Search Results

Search found 22267 results on 891 pages for 'org mode'.

Page 533/891 | < Previous Page | 529 530 531 532 533 534 535 536 537 538 539 540  | Next Page >

• Computer hanged in the middle of bios flashing process

  - by Stalker

  I have a laptop: Toshiba Satellite c660-17j, today I decided to update BIOS. I've downloaded bios updater from manufacturer's web site, and in the middle of flashing process computer hanged. I was waiting more than 30 minutes, but nothing was changed on the screen, i've tryed to PRESS MORE BUTTONS, but there were no reactions, so i've turned it off by removing battery (all other methods failed, even pressing power button for ~10 secs). After that computer can't start. I understand, that there's MESS in BIOS chip, and it's possible to re-flash it with hardware programmer, but I don't have it. I remember, that on some PCs (even on my eeepc) there was possibility to re-flash bios by inserting usb flash-disk (with .dat file on it, which contained BIOS), and power on PC, while holding some keys combination, then PC was switching to BIOS programming mode and re-flashed BIOS, after that it was possible to boot up normaly. Is there a way to recover computer without hardware programming BIOS chip? p.s. sorry for my english.

  Read the article

• Seeing DNS changes takes too long on my PC, can it be my router misconfiguration?

  - by Borek

  I administer a few sites and need to update their DNS entries from time to time, e.g., adding an A-record point certain subdomain to a certain IP. When I check sites like http://www.opendns.com/support/cache/, I can clearly see the DNS change taking effect throughout the world - is it just my PC that can't see this change (ping newsubdomain.example.org says it cannot resolve host name) The network "map" is like this: My PC -> my router -> my ISP's router -> internet On my PC, the DNS is set automatically which means that if I run iconfig /all, my router will be returned as the DNS server (192.168.1.1). On my router, the DNS is set to be what my ISP provided me with. Is this correct? What can I do to see new hostnames resolved quicker?

  Read the article

• How to configure installed Ruby and gems?

  - by NARKOZ

  My current gem env returns: RubyGems Environment: - RUBYGEMS VERSION: 1.3.6 - RUBY VERSION: 1.8.7 (2008-08-11 patchlevel 72) [x86_64-linux] - INSTALLATION DIRECTORY: /home/USERNAME/.gems - RUBYGEMS PREFIX: /home/narkoz - RUBY EXECUTABLE: /usr/bin/ruby1.8 - EXECUTABLE DIRECTORY: /home/USERNAME/.gems/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/USERNAME/.gems - /usr/lib/ruby/gems/1.8 - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gempath" => ["/home/USERNAME/.gems", "/usr/lib/ruby/gems/1.8"] - "gemhome" => "/home/USERNAME/.gems" - REMOTE SOURCES: - http://rubygems.org/ How can I change path /home/USERNAME/ to my own without uninstalling? OS: Debian Linux

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• Windows 8: User profile service service failed the login. User Profile can not be loaded

  - by Ryanmt

  I removed accounts that were hosted on a separate drive before upgrading to windows 8 from 7 yesterday. However, now I get the User profile service service failed the login. User Profile can not be loaded. error whenever I try to access any new account. I've attempted it: from safe mode (suggestions here ) net user test \ADD Editing the permissions on the %sysdrive%\Users\Default folder to ensure it is readable Every attempt is met with the same error. Additionally, I do not see any new entries created in the HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\ProfileList registry entry. I'm not sure I understand why a failed user creation wouldn't trigger an error... but that seems to be what is happening here.

  Read the article

• Accessing our Intranet from outside our Network - WITHOUT VPN

  - by westexasman

  We just upgraded our company intranet from an IIS based, ASP (poorly written) server/code base to a Windows Server 2008 r2 (Apache/MySQL/PHP) server. The old server allowed users to login to intranet.xxx.org using there AD user/pass which then lead them to the company Intranet from basically anywhere they had Internet access. We want to mimic that functionality (or change it to something more secure) with the new setup. This was seemingly setup for off-site employees running on a state network. The state network does not allow VPN, therefor, we needed a way to allow those employees access to the Intranet. So, how do we go about allowing users to login from the outside world and gain access to our Intranet?

