Search Results

Search found 37414 results on 1497 pages for 'open port'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 531/1497 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • openss7 ss7 I_LINK ioctl

    - by deddihp
    Hello everyone, is there anyonve have used openss7 before ?. well, I am trying to implement MTP with mtpi interface. so i use I_LINK to link between M2PA and MTP. But I got some error, ioctl invalid argument. Do you have some suggestion for me ?. Thanks. your answer will be very helpful for me. int a1 = open("/dev/sctp_n", O_RDWR); int a2 = open("/dev/mtp", O_RDWR); ioctl(a1, I_PUSH, "m2pa-sl"); perror("m2pa-sl"); int a3 = ioctl(a1, I_LINK, a2); perror("ilink");

    Read the article

  • EADDRNOTAVAIL when binding 127.0.0.1 on localhost?

    - by Jonas Byström
    I'm getting errno==49 (EADDRNOTAVAIL) when trying to UDP-bind() to 127.0.0.1:47346 running Mac OS X on a G5 (big endian PowerPC). Is there something preventing me from doing so? I've tried other addresses and ports (192.168.1.2 and port 47346) but with no success. Here's a gdb printout of my sockaddr_in: $1 = { sin_len = 0 '\0', sin_family = 2 '\002', sin_port = 47346, sin_addr = { s_addr = 3232235778 }, sin_zero = "???\000\000??" }

    Read the article

  • C# CF: file encryption/decryption on the fly

    - by nuttynibbles
    Hi, i've seen many article on encrypt/decrypt of file and typically a button is used to choose the file for encrypt and another button to decrypt the file. i've seen some application like truecrypt and probably others which does file encryption on-the-fly with transparent. this means that when a encrypted file is clicked to access, it will automatically decrypt and play/open the file. then when the file is closed, it will automatically encrypt again. some have said that the only way to detect file open is through file system filter. but is there other ways to do this in c# compact framework?

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • Attaching HTML file as email in VB 6.0

    - by Shax
    Hi, I am trying to attach an html file file to email using Visual Basic 6.0. when the cursor is comes on Open strFile For Binary Access Read As #hFile line it gives error "Error encoding file - Bad file name or number". Please all your help and support would be highly appreciated. Dim handleFile As Integer Dim strValue As String Dim lEventCtr As Long handleFile = FreeFile Open strFile For Binary Access Read As #handleFile Do While Not EOF(hFile) ' read & Base 64 encode a line of characters strValue = Input(57, #handleFile) SendCommand EncodeBase64String(strValue) & vbCrLf ' DoEvents (occasionally) lEventCtr = lEventCtr + 1 If lEventCtr Mod 50 = 0 Then DoEvents Loop Close #handleFile Exit Sub File_Error: Close #handleFile m_ErrorDesc = "Error encoding file - " & Err.Description Err.Raise Err.Number, Err.Source, m_ErrorDesc End Sub

    Read the article

  • WiFi & GbE Slow while Both Active.

    - by Mark Tomlin
    I'm having a problem with my WiFi network connection when I use my wired GbE connection concurrently on my Laptop. I'm using my WiFi for Internet access, and general web surfing and I'm using my GbE connection to connect to my PlayStation so I can stream media. The WiFi connection is via a Linksys 610N connected to my Cable Modem. Where as the GbE connection is a direct connection from my Ethernet port to the Ethernet port of the PS3 via a Cat-5 cable (no router in between this connection). As soon as I connect the cable from the PS3 to my Ethernet port on my Laptop the WiFi connection slows to a halt, but then allows for a connection to the web as normal but at much slower speeds for the things like BitTorrent that stops completely. It seems to me that Windows can't handle both connections at once. It will have both active but it can only accept and send packets on one device at one time. I can get WiFi connections to work to go to websites and the like, but once I use my GbE connection to share media between my Laptop and my PS3 the Wifi connection dies out and I no longer have access to the internet. I setup my connection on the PS3 and the Laptop following the insturctions posted here: http://forums.finalgear.com/problems/s14e01-ps3-size-problem-40642/#post1188132 And the following is the results of my ipconfig. Windows IP Configuration Host Name . . . . . . . . . . . . : dygear Primary Dns Suffix . . . . . . . : Node Type . . . . . . . . . . . . : Hybrid IP Routing Enabled. . . . . . . . : No WINS Proxy Enabled. . . . . . . . : No Ethernet adapter WiFi: Connection-specific DNS Suffix . : Description . . . . . . . . . . . : Intel(R) PRO/Wireless 3945ABG Network Connection Physical Address. . . . . . . . . : 00-19-**-**-**-** Dhcp Enabled. . . . . . . . . . . : Yes Autoconfiguration Enabled . . . . : Yes IP Address. . . . . . . . . . . . : 192.168.1.111 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : 192.168.1.1 DHCP Server . . . . . . . . . . . : 192.168.1.1 DNS Servers . . . . . . . . . . . : 192.168.1.1 167.206.254.2 167.206.254.1 Lease Obtained. . . . . . . . . . : Wednesday, May 19, 2010 08:55:30 Lease Expires . . . . . . . . . . : Thursday, May 20, 2010 08:55:30 Ethernet adapter LAN: Connection-specific DNS Suffix . : Description . . . . . . . . . . . : Broadcom NetXtreme Gigabit Ethernet Physical Address. . . . . . . . . : 00-16-**-**-**-** Dhcp Enabled. . . . . . . . . . . : No IP Address. . . . . . . . . . . . : 192.168.1.50 Subnet Mask . . . . . . . . . . . : 255.255.255.0 Default Gateway . . . . . . . . . : Any ideas?

