz_groupfile.c mod_authz_user.c mod_authz_default.c mod_auth_basic.c mod_include.c mod_filter.c mod_log_config.c mod_env.c mod_setenvif.c mod_version.c mod_ssl.c prefork.c http_core.c mod_mime.c mod_status.c mod_autoindex.c mod_asis.c mod_cgi.c mod_negotiation.c mod_dir.c mod_actions.c mod_userdir.c mod_alias.c mod_rewrite.c mod_so.c 5.List of loaded dynamic modules: LoadModule authz_host_module modules/mod_authz_host.so LoadModule include_module modules/mod_include.so LoadModule log_config_module modules/mod_log_config.so LoadModule setenvif_module modules/mod_setenvif.so LoadModule mime_module modules/mod_mime.so LoadModule autoindex_module modules/mod_autoindex.so LoadModule vhost_alias_module modules/mod_vhost_alias.so LoadModule negotiation_module modules/mod_negotiation.so LoadModule dir_module modules/mod_dir.so LoadModule alias_module modules/mod_alias.so LoadModule rewrite_module modules/mod_rewrite.so LoadModule proxy_module modules/mod_proxy.so LoadModule cgi_module modules/mod_cgi.so 6.My prefrok directive <IfModule prefork.c> StartServers 8 MinSpareServers 5 MaxSpareServers 25 ServerLimit 80 MaxClients 80 MaxRequestsPerChild 4000 </IfModule> KeepAliveTimeout 6 MaxKeepAliveRequests 100 KeepAlive On 7.top -u apache: ctrl+ M top - 09:19:42 up 2 days, 19 min, 2 users, load average: 0.85, 0.87, 0.80 Tasks: 113 total, 1 running, 112 sleeping, 0 stopped, 0 zombie Cpu(s): 7.3%us, 15.7%sy, 0.0%ni, 75.7%id, 0.0%wa, 0.7%hi, 0.7%si, 0.0%st Mem: 3652120k total, 3149964k used, 502156k free, 348048k buffers Swap: 4425896k total, 0k used, 4425896k free, 1944952k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 16956 apache 20 0 700m 135m 100m S 0.0 3.8 2:16.78 httpd 16953 apache 20 0 565m 130m 96m S 0.0 3.7 1:57.26 httpd 16957 apache 20 0 587m 129m 102m S 0.0 3.6 1:47.41 httpd 16955 apache 20 0 567m 126m 93m S 0.0 3.6 1:43.60 httpd 17494 apache 20 0 626m 125m 96m S 0.0 3.5 1:58.77 httpd 17515 apache 20 0 540m 120m 88m S 0.0 3.4 1:45.57 httpd 17516 apache 20 0 573m 120m 88m S 0.0 3.4 1:50.51 httpd 16954 apache 20 0 551m 120m 88m S 0.0 3.4 1:52.47 httpd 17493 apache 20 0 586m 120m 94m S 0.0 3.4 1:51.02 httpd 17279 apache 20 0 568m 117m 87m S 16.0 3.3 1:51.87 httpd 17302 apache 20 0 560m 116m 90m S 0.3 3.3 1:59.06 httpd 17495 apache 20 0 551m 116m 89m S 0.0 3.3 1:47.51 httpd 17277 apache 20 0 476m 114m 81m S 0.0 3.2 1:37.14 httpd 30097 apache 20 0 536m 113m 83m S 0.0 3.2 1:47.38 httpd 30112 apache 20 0 530m 112m 81m S 0.0 3.2 1:40.15 httpd 17513 apache 20 0 516m 112m 85m S 0.0 3.1 1:43.92 httpd 16958 apache 20 0 554m 111m 82m S 0.0 3.1 1:44.18 httpd 1617 apache 20 0 487m 111m 85m S 0.0 3.1 1:31.67 httpd 16952 apache 20 0 461m 107m 75m S 0.0 3.0 1:13.71 httpd 16951 apache 20 0 462m 103m 76m S 0.0 2.9 1:28.05 httpd 17278 apache 20 0 497m 103m 76m S 0.0 2.9 1:31.25 httpd 17403 apache 20 0 537m 102m 79m S 0.0 2.9 1:52.24 httpd 25081 apache 20 0 412m 101m 70m S 0.0 2.8 1:01.74 httpd I guess thats all information needed to help me solve this problem. I think the virt memory is to big, the same res. The consumption of ram is increasing all the time. Maybe it's memory leak because i see there is so many static modules compiled. Could someone help me with this issue? Thank you in advance. 