  Read the article

• It takes a long time until windows xp recognize I connected USB diks

  - by Pavol G

  Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

  Read the article

• I can see markup characters in vim `:help`

  - by Relax

  I just created a .txt file inside .vim/doc for documenting one little function of my .vimrc, ran :helptags ~/.vim/doc and apparently the whole vim help system went wild. Now, if I open for example :help help, I see things like: This also works together with other characters, for example to find help for CTRL-V in Insert mode: > :help i^V < (notice the < and characters). I can also see the ~ at the end of headlines and the modeline at the end of the help page (thinks like vim:tw=78:ts=8:ft=help:norl:). I have no idea about what happens or how to fix it. Any clue? Thanks in advance!

  Read the article

• Http Hanlder must be reset with each deployment. How can I add this functionality to the web.config

  - by user42942

  My application is a dotnet 4 hybrid - MVC in some areas, web forms in others. This application was recently upgraded to dotnet 4 and includes a lot of older code and some mismatched parts. Unfortunately it includes a telerik component that requires me to run the Application pool in classic mode. In order to fix this (in IIS7) I have to add a handler mapping to the IIS configuration. This mapping is basically a wildcard mapping that points the wildcard path "*" to the %windir%\Microsoft.NET\Framework64\v4.0.30319\aspnet_isapi.dll. The problem I am running into is this: For some reason this mapping gets dropped when deploying the site. So, can I add the functionality of this mapping to the web config? If so, How? Or is there another solution to make this manually added mapping "sticky" so that it remains in place during and after a deployment? (I am also asking this on StackOverflow, as I'm not sure if this should be a coding question or a Server question)

  Read the article

• How to combine with openvpn, dynamic-ip?

  - by asfasdv

  Dear everyone, I am currently using openvpn to surf online to bypass censorship. Let me show you the initial scenario: before openvpn is turned on: IP: 1.2.3.4 (hypothetical, checked by visiting whatismyip.com/) after openvpn is turned on IP: 10.2.3.4 (this is also checked with whatismyip.com/, I assume this is where the vpn's exit point's IP ) Situation: Once I enable openvpn, I can still ssh into this computer by sshing into 1.2.3.4, even though visiting whatismyip.com/ says it's 10.2.3.4. However, I am on dynamic IP, I run a website, and am using tools (inadyn in particular) which pings the freedns.afraid.org (my dns server) and updates my ip. The messed up part is when inadyn does so, my dns changes the ip to 10.2.3.4, which is presumably the exit point of my vpn. How do I get around this? (Note that sshing into 1.2.3.4 STILL works).

  Read the article

• Non interactive git clone (ssh fingerprint prompt)

  - by qwe

  I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

  Read the article

• Vim Misbehaving

  - by zchtodd

  I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Set an Excel cell's color based on multiple other cells' colors

  - by Lord Torgamus

  I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

  Read the article

• Microsoft mouse screws up my power settings

  - by Patriot

  Running a new computer with Windows 7 and 64-bit OS. Had a wireless Logitech mouse that worked perfectly with this set up. The mouse was old, and the buttons were sticking and causing double clicks, so I bought a new Microsoft Mobile Wireless 3000 mouse to replace it. The new mouse works perfectly, but now my screen saver is disabled and my computer won't go into sleep mode after 15 minutes as per my power setting. If I hook the Logitech mouse back up, screen saver works fine and computer goes to sleep as it should. Am I missing something, or is Microsoft's mouse just junk. Got no software with the new mouse, so no drivers seem available.

  Read the article

• Ubuntu 6.06 Boot problem

  - by nijikunai

  I tried to boot my pc using ubuntu 6.06 in the live cd mode but it refuses to boot. It throws the error Uncompressing Linux.. ok, booting from kernel [ 54.168828] ACPI Unable to load the System Descriptor Tables The live cd works perfectly okay in other computers. Out of curiosity, I also tried to boot using Slax live cd, It too threw some errors incomplete literal tree invalid compressed format (err=1) UDF-fs: No partition found (1) XFS: bade magic number XFS: SB validate failed Kernel panic - not syncing: VFS: Unable to mount root fs on unknown-block(1,0) The slax errors are a bit worrying to me. Thanks for the help in advance!

  Read the article

• Redirecting HTTP traffic from a local server on the web

  - by MrJackV

  Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

  Read the article

• unable to transfer files from handy cam to PC

  - by user143989

  I am using a Windows 7 PC,I am using sony dcr -sr88 handy cam . I need to transfer all my videos from handycam to my PC. when i try to connect to the PC through USB. it detects the usb drive in the Handycam on my PC and shows the used memory. But when i open the folder it shows "folder is empty". How i can copy the files? I have tried following: Changed the USB cable CHanged the USB port I can play the videos through handicam, but those files not visible in PC when connected in USB mode. Please help ..bit urgent!

  Read the article

• time on files differ by 1 sec. FAIL Robocopy sync

  - by csmba

  I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

  Read the article

• full-screen browsing with IE10 on Windows 8

  - by Tom

  I have updated to Windows 8 and got Internet Explorer 10, but I don't get the full screen mode, is just like another desktop app. All links on the Windows Store Apps (Bing, News...) redirect to the old desktop and open my default browser (chrome). I have set IE as default browser but that not solve the problem. I have been looking on the IE10 options but I don't see this option. How can I solve this? Maybe this info help: Windows version: Windows 8 Pro 64 bits Installed Browsers: Firefox, Chrome (default), Opera, IE10 I have seem other people with the same version and is working Edit: Is possible to have IE10 by default for windows 8 apps links and Chrome for Desktop?

  Read the article

• full-screen browsing with IE10 on Windows 8

  - by Tom

  I have updated to Windows 8 and got Internet Explorer 10, but I don't get the full screen mode, is just like another desktop app. All links on the Windows Store Apps (Bing, News...) redirect to the old desktop and open my default browser. I have been looking on the IE10 options but I don't see this option. How can I solve this? Maybe this info help: Windows version: Windows 8 Pro 64 bits Installed Browsers: Firefox, Chrome (default), Opera, IE10 I have seem other people with the same version and is working

  Read the article

• Why my browsers display XML files as blank pages?

  - by n1313

  Every time I open an XML file, all I get is blank page instead of tag tree. The file itself is correct and loads okay, I can see it via View Source or in the Firebug. I've tried turning off all my addons and tried running Firefox in safe mode, but the problem was not solved. I'm guessing that I've messed up my configuration somehow and Firefox now tries to render XML files as HTML ones. I've tried googling, but with no success. Help, please? UPD: example file: http://lj.lain.ru/3/1273657698603.sample.xml Also I've noticed that somehow all of the browsers on the machine are now acting the same, so I'm changing the question accordingly

  Read the article

• Install Composer on Ubuntu

  - by Milos

  I am trying to install composer with the command: sudo curl -s https://getcomposer.org/installer | php And I am getting this error: All settings correct for using Composer Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied The download failed repeatedly, aborting. I don't know why? Do you have an idea? I tryed to google it but nothing.

  Read the article

• how to get a decent emacs setup on linux

  - by Hersheezy

  I am currently interested in switching from vim to emacs. One of the more compelling reasons for this is the smooth integration with a unix environment. The most experienced emacs users I have seen have a bash prompt at the bottom of their window, with stdout going to a buffer right above it. They then interact with the output of programs such as grep in interesting ways. I am on Ubuntu 10.04 and the default emacs environment does not seem to do much for me in the way of integration. For example, in the M-x shell mode, output from basic commands like ls produce lots of strange characters and hitting the up arrow does not go to previous commands. Any recommendations on a good direction to go in?

  Read the article

• Problem starting X in unbuntu 10.10

  - by xain

  Hi, I recently installed ubuntu 10.10 on my old toshiba a100 (where I've been running XP with no problems for ages). The installation went fine, I can log in with my user account, but after that the screen has only the wallpaper (and the mouse is enabled). Any hints on how to troubleshoot it ? These are the Xorg and the messages log files. Thanks When booted in safe graphics mode it worked just fine. Is there a way to set that configuration as the default so I don't have to go through those menus every time I boot ?

  Read the article

< Previous Page | 529 530 531 532 533 534 535 536 537 538 539 540  | Next Page >