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • ASP.NET MVC 2 - user defined database connection.

    - by J Harley
    Hello, I am looking to port my very basic DBMS software from classic ASP to ASP.net - however the user would need to input the connection details in order to connect to their specific DBMS server. Is this at all possible with ASP.NET MVC (very similar to DSN-less connections in ASP). Cheers, Joel

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Looking for Fiddler2 help. connection to gateway refused? Just got rid of a virus

    - by John Mackey
    I use Fiddler2 for facebook game items, and it's been a great success. I accessed a website to download some dat files I needed. I think it was eshare, ziddu or megaupload, one of those. Anyway, even before the rar file had downloaded, I got this weird green shield in the bottom right hand corner of my computer. It said a Trojan was trying to access my computer, or something to that extent. It prompted me to click the shield to begin anti-virus scanning. It turns out this rogue program is called Antivirus System Pro and is pretty hard to get rid of. After discovering the rogue program, I tried using Fiddler and got the following error: [Fiddler] Connection to Gateway failed.Exception Text: No connection could be made because the target machine actively refused it 127.0.0.1:5555 I ended up purchasing SpyDoctor + Antivirus, which I'm told is designed specifically for getting rid of these types of programs. Anyway, I did a quick-scan last night with spydoctor and malware bytes. Malware picked up 2 files, and Spydoctor found 4. Most were insignificant, but it did find a worm called Worm.Alcra.F, which was labeled high-priority. I don’t know if that’s the Anti-Virus Pro or not, but SpyDoctor said it got rid of all of those successfully. I tried to run Fiddler again before leaving home, but was still getting the "gateway failed" error. Im using the newest version of firefox. When I initially set up the Fiddler 2.2.8.6, I couldn’t get it to run at first, so I found this faq on the internet that said I needed to go through ToolsOptionsSettings and set up an HTTP Proxy to 127.0.0.1 and my Port to 8888. Once I set that up and downloaded this fiddler helper as a firefox add-on, it worked fine. When I turn on fiddler, it automatically takes my proxy setting from no proxy (default) to the 127.0.0.1 with Port 8888 set up. It worked fine until my computer detected this virus. Anyway, hopefully I've given you sufficient information to offer me your best advice here. Like I said, Spydoctor says the bad stuff is gone, so maybe the rogue program made some type of change in my fiddler that I could just reset or uncheck or something like that? Or will I need to completely remove fiddler and those dat files and rar files I downloaded? Any help would be greatly appreciated. Thanks for your time.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • sending email on local machine is not working.

    - by haansi
    I am using my gmail's email account to send emails in asp.net website. It works fine on hosting server but it donot works if I try to sent email on loclserver. Please guide me what I should do to make it sending emails even on localserver ? Do I need to install some smtp server on my local machine ? I have not installed any smtp server on my machine. How and where from I can get smtp server and kindly also guide how I can do its setting to use on local machine. Thnaks Here is my Code public string SendEmail(Email email) { string errmsg = null; if (dt != null) { try { dt = systemrep.GetSystemInfo(); dr = dt.Rows[0]; From = dr["nm_EmailFrom"].ToString(); SMTP = dr["nm_SMTP"].ToString(); Port = dr["amt_Port"].ToString(); EmailId = dr["nm_emailUserId"].ToString(); EmailPassword = dr["nm_emailPassword"].ToString(); DefaultCredations = Convert.ToBoolean(dr["ind_Credentials"].ToString()); MailMessage message = new MailMessage(); SmtpClient smtp = new SmtpClient(); NetworkCredential mailAuthentication = new NetworkCredential(EmailId, EmailPassword); message.To.Add(new MailAddress(email.To)); message.From = new MailAddress(From); message.IsBodyHtml = true; message.Subject = email.Subject; message.Body = email.Message; smtp.UseDefaultCredentials = DefaultCredations; smtp.EnableSsl = true; smtp.Port = 25; smtp.DeliveryMethod = SmtpDeliveryMethod.Network; smtp.Host = SMTP; smtp.Credentials = new NetworkCredential(EmailId, EmailPassword); smtp.Send(message); } catch (SmtpException smtpEx) { errmsg = string.Format("alert('There was a problem in sending the email: {0}');", smtpEx.Message.Replace("'", "\\'")); } catch (Exception generalEx) { errmsg = string.Format("alert('There was a general problem: {0}');", generalEx.Message.Replace("'", "\\'")); } } else errmsg = "An error accured whilte getting email settings from database, process couldn't be completed"; return errmsg; } }

    Read the article

  • OCR Web Service

    - by sdfx
    I am searching for an OCR web service (eventually open source, preferably free) that simply receives an image and returns the text of the image in writing. I've looked at tesseract, OCRopus and GOCR but the only open server I could find is WeOCR. Unfortunately the detection rates (at least during my tests) are sub-par and the speed is not much better. Does anyone have any experience with OCR web services? I guess the license of tesseract allows the operation of such a service, are there any out there?