8.ldd /usr/sbin/httpd linux-gate.so.1 => (0x0012d000) libm.so.6 => /lib/libm.so.6 (0x0012e000) libpcre.so.0 => /lib/libpcre.so.0 (0x00157000) libselinux.so.1 => /lib/libselinux.so.1 (0x0017f000) libaprutil-1.so.0 => /usr/lib/libaprutil-1.so.0 (0x0019a000) libcrypt.so.1 => /lib/libcrypt.so.1 (0x001b4000) libldap-2.3.so.0 => /usr/lib/libldap-2.3.so.0 (0x001e6000) liblber-2.3.so.0 => /usr/lib/liblber-2.3.so.0 (0x00220000) libdb-4.6.so => /lib/libdb-4.6.so (0x0022e000) libexpat.so.1 => /lib/libexpat.so.1 (0x00370000) libapr-1.so.0 => /usr/lib/libapr-1.so.0 (0x00391000) libpthread.so.0 => /lib/libpthread.so.0 (0x003b9000) libdl.so.2 => /lib/libdl.so.2 (0x003d2000) libc.so.6 => /lib/libc.so.6 (0x003d7000) /lib/ld-linux.so.2 (0x00110000) libuuid.so.1 => /lib/libuuid.so.1 (0x00530000) libresolv.so.2 => /lib/libresolv.so.2 (0x00534000) libsasl2.so.2 => /usr/lib/libsasl2.so.2 (0x00548000) libssl.so.6 => /lib/libssl.so.6 (0x00561000) libcrypto.so.6 => /lib/libcrypto.so.6 (0x005a6000) libgssapi_krb5.so.2 => /usr/lib/libgssapi_krb5.so.2 (0x006d9000) libkrb5.so.3 => /usr/lib/libkrb5.so.3 (0x00707000) libcom_err.so.2 => /lib/libcom_err.so.2 (0x0079a000) libk5crypto.so.3 => /usr/lib/libk5crypto.so.3 (0x0079d000) libz.so.1 => /lib/libz.so.1 (0x007c3000) libkrb5support.so.0 => /usr/lib/libkrb5support.so.0 (0x007d6000) libkeyutils.so.1 => /lib/libkeyutils.so.1 (0x007df000) Currently i cant restart the apache. I work in a company and now there is rush hours. I will do that about 5 pm. Current top -u apache: shift + M top - 12:31:33 up 2 days, 3:30, 1 user, load average: 0.73, 0.80, 0.79 Tasks: 114 total, 1 running, 113 sleeping, 0 stopped, 0 zombie Cpu(s): 3.3%us, 4.7%sy, 0.0%ni, 90.0%id, 1.3%wa, 0.3%hi, 0.3%si, 0.0%st Mem: 3652120k total, 3169720k used, 482400k free, 353372k buffers Swap: 4425896k total, 0k used, 4425896k free, 1978688k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 16957 apache 20 0 708m 145m 117m S 0.0 4.1 2:11.32 httpd 16956 apache 20 0 754m 142m 107m S 0.0 4.0 2:33.94 httpd 16955 apache 20 0 641m 136m 103m S 5.3 3.8 1:58.37 httpd 17515 apache 20 0 624m 131m 99m S 0.0 3.7 2:03.90 httpd 16954 apache 20 0 627m 130m 98m S 0.0 3.6 2:13.87 httpd 17302 apache 20 0 625m 124m 97m S 0.0 3.5 2:10.80 httpd 17403 apache 20 0 624m 114m 91m S 0.0 3.2 2:08.85 httpd 16952 apache 20 0 502m 114m 81m S 0.0 3.2 1:23.78 httpd 16186 apache 20 0 138m 61m 35m S 0.0 1.7 0:15.54 httpd 16169 apache 20 0 111m 49m 17m S 0.0 1.4 0:06.00 httpd 16190 apache 20 0 126m 48m 24m S 0.0 1.4 0:11.44 httpd 16191 apache 20 0 109m 48m 19m S 0.0 1.4 0:04.62 httpd 16163 apache 20 0 114m 48m 21m S 0.0 1.4 0:09.60 httpd 16183 apache 20 0 127m 48m 23m S 0.0 1.3 0:11.23 httpd 16189 apache 20 0 109m 47m 17m S 0.0 1.3 0:04.55 httpd 16201 apache 20 0 106m 47m 17m S 0.0 1.3 0:03.90 httpd 16193 apache 20 0 103m 46m 20m S 0.0 1.3 0:10.76 httpd 16188 apache 20 0 107m 45m 18m S 0.0 1.3 0:04.85 httpd 16168 apache 20 0 103m 44m 17m S 0.0 1.2 0:05.61 httpd 16187 apache 20 0 118m 41m 21m S 0.0 1.2 0:08.50 httpd 16184 apache 20 0 111m 41m 19m S 0.0 1.2 0:09.28 httpd 16206 apache 20 0 110m 41m 20m S 0.0 1.2 0:11.69 httpd 16199 apache 20 0 108m 40m 17m S 0.0 1.1 0:07.76 httpd 16166 apache 20 0 104m 37m 18m S 0.0 1.0 0:04.31 httpd 16185 apache 20 0 99.3m 36m 16m S 0.0 1.0 0:04.16 httpd as you can see the memory usage growing up from e.g. res( 135 to 145)m and it will be growing up till memory ends. Are you sure that this option i set up: <IfModule prefork.c> StartServers 8 MinSpareServers 5 MaxSpareServers 25 ServerLimit 80 MaxClients 80 MaxRequestsPerChild 4000 </IfModule> KeepAliveTimeout 6 MaxKeepAliveRequests 100 KeepAlive On are correct? Maybe i should decrease some of them? Another questions that bother me: I got e.g. static module mod_negotiation.c compiled into apache and the same module loaded as dynamic. Is this normal that i've loaded duplicated module. But when i want to remove dynamic module(mod_negotiation.c) from httpd.conf and then restart apache error appears. Now I cant tell this error message because i cant restart apache :( Hello again:) This is memory usage just after restart apache: top - 16:19:12 up 2 days, 7:18, 3 users, load average: 1.08, 0.91, 0.91 Tasks: 109 total, 2 running, 107 sleeping, 0 stopped, 0 zombie Cpu(s): 17.0%us, 25.7%sy, 51.0%ni, 4.7%id, 0.0%wa, 0.3%hi, 1.3%si, 0.0%st Mem: 3652120k total, 2762516k used, 889604k free, 361552k buffers Swap: 4425896k total, 0k used, 4425896k free, 2020980k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 13569 apache 20 0 93416 43m 15m S 0.0 1.2 0:02.55 httpd 13575 apache 20 0 98356 38m 16m S 32.3 1.1 0:02.55 httpd 13571 apache 20 0 86808 33m 12m S 0.0 0.9 0:02.60 httpd 13568 apache 20 0 86760 33m 12m S 0.0 0.9 0:00.81 httpd 13570 apache 20 0 83480 33m 12m S 0.0 0.9 0:00.51 httpd 13572 apache 20 0 63520 5916 1548 S 0.0 0.2 0:00.02 httpd 13573 apache 20 0 63520 5916 1548 S 0.0 0.2 0:00.02 httpd 13574 apache 20 0 63520 5916 1548 S 0.0 0.2 0:00.02 httpd 13761 apache 20 0 63388 5128 860 S 0.0 0.1 0:00.01 httpd 13762 apache 20 0 63388 5128 860 S 0.0 0.1 0:00.01 httpd 13763 apache 20 0 63388 5128 860 S 0.0 0.1 0:00.00 httpd I will try to compile apache from source to newest version. Thx for help guys.

  Read the article

• Parse XML tree with no id using LINQ to XML

  - by Danny

  Requirement I want to read a XML tree, fill my objects with encountered attributes and after every run a method (insert it into my db). The amount of parents is not specified, also the order is not specified, it could be, address-death-death-address-address for example Input file Overview: <Root> <Element> <Element2> <Parent> <Child> <Grandchild> <Grandchild> </Child> </Parent> </Element2> </Element1> </Root> Full example: <?xml version="1.0" encoding="utf-8" ?> <Root> <Element1> <Element2> <Parent> <Child> <Grandchild> <number>01</number> <name>Person</name> <Rows> <Row> <number>0110</number> <name>ID</name> <value>123456789</value> </Row> </Rows> </Grandchild> <Grandchild> <number>08</number> <name>Address</name> <Rows> <Row> <number>1110</number> <name>street</name> <value>first aveneu</value> </Row> <Row> <number>1120</number> <name>streetnumber</name> <value>345</value> </Row> <Row> <number>1130</number> <name>zip</name> <value>2938PS</value> </Row> <Row> <number>1160</number> <name>country</name> <value>Germany</value> </Row> </Rows> </Grandchild> </Child> </Parent> <Parent> <Child> <Grandchild> <number>01</number> <name>Person</name> <Rows> <Row> <number>0110</number> <name>ID</name> <value>987654321</value> </Row> </Rows> </Grandchild> <Grandchild> <number>06</number> <name>Death</name> <Rows> <Row> <number>0810</number> <name>date</name> <value>2012-01-03</value> </Row> <Row> <number>0820</number> <name>placeOfDeath</name> <value>attic</value> </Row> <Row> <number>0830</number> <name>funeral</name> <value>burrial</value> </Row> </Rows> </Grandchild> </Child> </Parent> </Element2> </Element1> </Root> Desired result After encounter of parent determine type of grandchild (number 6 is death number 8 is address) Every parent has ALWAYS grandchild number 1 'Person', the second grandchild is either death or address. reading first parent Person person = new Person(); person.ID = value; <--- filled with 123456789 person.street = value; <--- filled with first aveneu person.streetnumber = value; <--- filled with 345 person.zip = value; <--- filled with 2938PS person.country = value; <--- filled with germany person.DoMethod(); // inserts the value in db Continue reading next parent. Person person = new Person(); person.ID = value; <--- filled with 987654321 person.date = value; <--- filled with 2012-01-03 person.placeOfDeath = value; <--- filled with attic person.funeral = value; <--- filled with burrial person.DoMethod(); // insert the values in db Continue reading till no parents found EDIT: how do I target the name element of the second grandchild for every child? Like address or death Code/Credit I got no further then this, with help of Daniel Hilgarth: Linq to XML (C#) parse XML tree with no attributes/id to object The XML tree has changed, and I am really stuck.. in the meantime I try to post new working code...

  Read the article

• PHP session not working with JQuery Ajax?

  - by Bolt_Head

  Update, Solved: After all this I found out that I was calling an old version of my code in the update ajax. 'boardControl.php' instead of 'boardUpdate.php' These are the kinds of mistakes that make programing fun. I'm writing a browser gomoku game. I have the ajax statement that allows the player to play a piece. $(document).ready(function() { $("td").live('click',function(){ var value = $(this).attr('id'); $.get('includes/boardControl.php',{play: value, bid: bid}); }); }); value = board square location bid = board ID Before creating a user login for player identification, the server side php had a temporary solution. It would rotate the piece state for the squares when clicked instead of knowing what player to create them for. After creating login stuff I set a session variable for the player's ID. I was hoping to read the session ID from the php during the ajax request and figure out what player they are from there. session_start(); ... $playerId = $_SESSION['char']; $Query=("SELECT p1, p2 FROM board WHERE bid=$bid"); $Result=mysql_query($Query); $p1 = mysql_result($Result,0,"p1"); $p2 = mysql_result($Result,0,"p2"); $newPiece = 0; //*default no player if($playerId == $p1) $newPiece = 1; if($playerId == $p2) $newPiece = 2; For some reason when I run the full web app, the pieces still cycle though, even after I deleted the code to make them cycle. Furthermore, after logging in If i manually load the php page in the browser, it modifies the database correctly (where it only plays pieces belonging to that player) and outputs the correct results. It seems to me that the session is not being carried over when used with Ajax. Yet Google searches tell me that, sessions do work with Ajax. Update: I'm trying to provide more information. Logging in works correctly. My ID is recognized and I printed it out next to the board to ensure that I was retrieving it correctly. The ajax request does update the board. The values passed are correct and confirmed with firebug's console. However instead of placing pieces only for the player they belong to it cycles though the piece states (0,1,2). When manually browsing to boardUpdate.php and putting in the same values sent from the Ajax the results seen in the echo'ed response indicates that the corresponding piece is played each time as intended. Same results on my laptop after fresh load of firefox. Manually browsing to boardUpdate.php without logging in before hand leave the board unchanged (as intended when no user is found in the session). I've double checked the that session_start() is on the php files and double checked the session ID variables. Hope this extra information helps, i'm running out of ideas what to tell you. Should I load up the full code? Update 2: After checking the Ajax responce in fire-bug I realized that the 'play' request does not get a result, and the board is not updated till the next 'update'. I'm still looking into this but I'll post it here for you guys too. boardUpdate.php Notable places are: Refresh Board(line6) Place Piece(line20) function boardUpdate($turnCount) (line63) <?php session_start(); require '../../omok/dbConnect.php'; //*** Refresh Board *** if(isset($_GET['update'])) { $bid = $_GET['bid']; $Query=("SELECT turn FROM board WHERE bid=$bid"); $Result=mysql_query($Query); $turnCount=mysql_result($Result,0,"turn"); if($_GET['turnCount'] < $turnCount) //** Turn increased { boardUpdate($turnCount); } } //*** Place Piece *** if(isset($_GET['play'])) // turn order? player detect? { $squareID = $_GET['play']; $bid = $_GET['bid']; $Query=("SELECT turn, boardstate FROM board WHERE bid=$bid"); $Result=mysql_query($Query); $turnCount=mysql_result($Result,0,"turn"); $boardState=mysql_result($Result,0,"boardstate"); $turnCount++; $playerId = $_SESSION['char']; $Query=("SELECT p1, p2 FROM board WHERE bid=$bid"); $Result=mysql_query($Query); $p1 = mysql_result($Result,0,"p1"); $p2 = mysql_result($Result,0,"p2"); $newPiece = 0; //*default no player if($playerId == $p1) $newPiece = 1; if($playerId == $p2) $newPiece = 2; // if($newPiece != 0) // { $oldPiece = getBoardSpot($squareID, $bid); $oldLetter = $boardState{floor($squareID/3)}; $slot = $squareID%3; //***function updateCode($old, $new, $current, $slot)*** $newLetter = updateCode($oldPiece, $newPiece, $oldLetter, $slot); $newLetter = value2Letter($newLetter); $newBoard = substr_replace($boardState, $newLetter, floor($squareID/3), 1); //** Update Query for boardstate & turn $Query=("UPDATE board SET boardState = '$newBoard', turn = '$turnCount' WHERE bid = '$bid'"); mysql_query($Query); // } boardUpdate($turnCount); } function boardUpdate($turnCount) { $json = '{"turnCount":"'.$turnCount.'",'; //** turnCount ** $bid = $_GET['bid']; $Query=("SELECT boardstate FROM board WHERE bid='$bid'"); $Result=mysql_query($Query); $Board=mysql_result($Result,0,"boardstate"); $json.= '"boardState":"'.$Board.'"'; //** boardState ** $json.= '}'; echo $json; } function letter2Value($input) { if(ord($input) >= 48 && ord($input) <= 57) return ord($input) - 48; else return ord($input) - 87; } function value2Letter($input) { if($input >= 10) return chr($input += 87); else return chr($input += 48); } //*** UPDATE CODE *** updates an letter with a new peice change and returns result letter. //***** $old : peice value before update //***** $new : peice value after update //***** $current : letterValue of code before update. //***** $slot : which of the 3 sqaures the change needs to take place in. function updateCode($old, $new, $current, $slot) { if($slot == 0) {// echo $current,"+((",$new,"-",$old,")*9)"; return letter2Value($current)+(($new-$old)*9); } else if($slot == 1) {// echo $current,"+((",$new,"-",$old,")*3)"; return letter2Value($current)+(($new-$old)*3); } else //slot == 2 {// echo $current,"+((",$new,"-",$old,")"; return letter2Value($current)+($new-$old); } }//updateCode() //**** GETBOARDSPOT *** Returns the peice value at defined location on the board. //****** 0 is first sqaure increment +1 in reading order (0-254). function getBoardSpot($squareID, $bid) { $Query=("SELECT boardstate FROM board WHERE bid='$bid'"); $Result=mysql_query($Query); $Board=mysql_result($Result,0,"boardstate"); if($squareID %3 == 2) //**3rd spot** { if( letter2Value($Board{floor($squareID/3)} ) % 3 == 0) return 0; else if( letter2Value($Board{floor($squareID/3)} ) % 3 == 1) return 1; else return 2; } else if($squareID %3 == 0) //**1st spot** { if(letter2Value($Board{floor($squareID/3)} ) <= 8) return 0; else if(letter2Value($Board{floor($squareID/3)} ) >= 18) return 2; else return 1; } else //**2nd spot** { return floor(letter2Value($Board{floor($squareID/3)}))/3%3; } }//end getBoardSpot() ?> Please help, I'd be glad to provide more information if needed. Thanks in advance =)

  Read the article

• Connection drop problem with Hibernate-mysql-c3p0

  - by user344788

  hi all, This is an issue which I have seen all across the web. I will bring it up again as till now I don't have a fix for the same. I am using hibernate 3. mysql 5 and latest c3p0 jar. I am getting a broken pipe exception. Following is my hibernate.cfg file. com.mysql.jdbc.Driver org.hibernate.dialect.MySQLDialect <property name="hibernate.show_sql">true</property> <property name="hibernate.use_sql_comments">true</property> <property name="hibernate.current_session_context_class">thread</property> <property name="connection.autoReconnect">true</property> <property name="connection.autoReconnectForPools">true</property> <property name="connection.is-connection-validation-required">true</property> <!--<property name="c3p0.min_size">5</property> <property name="c3p0.max_size">20</property> <property name="c3p0.timeout">1800</property> <property name="c3p0.max_statements">50</property> --><property name="hibernate.connection.provider_class">org.hibernate.connection.C3P0ConnectionProvider </property> <property name="hibernate.c3p0.acquireRetryAttempts">30</property> <property name="hibernate.c3p0.acquireIncrement">5</property> <property name="hibernate.c3p0.automaticTestTable">C3P0TestTable</property> <property name="hibernate.c3p0.idleConnectionTestPeriod">36000</property> <property name="hibernate.c3p0.initialPoolSize">20</property> <property name="hibernate.c3p0.maxPoolSize">100</property> <property name="hibernate.c3p0.maxIdleTime">1200</property> <property name="hibernate.c3p0.maxStatements">50</property> <property name="hibernate.c3p0.minPoolSize">10</property>--> My connection pooling is occurring fine. During the day it is fine , but once i keep it idle over the night ,next day I find it giving me broken connection error. public class HibernateUtil { private static Logger log = Logger.getLogger(HibernateUtil.class); //private static Log log = LogFactory.getLog(HibernateUtil.class); private static Configuration configuration; private static SessionFactory sessionFactory; static { // Create the initial SessionFactory from the default configuration files try { log.debug("Initializing Hibernate"); // Read hibernate.properties, if present configuration = new Configuration(); // Use annotations: configuration = new AnnotationConfiguration(); // Read hibernate.cfg.xml (has to be present) configuration.configure(); // Build and store (either in JNDI or static variable) rebuildSessionFactory(configuration); log.debug("Hibernate initialized, call HibernateUtil.getSessionFactory()"); } catch (Throwable ex) { // We have to catch Throwable, otherwise we will miss // NoClassDefFoundError and other subclasses of Error log.error("Building SessionFactory failed.", ex); throw new ExceptionInInitializerError(ex); } } /** * Returns the Hibernate configuration that was used to build the SessionFactory. * * @return Configuration */ public static Configuration getConfiguration() { return configuration; } /** * Returns the global SessionFactory either from a static variable or a JNDI lookup. * * @return SessionFactory */ public static SessionFactory getSessionFactory() { String sfName = configuration.getProperty(Environment.SESSION_FACTORY_NAME); System.out.println("Current s name is "+sfName); if ( sfName != null) { System.out.println("Looking up SessionFactory in JNDI"); log.debug("Looking up SessionFactory in JNDI"); try { System.out.println("Returning new sssion factory"); return (SessionFactory) new InitialContext().lookup(sfName); } catch (NamingException ex) { throw new RuntimeException(ex); } } else if (sessionFactory == null) { System.out.println("calling rebuild session factory now"); rebuildSessionFactory(); } return sessionFactory; } /** * Closes the current SessionFactory and releases all resources. * <p> * The only other method that can be called on HibernateUtil * after this one is rebuildSessionFactory(Configuration). */ public static void shutdown() { log.debug("Shutting down Hibernate"); // Close caches and connection pools getSessionFactory().close(); // Clear static variables sessionFactory = null; } /** * Rebuild the SessionFactory with the static Configuration. * <p> * Note that this method should only be used with static SessionFactory * management, not with JNDI or any other external registry. This method also closes * the old static variable SessionFactory before, if it is still open. */ public static void rebuildSessionFactory() { log.debug("Using current Configuration to rebuild SessionFactory"); rebuildSessionFactory(configuration); } /** * Rebuild the SessionFactory with the given Hibernate Configuration. * <p> * HibernateUtil does not configure() the given Configuration object, * it directly calls buildSessionFactory(). This method also closes * the old static variable SessionFactory before, if it is still open. * * @param cfg */ public static void rebuildSessionFactory(Configuration cfg) { log.debug("Rebuilding the SessionFactory from given Configuration"); if (sessionFactory != null && !sessionFactory.isClosed()) sessionFactory.close(); if (cfg.getProperty(Environment.SESSION_FACTORY_NAME) != null) { log.debug("Managing SessionFactory in JNDI"); cfg.buildSessionFactory(); } else { log.debug("Holding SessionFactory in static variable"); sessionFactory = cfg.buildSessionFactory(); } configuration = cfg; } } Above is my code for the session factory. And I have only select operations . And below is the method which is used most often to execute my select queries. One tricky thing which I am not understanding is in my findById method i am using this line of code getSession().beginTransaction(); without which it gives me an error saying that this cannot happpen without a transaction. But nowhere I am closing this transaction. And thers no method to close a transaction apart from commit or rollback (as far as i know) which are not applicable for select statements. public T findById(ID id, boolean lock) throws HibernateException, DAOException { log.debug("findNyId invoked with ID ="+id+"and lock ="+lock); T entity; getSession().beginTransaction(); if (lock) entity = (T) getSession().load(getPersistentClass(), id, LockMode.UPGRADE); else entity = (T) getSession().load(getPersistentClass(), id); return entity; } Can anyone please suggest what can I do ? I have tried out almost every solution available via googling, on stackoverlow or on hibernate forums with no avail. (And increasing wait_timeout on mysql is not a valid option in my case).

  Read the article

• Questions related to writing your own file downloader using multiple threads java

  - by Shekhar

  Hello In my current company, i am doing a PoC on how we can write a file downloader utility. We have to use socket programming(TCP/IP) for downloading the files. One of the requirements of the client is that a file(which will be large in size) should be transfered in chunks for example if we have a file of 5Mb size then we can have 5 threads which transfer 1 Mb each. I have written a small application which downloads a file. You can download the eclipe project from http://www.fileflyer.com/view/QM1JSC0 A brief explanation of my classes FileSender.java This class provides the bytes of file. It has a method called sendBytesOfFile(long start,long end, long sequenceNo) which gives the number of bytes. import java.io.File; import java.io.IOException; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileSender { private static final String FILE_NAME = "C:\\shared\\test.pdf"; public ByteArrayWrapper sendBytesOfFile(long start,long end, long sequenceNo){ try { File file = new File(FILE_NAME); byte[] fileBytes = FileUtils.readFileToByteArray(file); System.out.println("Size of file is " +fileBytes.length); System.out.println(); System.out.println("Start "+start +" end "+end); byte[] bytes = getByteArray(fileBytes, start, end); ByteArrayWrapper wrapper = new ByteArrayWrapper(bytes, sequenceNo); return wrapper; } catch (IOException e) { throw new RuntimeException(e); } } private byte[] getByteArray(byte[] bytes, long start, long end){ long arrayLength = end-start; System.out.println("Start : "+start +" end : "+end + " Arraylength : "+arrayLength +" length of source array : "+bytes.length); byte[] arr = new byte[(int)arrayLength]; for(int i = (int)start, j =0; i < end;i++,j++){ arr[j] = bytes[i]; } return arr; } public static long fileSize(){ File file = new File(FILE_NAME); return file.length(); } } Second Class is FileReceiver.java - This class receives the file. Small Explanation what this file does This class finds the size of the file to be fetched from Sender Depending upon the size of the file it finds the start and end position till the bytes needs to be read. It starts n number of threads giving each thread start,end, sequence number and a list which all the threads share. Each thread reads the number of bytes and creates a ByteArrayWrapper. ByteArrayWrapper objects are added to the list Then i have while loop which basically make sure that all threads have done their work finally it sorts the list based on the sequence number. then the bytes are joined, and a complete byte array is formed which is converted to a file. Code of File Receiver package com.filedownloader; import java.io.File; import java.io.IOException; import java.util.ArrayList; import java.util.Collections; import java.util.Comparator; import java.util.List; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileReceiver { public static void main(String[] args) { FileReceiver receiver = new FileReceiver(); receiver.receiveFile(); } public void receiveFile(){ long startTime = System.currentTimeMillis(); long numberOfThreads = 10; long filesize = FileSender.fileSize(); System.out.println("File size received "+filesize); long start = filesize/numberOfThreads; List<ByteArrayWrapper> list = new ArrayList<ByteArrayWrapper>(); for(long threadCount =0; threadCount<numberOfThreads ;threadCount++){ FileDownloaderTask task = new FileDownloaderTask(threadCount*start,(threadCount+1)*start,threadCount,list); new Thread(task).start(); } while(list.size() != numberOfThreads){ // this is done so that all the threads should complete their work before processing further. //System.out.println("Waiting for threads to complete. List size "+list.size()); } if(list.size() == numberOfThreads){ System.out.println("All bytes received "+list); Collections.sort(list, new Comparator<ByteArrayWrapper>() { @Override public int compare(ByteArrayWrapper o1, ByteArrayWrapper o2) { long sequence1 = o1.getSequence(); long sequence2 = o2.getSequence(); if(sequence1 < sequence2){ return -1; }else if(sequence1 > sequence2){ return 1; } else{ return 0; } } }); byte[] totalBytes = list.get(0).getBytes(); byte[] firstArr = null; byte[] secondArr = null; for(int i = 1;i<list.size();i++){ firstArr = totalBytes; secondArr = list.get(i).getBytes(); totalBytes = concat(firstArr, secondArr); } System.out.println(totalBytes.length); convertToFile(totalBytes,"c:\\tmp\\test.pdf"); long endTime = System.currentTimeMillis(); System.out.println("Total time taken with "+numberOfThreads +" threads is "+(endTime-startTime)+" ms" ); } } private byte[] concat(byte[] A, byte[] B) { byte[] C= new byte[A.length+B.length]; System.arraycopy(A, 0, C, 0, A.length); System.arraycopy(B, 0, C, A.length, B.length); return C; } private void convertToFile(byte[] totalBytes,String name) { try { FileUtils.writeByteArrayToFile(new File(name), totalBytes); } catch (IOException e) { throw new RuntimeException(e); } } } Code of ByteArrayWrapper package com.filedownloader; import java.io.Serializable; public class ByteArrayWrapper implements Serializable{ private static final long serialVersionUID = 3499562855188457886L; private byte[] bytes; private long sequence; public ByteArrayWrapper(byte[] bytes, long sequenceNo) { this.bytes = bytes; this.sequence = sequenceNo; } public byte[] getBytes() { return bytes; } public long getSequence() { return sequence; } } Code of FileDownloaderTask import java.util.List; public class FileDownloaderTask implements Runnable { private List<ByteArrayWrapper> list; private long start; private long end; private long sequenceNo; public FileDownloaderTask(long start,long end,long sequenceNo,List<ByteArrayWrapper> list) { this.list = list; this.start = start; this.end = end; this.sequenceNo = sequenceNo; } @Override public void run() { ByteArrayWrapper wrapper = new FileSender().sendBytesOfFile(start, end, sequenceNo); list.add(wrapper); } } Questions related to this code 1) Does file downloading becomes fast when multiple threads is used? In this code i am not able to see the benefit. 2) How should i decide how many threads should i create ? 3) Are their any opensource libraries which does that 4) The file which file receiver receives is valid and not corrupted but checksum (i used FileUtils of common-io) does not match. Whats the problem? 5) This code gives out of memory when used with large file(above 100 Mb) i.e. because byte array which is created. How can i avoid? I know this is a very bad code but i have to write this in one day -:). Please suggest any other good way to do this? Thanks Shekhar

  Read the article

• How to use data of one table in 'where' clause of another table?

  - by sahar

  hello, i need ur help guys..i m making website for 'home docor ideas'..i have a log in form(login-form.php) in which when 'log in' and 'password' is inserted,after verification through login-execute.php, redirected to viewOrder.php where user can view all of the orders ordered by clients.. all is fine up till here.. but what i want is,when user get logged in ,he view only that order which is ordered by him not all customer's orders.. two tables are there in database: members and order_insert.. in 'members' table, login and password is stored and in 'order_insert',orders of customers is stored.. codes of these three pages is as follows.. ......................... login-form.php ......................... <form id="loginForm" name="loginForm" method="post" action="login-exec.php"> <table width="300" border="0" align="center" cellpadding="2" cellspacing="0"> <tr> <td width="112"><b>Login</b></td> <td width="188"><input name="login" type="text" class="textfield" id="login" /></td> </tr> <tr> <td><b>Password</b></td> <td><input name="password" type="password" class="textfield" id="password" /></td> </tr> <tr> <td>&nbsp;</td> <td><input type="submit" name="Submit" value="Login" /></td> </tr> </table> </form> ......................... login-execute.php ......................... <?php //Start session session_start(); //Include database connection details require_once('config.php'); //Array to store validation errors $errmsg_arr = array(); //Validation error flag $errflag = false; //Connect to mysql server $link = mysql_connect(DB_HOST, DB_USER, DB_PASSWORD); if(!$link) { die('Failed to connect to server: ' . mysql_error()); } //Select database $db = mysql_select_db(DB_DATABASE); if(!$db) { die("Unable to select database"); } //Function to sanitize values received from the form. Prevents SQL injection function clean($str) { $str = @trim($str); if(get_magic_quotes_gpc()) { $str = stripslashes($str); } return mysql_real_escape_string($str); } //Sanitize the POST values $login = clean($_POST['login']); $password = clean($_POST['password']); //Input Validations if($login == '') { $errmsg_arr[] = 'Login ID missing'; $errflag = true; } if($password == '') { $errmsg_arr[] = 'Password missing'; $errflag = true; } //If there are input validations, redirect back to the login form if($errflag) { $_SESSION['ERRMSG_ARR'] = $errmsg_arr; session_write_close(); header("location: login-form.php"); exit(); } //Create query $qry="SELECT * FROM members WHERE login='$login' AND passwd='".md5($_POST['password'])."'"; $result=mysql_query($qry); //Check whether the query was successful or not if($result) { if(mysql_num_rows($result) == 1) { //Login Successful session_regenerate_id(); $member = mysql_fetch_assoc($result); $_SESSION['SESS_MEMBER_ID'] = $member['member_id']; $_SESSION['SESS_FIRST_NAME'] = $member['firstname']; $_SESSION['SESS_LAST_NAME'] = $member['lastname']; session_write_close(); header("location: viewOrder.php"); exit(); }else { //Login failed header("location: login-failed.php"); exit(); } }else { die("Query failed"); } ?> ............................. viewOrder.php .............................. <html> <body bgcolor="#FFFFFF" > <? $host="localhost"; // Host name $username="root"; // Mysql username $password=""; // Mysql password $db_name="mydatabase"; // Database name $tbl_name="order_insert"; // Table name $tbl_name2="members"; // connect to server and databases mysql_connect("$host", "$username", "$password")or die("cannot connect"); mysql_select_db("$db_name")or die("cannot select DB"); $result = mysql_query("SELECT * FROM $tbl_name "); print "<center>"; $output .= "<table width=1100 border=1 bordercolor=black>"; $output .= "<tr align=center><td>ID</td><td>First Name</td><td>Last Name</td><td>E Mail</td><td> City </td><td> Country </td><td> Phone</td><td>Decoration Type</td><td>Service Description</td><td>Budget</td><td>Update</td><td>Delete</td></tr>"; $output .= "<th></th><th></th>"; $output .= "</tr>\n\n"; while ($row = mysql_fetch_assoc($result)){ $output .= "<tr>\n"; foreach ($row as $col=>$val){ $output .= " <td>$val</td>\n"; } // end foreach $keyVal = $row["id"]; $output .= "<td><a href='update.php?ID=$row[orderId]' >Update </a></td>"; $output .= "<td><a href='delete.php?ID=$row[orderId]' >Delete </a></td>"; $output .= "</tr>\n\n"; }// end while $output .= "</table></center>"; print "$output"; ?>&nbsp;&nbsp;&nbsp;<br> <br> <center><table > <tr><td> <form action="home.php"><font color="#FF0000"><input type="submit" name="btn" style="color:#CC0000" value="<--Back" ></font></form></td></tr></table></center> </body> </html> ..... your help and suggestions will be appreciated

  Read the article

• SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

  - by pinaldave

  TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

  Read the article

• SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

  - by pinaldave

  TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

  Read the article

< Previous Page | 49 50 51 52 53 54  | Next Page >