    Read the article

  • Using a bookmarklet to track a package

    - by user307558
    I'm trying to write a bookmarklet that tracks a package in the mail. First it checks to see if the tracking page is open, if not it opens it in a new tab, and then sets the value of the form to the tracking number. Finally, it submits the form. What I'm so far unable to do is set the value of the form in the case where the bookmarklet opens up a new tab. Here's what I have: javascript: (function(){ var trackingNumber = "/*tracking number*/"; var a = document.forms.trackingForm; if ('http://fedex.com/Tracking' == document.location) { trackingForm.trackNbrs.value = trackingNumber; document.forms.trackingForm.submit(); } else { window.open('http://fedex.com/Tracking'); this.window.onload = function(){ //This seems to be the problem trackingForm.trackNbrs.value = trackingNumber; onload(document.forms.trackingForm.submit()); } } })(); Any ideas?

    Read the article

  • Internal redirection to tomcat from IIS 7.0?

    - by user294754
    Hello All, I am running some sites on IIS 7.0. But yesterday one of my client me to host a Java website. I cant host that website directly so I installed tomcat server on port 8080. Now I want whenever browser send a request for that website it should redirected to my tomcat internally. The client URL should not update. Regards, Prateek

    Read the article

  • poblems with jquery code

    - by Michael
    Another jquery issue... I have tried this several times using "class" and "id" elements and I can not get it right. I am hoping the brains on stackoverflow can help! The problem that I am having is when I open the page all elments are closed. When I click on one link all links open. I believe it closes correctly the problem is that when I open the first link all items open. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Bid Items</title> <link href="bid.css" rel="stylesheet" type="text/css" /> <script src="jquerry/js/jquery.js" type="text/javascript"></script> <script type="text/javascript"> $(document).ready(function(){ $('#showhideconent').hide(); $('a').click(function(){ $('#showhideconent').show('slow'); }); $('a#close').click(function(){ $('#showhideconent').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent2').hide(); $('a').click(function(){ $('#showhideconent2').show('slow'); }); $('a#close2').click(function(){ $('#showhideconent2').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent3').hide(); $('a').click(function(){ $('#showhideconent3').show('slow'); }); $('a#close3').click(function(){ $('#showhideconent3').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent4').hide(); $('a').click(function(){ $('#showhideconent4').show('slow'); }); $('a#close4').click(function(){ $('#showhideconent4').hide('slow'); }) }); </script> </head> <body class="oneColElsCtr" onload="MM_preloadImages('Assignment4b.jpg')"> <div id="container"> <div id="mainContent"> <h1>Bid Page</h1> <h1>Coke Memorbila</h1> <a href="#" id="click">Amber Bottle 1914</a> <div id="box" align="center"> <div id="showhideconent"> <p><a href="coke/Amber1914.shtml"><img src="amber1914.jpg" width="200" height="200" alt="Amber Coke" /></a></p> <p><a href="#" id="close">Close</a> </p> </div> </div> <a href="#" id="click">Amber Bottle 1915</a> <div id="box" align="center"> <div id="showhideconent2"> <p><a href="coke/Amber1915.shtml"><img src="coke/Amber1914.shtml" width="200" height="200" alt="Amber Bottle 1915" /></a></p> <p><a href="#" id="close2">Close</a> </p> </div> </div> <a href="#" id="click">Green 1929</a> <div id="box" align="center"> <div id="showhideconent3"> <p><a href="coke/green1929.shtml"><img src="green1929.jpg" width="200" height="200" alt="Green 1929" /></a></p> <p><a href="#" id="close3">Close</a> </p> </div> </div> <a href="#" id="click">1970s Cans</a> <div id="box" align="center"> <div id="showhideconent4"> <p><a href="coke/tincans.shtml"><img src="coke_tincan.jpg" width="200" height="200" alt="Tin Cans" /></a></p> <p><a href="#" id="close4">Close</a> </p> </div> </div> </body> </html>

    Read the article

  • Looping an executable to get the result from Python script

    - by fx
    In my python script, I need to call within a for loop an executable, and waiting for that executable to write the result on the "output.xml". How do I manage to use wait() & how do I know when one of my executable is finished generating the result to get the result? How do I close that process and open a new one to call again the executable and wait for the new result? import subprocess args = ("bin/bar") popen = subprocess.Popen(args) I need to wait for the output from "bin/bar" to generate the "output.xml" and from there, read it's content. for index, result in enumerate(results): myModule.callSubProcess(index) #this is where the problem is. fileOutput = open("output.xml") parseAndStoreInSQLiteFileOutput(index, file)

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >